HHsearch alignment for GI: 254780270 and conserved domain: cd03294

>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.60  E-value=0.014  Score=38.40  Aligned_cols=38  Identities=24%  Similarity=0.447  Sum_probs=27.6

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             46735998605656502799999977088249986188
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGG  401 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg  401 (820)
T Consensus        48 ~~GE~~~ivG~SGsGKSTLLr~i~GL~~p~~G~I~~~G   85 (269)
T cd03294          48 REGEIFVIMGLSGSGKSTLLRCINRLIEPTSGKVLIDG   85 (269)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECC
T ss_conf             89999999989984899999999759999975999999