Query         gi|254780270|ref|YP_003064683.1| ATP-dependent protease La [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 820
No_of_seqs    267 out of 2355
Neff          5.8 
Searched_HMMs 39220
Date          Tue May 24 11:15:32 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780270.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR00763 lon ATP-dependent pr 100.0       0       0 2345.2  61.2  759   29-787     1-941 (941)
  2 PRK10787 DNA-binding ATP-depen 100.0       0       0 2210.9  83.7  777   22-798     5-782 (784)
  3 COG0466 Lon ATP-dependent Lon  100.0       0       0 2183.2  76.4  769   27-795     9-781 (782)
  4 KOG2004 consensus              100.0       0       0 1865.7  64.3  773   20-792    61-902 (906)
  5 pfam05362 Lon_C Lon protease ( 100.0       0       0  554.3  21.6  204  585-788     1-204 (205)
  6 TIGR02903 spore_lon_C ATP-depe 100.0       0       0  496.9  28.8  466  215-787    76-616 (616)
  7 TIGR02902 spore_lonB ATP-depen 100.0       0       0  443.2  27.3  417  286-787    34-532 (532)
  8 PRK13765 ATP-dependent proteas 100.0       0       0  382.3  31.1  352  411-793   214-608 (637)
  9 COG1067 LonB Predicted ATP-dep 100.0 1.5E-38 3.9E-43  310.7  28.7  345  433-791   225-623 (647)
 10 pfam02190 LON ATP-dependent pr 100.0 6.2E-30 1.6E-34  245.5  22.7  190   27-219     1-193 (193)
 11 COG2802 Uncharacterized protei  99.9 1.9E-25   5E-30  211.4  20.0  198   23-223     7-210 (221)
 12 TIGR00764 lon_rel ATP-dependen  99.9 1.9E-24 4.7E-29  204.0  14.6  383  388-792   204-652 (662)
 13 TIGR03346 chaperone_ClpB ATP-d  99.9 1.5E-19 3.8E-24  166.9  29.0  262  306-580   531-834 (852)
 14 TIGR03345 VI_ClpV1 type VI sec  99.9   7E-19 1.8E-23  161.8  28.0  434  121-578   332-837 (852)
 15 PRK10865 protein disaggregatio  99.9 9.9E-19 2.5E-23  160.7  28.4  259  309-580   537-837 (857)
 16 PRK11034 clpA ATP-dependent Cl  99.8 2.9E-17 7.3E-22  149.6  23.7  301  267-580   380-724 (758)
 17 CHL00095 clpC Clp protease ATP  99.8 1.5E-16 3.9E-21  144.1  26.6  260  308-580   477-792 (823)
 18 COG0542 clpA ATP-binding subun  99.8 1.6E-15 4.2E-20  136.3  25.7  263  312-589   463-775 (786)
 19 PRK11823 DNA repair protein Ra  99.7 8.1E-17 2.1E-21  146.2  12.6  343  362-788    86-453 (454)
 20 CHL00195 ycf46 Ycf46; Provisio  99.7 1.8E-14 4.7E-19  128.3  23.4  214  340-596   229-461 (491)
 21 PRK03992 proteasome-activating  99.7 1.3E-15 3.2E-20  137.1  17.2  224  339-599   132-374 (390)
 22 COG1750 Archaeal serine protea  99.7 5.7E-16 1.5E-20  139.8  11.7  166  623-795    48-216 (579)
 23 TIGR02639 ClpA ATP-dependent C  99.7 6.4E-15 1.6E-19  131.8  16.5  294  270-579   407-762 (774)
 24 pfam00004 AAA ATPase family as  99.7 2.8E-16 7.2E-21  142.1   8.9  119  369-508     1-130 (131)
 25 PRK13342 recombination factor   99.7 4.7E-15 1.2E-19  132.8  15.0  193  363-604    34-230 (417)
 26 pfam07724 AAA_2 AAA domain (Cd  99.7 6.9E-16 1.8E-20  139.1  10.1  115  368-492     5-126 (168)
 27 PRK04195 replication factor C   99.6 4.1E-14   1E-18  125.7  17.2  189  318-561     2-200 (403)
 28 TIGR02653 Lon_rel_chp conserve  99.6 3.5E-15   9E-20  133.7  11.5  180  607-787   493-674 (677)
 29 PRK05201 hslU ATP-dependent pr  99.6 1.5E-13 3.9E-18  121.4  19.2  262  329-599     5-432 (442)
 30 PRK05342 clpX ATP-dependent pr  99.6 3.7E-13 9.4E-18  118.5  20.4  254  330-594    63-401 (411)
 31 PRK13341 recombination factor   99.6 1.3E-13 3.3E-18  121.9  16.0  190  367-602    53-251 (726)
 32 CHL00176 ftsH cell division pr  99.6 4.6E-13 1.2E-17  117.7  18.1  218  335-594   173-413 (631)
 33 COG0464 SpoVK ATPases of the A  99.6 1.3E-13 3.3E-18  121.9  15.3  221  340-597   243-482 (494)
 34 pfam05496 RuvB_N Holliday junc  99.6 4.4E-13 1.1E-17  117.9  17.1  198  339-573    24-230 (234)
 35 COG0714 MoxR-like ATPases [Gen  99.6   8E-14   2E-18  123.5  13.1  173  329-523    14-203 (329)
 36 PRK00440 rfc replication facto  99.6 9.8E-13 2.5E-17  115.2  17.5  215  315-599     1-226 (318)
 37 CHL00181 cbbX CbbX; Provisiona  99.5 3.7E-12 9.3E-17  110.9  19.1  227  327-591    11-271 (287)
 38 pfam07728 AAA_5 AAA domain (dy  99.5 2.7E-14   7E-19  127.0   6.8  126  369-502     2-139 (139)
 39 PRK00080 ruvB Holliday junctio  99.5 2.3E-12   6E-17  112.4  15.5  178  339-551    25-211 (328)
 40 TIGR00382 clpX ATP-dependent C  99.5 3.1E-13 7.9E-18  119.1  10.7  274  288-595    65-447 (452)
 41 PRK10733 hflB ATP-dependent me  99.5   5E-12 1.3E-16  109.9  16.7  217  337-594   150-388 (644)
