HHsearch alignment for GI: 254780270 and conserved domain: cd03369

>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1). NFT1 belongs to the MRP (mulrtidrug resisitance-associated protein) family of ABC transporters. Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions such as glutathione, glucuronate, and sulfate.
Probab=94.37  E-value=0.06  Score=33.59  Aligned_cols=39  Identities=21%  Similarity=0.405  Sum_probs=32.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             467359986056565027999999770882499861888
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGV  402 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~  402 (820)
T Consensus        32 ~~Ge~v~ivG~sGsGKSTLl~ll~g~~~p~~G~I~idg~   70 (207)
T cd03369          32 KAGEKIGIVGRTGAGKSTLILALFRFLEAEEGKIEIDGI   70 (207)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCEEEECCE
T ss_conf             699999999999987999999999872888878999999