 42 KOG0731 consensus               99.5 9.7E-12 2.5E-16  107.7  16.6  167  336-528   308-500 (774)
 43 PRK00411 cdc6 cell division co  99.5 8.7E-11 2.2E-15  100.5  20.7  222  344-595    35-279 (394)
 44 COG1066 Sms Predicted ATP-depe  99.5 7.3E-12 1.9E-16  108.6  15.2  184  582-787   266-454 (456)
 45 PRK12402 replication factor C   99.5 1.5E-12 3.9E-17  113.8  11.5  191  316-551     1-215 (337)
 46 COG2256 MGS1 ATPase related to  99.4 7.3E-12 1.8E-16  108.7  14.4  184  368-600    50-240 (436)
 47 COG1223 Predicted ATPase (AAA+  99.4 1.1E-11 2.8E-16  107.4  14.7  250  304-599    92-356 (368)
 48 cd00009 AAA The AAA+ (ATPases   99.4 1.2E-12 2.9E-17  114.7   9.6  132  358-507    11-149 (151)
 49 PRK05563 DNA polymerase III su  99.4 1.1E-11 2.7E-16  107.4  13.8  213  339-598    16-244 (541)
 50 COG2255 RuvB Holliday junction  99.4 4.3E-11 1.1E-15  102.8  16.4  179  338-551    25-212 (332)
 51 PRK07270 DNA polymerase III su  99.4 1.6E-11   4E-16  106.1  13.0  189  339-568    15-223 (557)
 52 pfam07726 AAA_3 ATPase family   99.4   1E-12 2.6E-17  115.1   6.7  117  369-502     2-129 (131)
 53 KOG0738 consensus               99.4 1.9E-11 4.9E-16  105.5  13.2  228  339-596   212-467 (491)
 54 PRK06647 DNA polymerase III su  99.4 1.9E-11 4.8E-16  105.6  12.6  213  339-598    16-244 (560)
 55 PRK06305 DNA polymerase III su  99.4 1.9E-11 4.8E-16  105.5  12.0  211  340-598    18-246 (462)
 56 PRK06674 DNA polymerase III su  99.4   2E-10 5.2E-15   97.7  17.3  209  339-598    16-244 (563)
 57 PRK05896 DNA polymerase III su  99.3 1.8E-10 4.7E-15   98.1  16.7  212  339-597    16-243 (613)
 58 KOG0730 consensus               99.3 2.2E-10 5.7E-15   97.4  15.7  221  337-596   432-672 (693)
 59 KOG0736 consensus               99.3 1.8E-10 4.5E-15   98.2  14.5  147  365-527   430-580 (953)
 60 PRK08451 DNA polymerase III su  99.3   6E-11 1.5E-15  101.7  11.4  208  339-597    14-241 (523)
 61 PRK09862 putative ATP-dependen  99.3 8.1E-10 2.1E-14   93.2  17.1  225  340-600   192-494 (506)
 62 PRK06645 DNA polymerase III su  99.3 9.1E-11 2.3E-15  100.3  12.0  215  340-598    22-256 (507)
 63 PRK13407 bchI magnesium chelat  99.3 7.1E-10 1.8E-14   93.6  16.5  227  340-595     9-303 (334)
 64 PRK07133 DNA polymerase III su  99.3 3.1E-10 7.9E-15   96.3  14.6  190  339-570    18-225 (718)
 65 KOG0733 consensus               99.3 1.2E-10 3.1E-15   99.4  12.3  193  339-565   190-416 (802)
 66 COG1220 HslU ATP-dependent pro  99.3 2.6E-09 6.5E-14   89.4  18.5  169  424-598   241-433 (444)
 67 COG1219 ClpX ATP-dependent pro  99.3 1.5E-10 3.8E-15   98.8  11.9  259  330-599    52-395 (408)
 68 KOG0745 consensus               99.2 6.4E-10 1.6E-14   93.9  14.9  216  369-592   229-528 (564)
 69 COG1222 RPT1 ATP-dependent 26S  99.2 1.9E-10 4.8E-15   98.0  11.9  219  338-595   150-389 (406)
 70 KOG1051 consensus               99.2 4.2E-09 1.1E-13   87.7  18.6  164  317-492   539-711 (898)
 71 COG4930 Predicted ATP-dependen  99.2 1.4E-10 3.6E-15   99.0  10.7  196  586-784   475-678 (683)
 72 CHL00081 chlI Mg-protoporyphyr  99.2   4E-09   1E-13   87.9  17.5  229  341-595    14-314 (347)
 73 TIGR00635 ruvB Holliday juncti  99.2 1.9E-10 4.9E-15   97.9  10.0  178  340-552     5-191 (305)
 74 TIGR01241 FtsH_fam ATP-depende  99.2 2.3E-11 5.9E-16  104.8   4.1  285  339-673    59-422 (505)
 75 KOG0733 consensus               99.1 1.8E-09 4.5E-14   90.6  13.1  222  339-598   511-769 (802)
 76 KOG4159 consensus               99.1 4.7E-10 1.2E-14   95.0   8.9  191   23-221   172-370 (398)
 77 KOG0734 consensus               99.1 1.8E-08 4.7E-13   82.9  17.0  280  326-654   291-606 (752)
 78 COG0470 HolB ATPase involved i  99.1 4.1E-09 1.1E-13   87.8  13.1  154  340-519     2-177 (325)
 79 PRK11361 acetoacetate metaboli  99.1 2.1E-08 5.3E-13   82.5  16.2  205  363-596   164-391 (457)
 80 PRK05022 anaerobic nitric oxid  99.1 1.2E-08   3E-13   84.4  14.6  208  363-591   207-435 (510)
 81 KOG0989 consensus               99.1 3.7E-09 9.4E-14   88.2  11.6  166  364-569    55-235 (346)
 82 TIGR00416 sms DNA repair prote  99.1 4.6E-10 1.2E-14   95.0   6.9  343  364-783   101-481 (481)
 83 PRK10820 DNA-binding transcrip  99.1 2.3E-08 5.7E-13   82.2  15.2  184  362-568   224-426 (513)
 84 KOG0651 consensus               99.0 1.7E-09 4.4E-14   90.7   9.4  185  348-560   138-353 (388)
 85 COG1474 CDC6 Cdc6-related prot  99.0 5.7E-08 1.5E-12   79.2  17.0  204  360-594    37-261 (366)
 86 pfam00493 MCM MCM2/3/5 family.  99.0 6.4E-09 1.6E-13   86.4  12.0  201  335-553    20-271 (327)
 87 KOG2028 consensus               99.0 2.1E-08 5.3E-13   82.5  14.5  207  358-605   154-375 (554)
 88 PRK07764 DNA polymerase III su  99.0   9E-09 2.3E-13   85.2  12.3  188  340-569    16-226 (775)
 89 COG3480 SdrC Predicted secrete  99.0 8.1E-10 2.1E-14   93.2   6.7   97  687-785   230-337 (342)
 90 TIGR01243 CDC48 AAA family ATP  99.0 2.1E-07 5.5E-12   74.8  18.5  217  338-596   540-784 (980)
 91 PRK11608 pspF phage shock prot  99.0 3.6E-08 9.1E-13   80.7  14.3  190  362-569    26-237 (325)
 92 PRK10923 glnG nitrogen regulat  99.0   2E-08   5E-13   82.7  12.9  202  363-594   159-384 (469)
 93 TIGR03420 DnaA_homol_Hda DnaA   99.0 4.4E-08 1.1E-12   80.0  14.6  186  357-595    29-225 (226)
 94 TIGR01242 26Sp45 26S proteasom  99.0 8.3E-09 2.1E-13   85.5  10.8  175  334-529   117-312 (364)
 95 PRK05564 DNA polymerase III su  99.0 2.3E-08   6E-13   82.1  12.7  143  339-517     4-159 (313)
 96 PRK10365 transcriptional regul  99.0 1.5E-08 3.7E-13   83.7  11.6  202  363-593   160-384 (441)
 97 TIGR02397 dnaX_nterm DNA polym  99.0 2.6E-08 6.7E-13   81.7  12.6  193  361-598    31-244 (363)
 98 KOG0743 consensus               99.0 1.7E-07 4.2E-12   75.7  16.5  176  368-572   237-435 (457)
 99 KOG0737 consensus               99.0 6.4E-08 1.6E-12   78.8  14.4  203  340-577    93-312 (386)
100 PRK08853 DNA polymerase III su  98.9 2.2E-08 5.7E-13   82.2  11.7  173  358-562    30-218 (717)
101 pfam06068 TIP49 TIP49 C-termin  98.9 4.8E-08 1.2E-12   79.7  13.4  190  359-559    43-383 (395)
102 PRK11388 DNA-binding transcrip  98.9 6.2E-08 1.6E-12   78.9  13.6  203  363-595   346-568 (639)
103 COG0465 HflB ATP-dependent Zn   98.9 4.9E-08 1.2E-12   79.7  12.7  182  325-522   129-332 (596)
104 PRK11331 5-methylcytosine-spec  98.9 5.6E-08 1.4E-12   79.2  12.8  137  364-510   193-358 (459)
105 PRK09112 DNA polymerase III su  98.9 1.8E-08 4.6E-13   83.0   9.6  186  338-564    22-241 (352)
106 PRK08691 DNA polymerase III su  98.9   3E-08 7.5E-13   81.3  10.6  184  341-561    18-217 (704)
107 KOG0740 consensus               98.9 3.3E-08 8.3E-13   81.0  10.7  203  339-575   153-370 (428)
108 PTZ00112 origin recognition co  98.9 1.6E-07 4.1E-12   75.8  14.1  212  342-592   270-507 (650)
109 PRK09111 DNA polymerase III su  98.9 6.8E-08 1.7E-12   78.6  11.9  198  359-598    38-256 (600)
110 PRK06893 DNA replication initi  98.9 5.1E-07 1.3E-11   72.0  16.1  187  358-596    31-228 (229)
111 PRK07003 DNA polymerase III su  98.8 5.8E-08 1.5E-12   79.1  11.0  171  358-560    30-216 (816)
112 PRK07994 DNA polymerase III su  98.8   7E-08 1.8E-12   78.5  11.0  171  363-565    35-221 (643)
113 PRK05648 DNA polymerase III su  98.8 2.2E-07 5.7E-12   74.7  12.4  197  359-597    31-243 (705)
114 COG2812 DnaX DNA polymerase II  98.8 1.3E-07 3.3E-12   76.5  11.2  211  342-599    19-245 (515)
115 KOG0744 consensus               98.8 4.2E-08 1.1E-12   80.2   8.6  164  341-521   145-338 (423)
116 KOG0728 consensus               98.8 7.6E-08 1.9E-12   78.2   9.9  139  364-523   179-331 (404)
117 KOG0730 consensus               98.8 9.7E-07 2.5E-11   69.9  15.5  171  365-578   217-403 (693)
118 PRK08903 hypothetical protein;  98.8 6.6E-07 1.7E-11   71.1  14.3  178  363-598    39-226 (227)
119 smart00464 LON Found in ATP-de  98.8 1.7E-08 4.2E-13   83.2   5.9   91   27-216     1-92  (92)
120 PRK06872 DNA polymerase III su  98.7 3.3E-07 8.3E-12   73.4  12.2  167  358-560    30-216 (696)
121 PRK05642 DNA replication initi  98.7   1E-06 2.6E-11   69.7  14.4  179  365-596    44-233 (234)
122 KOG0727 consensus               98.7 3.5E-07 8.8E-12   73.2  11.9  216  339-593   155-391 (408)
123 PRK07471 DNA polymerase III su  98.7 1.5E-07 3.8E-12   76.0  10.0  154  339-517    17-205 (363)
124 KOG0739 consensus               98.7 1.6E-07   4E-12   75.8  10.1  154  340-508   134-297 (439)
125 smart00350 MCM minichromosome   98.7 4.4E-07 1.1E-11   72.4  12.3  170  336-523   200-400 (509)
126 TIGR02928 TIGR02928 orc1/cdc6   98.7 1.8E-06 4.7E-11   67.7  15.5  212  363-595    40-285 (383)
127 KOG0478 consensus               98.7 2.2E-07 5.7E-12   74.7  10.5  244  337-595   427-721 (804)
128 TIGR01243 CDC48 AAA family ATP  98.7 1.7E-07 4.3E-12   75.6   9.8  160  340-521   207-388 (980)
129 KOG0735 consensus               98.7 3.7E-07 9.5E-12   73.0  11.5  227  361-625   426-672 (952)
130 PRK12323 DNA polymerase III su  98.7 6.6E-07 1.7E-11   71.1  12.6  167  359-561    31-222 (721)
131 KOG0736 consensus               98.7 5.6E-07 1.4E-11   71.7  11.7  222  339-595   672-929 (953)
132 COG1239 ChlI Mg-chelatase subu  98.7 5.2E-07 1.3E-11   71.9  11.3  227  341-595    19-319 (423)
133 PRK08084 DNA replication initi  98.7   3E-06 7.6E-11   66.2  15.1  186  356-595    35-233 (235)
134 smart00763 AAA_PrkA PrkA AAA d  98.7 1.6E-06 4.2E-11   68.1  13.8   55  337-391    49-103 (361)
135 PHA02244 ATPase-like protein    98.7 2.9E-07 7.3E-12   73.9   9.8  178  369-571   122-322 (383)
136 COG1224 TIP49 DNA helicase TIP  98.7 5.3E-07 1.3E-11   71.9  11.1  189  360-559    59-399 (450)
137 TIGR00368 TIGR00368 Mg chelata  98.7   3E-07 7.6E-12   73.7   9.7  153  621-785     6-162 (505)
138 TIGR02881 spore_V_K stage V sp  98.7 1.6E-06 4.2E-11   68.2  13.4  200  341-581     8-247 (261)
139 KOG2170 consensus               98.6 7.7E-08   2E-12   78.2   6.6  159  325-502    68-237 (344)
140 PRK07399 DNA polymerase III su  98.6 1.8E-06 4.6E-11   67.8  12.9  161  339-524     4-196 (314)
141 COG2204 AtoC Response regulato  98.6 3.3E-06 8.4E-11   65.8  14.2  184  363-566   162-368 (464)
142 PRK07132 DNA polymerase III su  98.6 8.2E-07 2.1E-11   70.4  10.8  145  349-516     4-157 (303)
143 PRK08770 DNA polymerase III su  98.6   8E-07   2E-11   70.5  10.6  197  360-598    32-244 (663)
144 COG1241 MCM2 Predicted ATPase   98.6 2.2E-07 5.5E-12   74.8   7.5  197  337-553   284-539 (682)
145 pfam00158 Sigma54_activat Sigm  98.6 3.3E-07 8.5E-12   73.4   8.2  130  363-507    20-167 (168)
146 smart00382 AAA ATPases associa  98.6 2.2E-07 5.7E-12   74.7   7.3  127  365-502     1-138 (148)
147 PRK08058 DNA polymerase III su  98.6 2.9E-07 7.5E-12   73.8   7.8  133  359-516    21-175 (329)
148 KOG0652 consensus               98.6 6.6E-07 1.7E-11   71.1   9.4  161  340-522   172-354 (424)
149 PRK11034 clpA ATP-dependent Cl  98.6 1.9E-06 4.9E-11   67.6  11.7  178  341-552   188-385 (758)
150 COG5271 MDN1 AAA ATPase contai  98.6 1.5E-06 3.9E-11   68.4  11.1  146  368-525  1545-1704(4600)
151 KOG0991 consensus               98.5 2.8E-07 7.1E-12   74.0   6.9  218  316-599    13-238 (333)
152 KOG1969 consensus               98.5 2.6E-06 6.6E-11   66.7  11.7  161  365-560   325-506 (877)
153 PRK08727 hypothetical protein;  98.5 1.2E-05 2.9E-10   61.7  15.0  181  363-596    38-229 (233)
154 PRK07940 DNA polymerase III su  98.5 5.2E-07 1.3E-11   71.9   7.9  159  340-517     6-186 (395)
155 COG3829 RocR Transcriptional r  98.5 3.4E-06 8.6E-11   65.8  11.8  199  358-595   261-495 (560)
156 COG0606 Predicted ATPase with   98.5 6.7E-07 1.7E-11   71.1   8.1  142  340-511   180-380 (490)
157 pfam00308 Bac_DnaA Bacterial d  98.5 4.7E-07 1.2E-11   72.2   7.0  172  368-574    36-218 (219)
158 PRK09862 putative ATP-dependen  98.5 3.2E-06 8.3E-11   65.9  11.0  162  612-786     4-167 (506)
159 PTZ00111 DNA replication licen  98.4 1.5E-06 3.9E-11   68.4   8.4  164  337-527   449-666 (916)
160 PRK08769 DNA polymerase III su  98.4 2.6E-06 6.5E-11   66.7   9.2  147  344-517     9-179 (319)
161 TIGR03015 pepcterm_ATPase puta  98.4 0.00011 2.8E-09   54.3  17.4  199  365-595    42-263 (269)
162 CHL00095 clpC Clp protease ATP  98.4 9.5E-06 2.4E-10   62.3  11.8  174  341-550   181-375 (823)
163 PRK10865 protein disaggregatio  98.4 1.1E-05 2.8E-10   61.9  12.0  178  340-551   179-376 (857)
164 KOG0726 consensus               98.4 1.7E-07 4.4E-12   75.5   2.6  168  332-522   178-368 (440)
165 TIGR03346 chaperone_ClpB ATP-d  98.4 1.2E-05 3.2E-10   61.5  11.8  180  340-553   174-373 (852)
166 KOG0735 consensus               98.3 1.2E-05   3E-10   61.7  11.2  205  339-580   667-893 (952)
167 PRK05917 DNA polymerase III su  98.3   3E-06 7.8E-11   66.1   7.9  125  360-509    13-153 (290)
168 PRK04132 replication factor C   98.3 1.1E-06 2.9E-11   69.3   4.8   98  480-600   673-771 (863)
169 TIGR03345 VI_ClpV1 type VI sec  98.2 2.1E-05 5.3E-10   59.8  10.5  179  336-550   185-384 (852)
170 PRK09087 hypothetical protein;  98.2 0.00012   3E-09   54.1  14.1  173  362-596    40-220 (226)
171 PRK05707 DNA polymerase III su  98.2 4.7E-05 1.2E-09   57.1  12.1  133  366-517    22-172 (328)
172 COG3604 FhlA Transcriptional r  98.2 1.7E-05 4.2E-10   60.5   9.7  173  364-569   245-453 (550)
173 KOG0741 consensus               98.2   2E-05 5.1E-10   59.9  10.0  164  363-553   255-440 (744)
174 KOG0732 consensus               98.2 1.1E-05 2.8E-10   61.8   8.6  356  340-753   266-660 (1080)
175 PRK12422 chromosomal replicati  98.2 8.2E-06 2.1E-10   62.8   7.9  179  368-579   143-328 (455)
176 TIGR02880 cbbX_cfxQ CbbX prote  98.2 2.9E-05 7.4E-10   58.7  10.3  176  327-527    10-212 (284)
177 PRK08939 primosomal protein Dn  98.2   6E-05 1.5E-09   56.3  11.5   88  349-444   142-229 (306)
178 TIGR01817 nifA Nif-specific re  98.2 9.1E-06 2.3E-10   62.5   7.3  277  349-682   222-571 (574)
179 COG0542 clpA ATP-binding subun  98.1 5.3E-05 1.3E-09   56.7  11.1  174  340-549   171-366 (786)
180 pfam01078 Mg_chelatase Magnesi  98.1 6.2E-06 1.6E-10   63.8   6.1  151  340-511     4-203 (207)
181 TIGR00602 rad24 checkpoint pro  98.1 1.2E-05   3E-10   61.7   7.5  126  317-462    76-236 (670)
182 PRK06871 DNA polymerase III su  98.1 0.00013 3.3E-09   53.7  12.8  133  365-517    22-172 (324)
183 KOG2680 consensus               98.1 2.2E-05 5.7E-10   59.5   8.8  203  360-573    60-413 (454)
184 PRK00149 dnaA chromosomal repl  98.1 2.4E-05 6.1E-10   59.3   8.9  186  368-596   147-344 (447)
185 pfam01637 Arch_ATPase Archaeal  98.1 0.00024 6.1E-09   51.8  13.7  168  358-550    12-211 (223)
186 PRK06090 DNA polymerase III su  98.1 5.3E-05 1.4E-09   56.7  10.3  135  362-516    21-173 (319)
187 COG1221 PspF Transcriptional r  98.1 0.00034 8.6E-09   50.6  14.0  212  337-574    80-311 (403)
188 KOG0729 consensus               98.1 1.8E-05 4.6E-10   60.3   7.4   86  367-461   212-305 (435)
189 TIGR02173 cyt_kin_arch cytidyl  98.1 3.1E-06 7.9E-11   66.1   3.4   59  368-445     2-60  (173)
190 pfam03266 DUF265 Protein of un  98.1 5.4E-06 1.4E-10   64.2   4.6  121  369-508     2-156 (168)
191 KOG0742 consensus               98.1 7.3E-05 1.9E-09   55.7  10.4  199  306-529   303-534 (630)
192 PRK08116 hypothetical protein;  98.1 7.5E-05 1.9E-09   55.6  10.3  104  347-463    90-200 (262)
193 COG0593 DnaA ATPase involved i  98.1 5.3E-05 1.4E-09   56.7   9.5  177  365-574   112-296 (408)
194 KOG1514 consensus               98.0 0.00054 1.4E-08   49.1  14.3  181  363-579   419-630 (767)
195 TIGR02639 ClpA ATP-dependent C  98.0 0.00011 2.8E-09   54.4  10.6  295  343-685   212-690 (774)
196 COG1484 DnaC DNA replication p  98.0 0.00015 3.9E-09   53.2  10.6   88  365-462   104-194 (254)
197 PRK13695 putative NTPase; Prov  97.9 1.4E-05 3.5E-10   61.1   4.9   94  368-465     5-130 (174)
198 PRK07276 DNA polymerase III su  97.9 6.7E-05 1.7E-09   55.9   8.3  162  344-537     3-180 (290)
199 KOG2227 consensus               97.9 0.00084 2.1E-08   47.6  13.9  210  364-621   173-413 (529)
200 COG0606 Predicted ATPase with   97.9 0.00033 8.3E-09   50.7  11.6  151  624-786     2-154 (490)
201 PRK07952 DNA replication prote  97.9 0.00023   6E-09   51.8  10.7   86  366-463    96-187 (242)
202 TIGR00678 holB DNA polymerase   97.9 0.00011 2.8E-09   54.4   8.8  144  358-521     6-191 (216)
203 PRK08699 DNA polymerase III su  97.9 7.8E-05   2E-09   55.4   8.1  134  364-517    19-179 (325)
204 pfam05673 DUF815 Protein of un  97.9  0.0014 3.6E-08   45.9  14.5  178  339-558    28-211 (248)
205 pfam03215 Rad17 Rad17 cell cyc  97.9 0.00036 9.1E-09   50.4  11.4  112  361-489    40-170 (490)
206 PRK13406 bchD magnesium chelat  97.9 0.00064 1.6E-08   48.5  12.6  191  356-568    16-223 (584)
207 TIGR02442 Cob-chelat-sub cobal  97.9 0.00029 7.5E-09   51.1  10.6  181  343-566     8-280 (688)
208 PRK08154 anaerobic benzoate ca  97.8 4.9E-05 1.2E-09   57.0   6.3   75  298-398    91-165 (304)
209 TIGR02640 gas_vesic_GvpN gas v  97.8 2.7E-05 6.9E-10   58.9   5.0  206  344-593     7-255 (265)
210 PRK06620 hypothetical protein;  97.8  0.0011 2.8E-08   46.7  12.8  164  366-595    44-213 (214)
211 TIGR02915 PEP_resp_reg putativ  97.8 0.00013 3.3E-09   53.8   7.6  256  251-592    90-386 (451)
212 TIGR03499 FlhF flagellar biosy  97.8 0.00015 3.7E-09   53.4   7.7   93  265-399   133-232 (282)
213 pfam06309 Torsin Torsin. This   97.8 0.00022 5.5E-09   52.1   8.4   77  327-403    13-95  (127)
214 PRK05703 flhF flagellar biosyn  97.7 0.00073 1.9E-08   48.1  10.7  129  264-440   150-295 (412)
215 PRK06995 flhF flagellar biosyn  97.7  0.0003 7.7E-09   51.0   8.5   81  365-450   175-268 (404)
216 KOG1968 consensus               97.7 0.00018 4.6E-09   52.7   7.0  182  337-552   319-521 (871)
217 PRK07993 DNA polymerase III su  97.7 0.00018 4.5E-09   52.8   6.9  139  361-518    19-175 (334)
218 pfam08298 AAA_PrkA PrkA AAA do  97.6 0.00017 4.4E-09   52.8   5.8   54  339-392    58-111 (358)
219 COG1618 Predicted nucleotide k  97.6 5.3E-05 1.4E-09   56.7   3.0   88  369-463     8-129 (179)
220 PRK00131 aroK shikimate kinase  97.6 6.9E-05 1.8E-09   55.8   3.6   33  364-396     2-34  (175)
221 COG3283 TyrR Transcriptional r  97.6  0.0053 1.3E-07   41.6  13.2  166  365-566   227-426 (511)
222 pfam01695 IstB IstB-like ATP b  97.6 8.5E-05 2.2E-09   55.1   4.0  105  349-466    32-139 (178)
223 TIGR00390 hslU heat shock prot  97.5  0.0002 5.2E-09   52.3   5.6  163  426-598   262-452 (463)
224 PRK13948 shikimate kinase; Pro  97.5 9.6E-05 2.4E-09   54.8   3.8   34  364-397     8-41  (182)
225 TIGR00390 hslU heat shock prot  97.5  0.0002 5.2E-09   52.3   5.5   88  335-436     8-105 (463)
226 PRK05057 aroK shikimate kinase  97.5 8.7E-05 2.2E-09   55.1   3.5   30  368-397     6-35  (172)
227 PRK12723 flagellar biosynthesi  97.5  0.0016 4.1E-08   45.5  10.0   45  344-388   147-196 (388)
228 PRK13947 shikimate kinase; Pro  97.5 9.1E-05 2.3E-09   54.9   3.5   29  369-397     4-32  (171)
229 PRK13946 shikimate kinase; Pro  97.5 0.00011 2.7E-09   54.4   3.5   38  360-397    14-51  (195)
230 cd00464 SK Shikimate kinase (S  97.5 0.00012   3E-09   54.1   3.5   29  369-397     2-30  (154)
231 COG0703 AroK Shikimate kinase   97.5 9.7E-05 2.5E-09   54.7   3.1   30  367-396     3-32  (172)
232 COG1373 Predicted ATPase (AAA+  97.4  0.0065 1.7E-07   40.9  12.4  138  365-534    35-186 (398)
233 pfam00931 NB-ARC NB-ARC domain  97.4   0.001 2.6E-08   46.9   8.1  154  346-524     3-170 (285)
234 PRK13531 regulatory ATPase Rav  97.4 4.8E-05 1.2E-09   57.0   1.1  130  364-514    37-183 (498)
235 TIGR02858 spore_III_AA stage I  97.4  0.0013 3.2E-08   46.3   8.2  131  325-493    94-242 (282)
236 PRK03731 aroL shikimate kinase  97.4 0.00016 4.1E-09   53.1   3.5   29  369-397     5-33  (172)
237 KOG0480 consensus               97.4  0.0035 8.9E-08   42.9  10.4  157  336-521   342-540 (764)
238 PRK13949 shikimate kinase; Pro  97.4 0.00016 4.1E-09   53.0   3.5   29  369-397     4-32  (169)
239 PRK06964 DNA polymerase III su  97.4 0.00078   2E-08   47.8   6.9  139  362-519    17-200 (342)
240 PRK12377 putative replication   97.3 0.00067 1.7E-08   48.4   6.3   86  366-462   101-190 (248)
241 PRK00625 shikimate kinase; Pro  97.3 0.00019 4.9E-09   52.5   3.5   30  369-398     3-32  (173)
242 PRK06835 DNA replication prote  97.3   0.002   5E-08   44.8   8.7   90  366-464   183-275 (330)
243 KOG1970 consensus               97.3 0.00089 2.3E-08   47.4   6.8  177  344-544    91-296 (634)
244 KOG0741 consensus               97.3  0.0024 6.2E-08   44.1   9.0   85  349-445   517-610 (744)
245 PRK05818 DNA polymerase III su  97.3  0.0018 4.7E-08   45.0   8.3  173  364-571     6-198 (262)
246 KOG2035 consensus               97.3    0.01 2.7E-07   39.3  12.0  164  361-566    29-227 (351)
247 pfam01057 Parvo_NS1 Parvovirus  97.3  0.0054 1.4E-07   41.5  10.6  155  326-510    77-239 (271)
248 KOG1808 consensus               97.2 0.00092 2.4E-08   47.3   6.2  138  358-514   432-590 (1856)
249 pfam00910 RNA_helicase RNA hel  97.2 0.00033 8.4E-09   50.7   3.6   98  369-490     1-104 (105)
250 PRK09270 frcK putative fructos  97.2  0.0019   5E-08   44.9   7.3   43  361-403    29-76  (230)
251 PRK09183 transposase/IS protei  97.1 0.00024 6.2E-09   51.7   2.3  161  316-515    65-246 (258)
252 PRK06526 transposase; Provisio  97.1  0.0003 7.6E-09   51.0   2.7  135  350-512    84-236 (254)
253 PRK03839 putative kinase; Prov  97.1 0.00037 9.5E-09   50.3   3.0   29  368-396     2-30  (180)
254 PRK12724 flagellar biosynthesi  97.1  0.0037 9.4E-08   42.8   8.0   81  364-450   221-313 (432)
255 KOG0990 consensus               97.1  0.0045 1.1E-07   42.1   8.1  183  316-547    27-217 (360)
256 COG3854 SpoIIIAA ncharacterize  97.0  0.0012   3E-08   46.5   5.0  104  369-497   140-262 (308)
257 PRK06696 uridine kinase; Valid  97.0  0.0032 8.1E-08   43.2   7.1   49  360-409    21-72  (227)
258 PRK13951 bifunctional shikimat  97.0 0.00063 1.6E-08   48.5   3.5   29  369-397     3-31  (488)
259 PRK08181 transposase; Validate  97.0 0.00042 1.1E-08   49.9   2.5  126  365-516   105-248 (269)
260 KOG1400 consensus               97.0  0.0029 7.4E-08   43.5   6.6  106   24-136    62-175 (371)
261 PRK06921 hypothetical protein;  97.0  0.0016   4E-08   45.6   5.1   89  345-444    95-187 (265)
262 cd02020 CMPK Cytidine monophos  97.0 0.00098 2.5E-08   47.1   4.0   36  368-405     1-36  (147)
263 cd01882 BMS1 Bms1.  Bms1 is an  97.0  0.0013 3.3E-08   46.2   4.5  107  363-492    36-145 (225)
264 COG1936 Predicted nucleotide k  96.9 0.00066 1.7E-08   48.4   2.7   28  367-395     1-28  (180)
265 KOG0482 consensus               96.9  0.0027 6.9E-08   43.8   5.7  155  339-507   342-521 (721)
266 pfam05729 NACHT NACHT domain.   96.8  0.0068 1.7E-07   40.8   7.5  141  368-523     2-162 (165)
267 PRK10416 cell division protein  96.8   0.022 5.7E-07   36.8  10.1  164  266-500   228-397 (499)
268 KOG4658 consensus               96.8   0.014 3.7E-07   38.3   9.1   48  342-395   161-211 (889)
269 KOG3347 consensus               96.8  0.0011 2.9E-08   46.6   3.3   36  363-398     4-39  (176)
270 KOG1051 consensus               96.8   0.013 3.2E-07   38.7   8.5  143  277-446   136-293 (898)
271 cd01428 ADK Adenylate kinase (  96.8  0.0017 4.3E-08   45.4   4.0   56  369-433     2-57  (194)
272 COG5271 MDN1 AAA ATPase contai  96.7   0.059 1.5E-06   33.6  11.6  157  369-553   891-1062(4600)
273 PRK02496 adk adenylate kinase;  96.7  0.0025 6.3E-08   44.0   4.1   58  369-435     4-61  (185)
274 COG0552 FtsY Signal recognitio  96.6    0.05 1.3E-06   34.2  10.7  160  265-493    66-234 (340)
275 COG3284 AcoR Transcriptional a  96.6  0.0055 1.4E-07   41.4   5.8  164  365-567   336-535 (606)
276 pfam07693 KAP_NTPase KAP famil  96.6   0.032 8.1E-07   35.7   9.6   51  434-501   161-211 (301)
277 PRK12726 flagellar biosynthesi  96.6    0.02 5.1E-07   37.2   8.3   77  283-400   163-240 (407)
278 cd03221 ABCF_EF-3 ABCF_EF-3  E  96.6    0.01 2.6E-07   39.4   6.7  113  364-506    24-141 (144)
279 pfam02367 UPF0079 Uncharacteri  96.6  0.0034 8.7E-08   43.0   4.3   31  363-393    12-42  (123)
280 PRK09435 arginine/ornithine tr  96.5  0.0067 1.7E-07   40.8   5.6  145  325-513    12-177 (325)
281 PRK00300 gmk guanylate kinase;  96.5  0.0034 8.6E-08   43.0   4.1   33  363-395     4-36  (208)
282 PRK06731 flhF flagellar biosyn  96.5   0.048 1.2E-06   34.3   9.9   39  363-401    72-110 (270)
283 cd03216 ABC_Carb_Monos_I This   96.5    0.01 2.6E-07   39.4   6.4   79  364-442    24-109 (163)
284 cd01120 RecA-like_NTPases RecA  96.5   0.016   4E-07   38.0   7.3   39  368-406     1-42  (165)
285 cd03114 ArgK-like The function  96.5  0.0083 2.1E-07   40.1   5.9  122  368-512     1-126 (148)
286 KOG0477 consensus               96.5  0.0067 1.7E-07   40.8   5.3  232  339-595   449-730 (854)
287 PRK04220 2-phosphoglycerate ki  96.5   0.079   2E-06   32.7  10.8   99  271-395    22-121 (306)
288 KOG1942 consensus               96.4  0.0028 7.2E-08   43.6   3.3   51  494-554   351-401 (456)
289 COG0563 Adk Adenylate kinase a  96.4  0.0027 6.9E-08   43.8   3.2   56  368-432     2-57  (178)
290 pfam01768 Birna_VP4 Birnavirus  96.4  0.0052 1.3E-07   41.6   4.7   65  680-750   179-244 (264)
291 TIGR00368 TIGR00368 Mg chelata  96.4  0.0015 3.9E-08   45.6   1.9   22  366-387   213-234 (505)
292 COG1072 CoaA Panthothenate kin  96.4   0.024   6E-07   36.6   7.9   76  351-429    70-159 (283)
293 PRK00771 signal recognition pa  96.4     0.1 2.6E-06   31.9  13.2  106  362-502    93-199 (433)
294 PRK07263 consensus              96.3    0.11 2.7E-06   31.7  12.1   41  361-401   198-242 (453)
295 TIGR03263 guanyl_kin guanylate  96.3  0.0059 1.5E-07   41.2   4.3   33  366-398     1-33  (180)
296 PRK07261 topology modulation p  96.3  0.0051 1.3E-07   41.7   3.9   29  369-397     3-31  (171)
297 cd00267 ABC_ATPase ABC (ATP-bi  96.3  0.0038 9.6E-08   42.7   3.1   78  364-442    23-107 (157)
298 COG2074 2-phosphoglycerate kin  96.2  0.0078   2E-07   40.3   4.6   42  354-395    77-118 (299)
299 COG1102 Cmk Cytidylate kinase   96.2  0.0047 1.2E-07   42.0   3.4   56  368-436     2-58  (179)
300 cd00227 CPT Chloramphenicol (C  96.2   0.014 3.5E-07   38.4   5.7   39  365-403     1-39  (175)
301 PRK04040 adenylate kinase; Pro  96.2   0.011 2.8E-07   39.2   5.1   44  366-409     2-56  (189)
302 PRK08118 topology modulation p  96.2  0.0057 1.5E-07   41.3   3.7   29  369-397     4-32  (167)
303 pfam03308 ArgK ArgK protein. T  96.2   0.012 2.9E-07   39.0   5.2  114  360-513    23-157 (267)
304 pfam03969 AFG1_ATPase AFG1-lik  96.1   0.051 1.3E-06   34.1   8.4  176  268-511     4-201 (361)
305 cd03227 ABC_Class2 ABC-type Cl  96.1   0.013 3.3E-07   38.6   5.2   91  365-462    20-129 (162)
306 PRK10646 putative ATPase; Prov  96.1  0.0092 2.3E-07   39.7   4.5   30  364-393    26-55  (153)
307 PRK13543 cytochrome c biogenes  96.1  0.0065 1.7E-07   40.9   3.7   40  364-403    35-74  (214)
308 PTZ00088 adenylate kinase 1; P  96.1  0.0089 2.3E-07   39.9   4.3   59  368-435     2-60  (225)
309 PRK00023 cmk cytidylate kinase  96.1  0.0079   2E-07   40.2   3.9   32  364-395     2-33  (225)
310 cd01130 VirB11-like_ATPase Typ  96.1   0.047 1.2E-06   34.4   7.9  100  349-462    12-122 (186)
311 COG2607 Predicted ATPase (AAA+  96.1    0.14 3.7E-06   30.7  10.8  180  340-558    61-244 (287)
312 cd02030 NDUO42 NADH:Ubiquinone  96.1  0.0052 1.3E-07   41.6   3.0   28  368-395     1-28  (219)
313 PRK05636 replicative DNA helic  96.0    0.12 3.2E-06   31.2  10.0   39  362-400   263-305 (507)
314 COG1120 FepC ABC-type cobalami  96.0  0.0081 2.1E-07   40.2   3.7   39  364-402    26-64  (258)
315 cd02025 PanK Pantothenate kina  96.0   0.017 4.4E-07   37.6   5.4   35  368-402     1-40  (220)
316 cd03115 SRP The signal recogni  96.0  0.0058 1.5E-07   41.2   2.9   24  367-390     1-24  (173)
317 COG5192 BMS1 GTP-binding prote  95.9  0.0082 2.1E-07   40.1   3.6   16  124-139   291-306 (1077)
318 PRK09825 idnK D-gluconate kina  95.9    0.01 2.5E-07   39.5   4.0   32  364-395     1-32  (176)
319 PRK09361 radB DNA repair and r  95.9   0.015 3.9E-07   38.1   4.9   28  363-390    20-47  (224)
320 PRK09302 circadian clock prote  95.9  0.0072 1.8E-07   40.6   3.2   31  362-392   262-293 (501)
321 pfam00448 SRP54 SRP54-type pro  95.9  0.0065 1.7E-07   40.9   2.9   39  366-404     1-42  (196)
322 PRK04182 cytidylate kinase; Pr  95.9  0.0092 2.3E-07   39.7   3.7   28  368-395     2-29  (178)
323 pfam00437 GSPII_E Type II/IV s  95.9   0.044 1.1E-06   34.6   7.1  100  348-460   125-229 (283)
324 COG2766 PrkA Putative Ser prot  95.9   0.033 8.4E-07   35.5   6.5  195  339-546    76-363 (649)
325 PRK11545 gntK gluconate kinase  95.9   0.012   3E-07   39.0   4.1   33  363-395     5-37  (177)
326 PRK13477 bifunctional pantoate  95.9   0.011 2.7E-07   39.2   3.9   32  364-395   282-313 (512)
327 PRK00279 adk adenylate kinase;  95.8  0.0079   2E-07   40.3   3.1   55  369-432     3-57  (215)
328 COG0410 LivF ABC-type branched  95.8  0.0071 1.8E-07   40.6   2.8   39  364-402    27-65  (237)
329 PRK10070 glycine betaine trans  95.8   0.014 3.6E-07   38.3   4.2  126  632-788   236-365 (400)
330 COG4088 Predicted nucleotide k  95.8   0.008   2E-07   40.2   2.9  141  367-563     2-149 (261)
331 PRK05595 replicative DNA helic  95.8    0.19 4.8E-06   29.8  14.3   40  362-401   197-240 (444)
332 pfam00625 Guanylate_kin Guanyl  95.7   0.031 7.8E-07   35.8   5.8   29  367-395     2-30  (182)
333 PRK12727 flagellar biosynthesi  95.7   0.064 1.6E-06   33.4   7.5   58  342-399   320-386 (557)
334 pfam07931 CPT Chloramphenicol   95.7   0.014 3.6E-07   38.3   4.1   36  366-401     1-36  (174)
335 COG1855 ATPase (PilT family) [  95.7   0.013 3.3E-07   38.6   3.9   70  308-392   217-289 (604)
336 COG0464 SpoVK ATPases of the A  95.7   0.023 5.9E-07   36.7   5.1  130  360-513    12-155 (494)
337 PRK04328 hypothetical protein;  95.7   0.017 4.3E-07   37.8   4.4   38  362-399    20-60  (250)
338 cd02021 GntK Gluconate kinase   95.7   0.011 2.7E-07   39.2   3.4   30  368-397     1-30  (150)
339 PRK05291 trmE tRNA modificatio  95.7     0.2   5E-06   29.7  10.7   44  344-387   193-237 (445)
340 cd01394 radB RadB. The archaea  95.7   0.027 6.8E-07   36.2   5.3   28  363-390    16-43  (218)
341 PRK07667 uridine kinase; Provi  95.7   0.038 9.6E-07   35.1   6.0   51  355-406     4-57  (190)
342 cd03255 ABC_MJ0796_Lo1CDE_FtsE  95.7   0.012 3.2E-07   38.7   3.5   39  364-402    28-66  (218)
343 pfam00406 ADK Adenylate kinase  95.6   0.011 2.9E-07   39.1   3.2   56  371-435     1-56  (186)
344 pfam06745 KaiC KaiC. This fami  95.6   0.021 5.3E-07   37.1   4.6   39  362-400    15-57  (231)
345 pfam05272 VirE Virulence-assoc  95.6    0.21 5.5E-06   29.4  10.1  159  314-509     1-169 (198)
346 cd00071 GMPK Guanosine monopho  95.6   0.013 3.4E-07   38.5   3.5   50  368-417     1-52  (137)
347 cd03294 ABC_Pro_Gly_Bertaine T  95.6   0.014 3.5E-07   38.4   3.6   38  364-401    48-85  (269)
348 pfam01745 IPT Isopentenyl tran  95.6   0.034 8.7E-07   35.5   5.6   77  368-447     3-89  (232)
349 PRK06904 replicative DNA helic  95.5    0.22 5.5E-06   29.4   9.5   42  361-402   216-261 (472)
350 COG3842 PotA ABC-type spermidi  95.5   0.016   4E-07   38.0   3.7   47  356-402    20-67  (352)
351 PRK11248 tauB taurine transpor  95.5   0.014 3.6E-07   38.4   3.4   39  364-402    25-63  (255)
352 PRK10851 sulfate/thiosulfate t  95.5   0.018 4.5E-07   37.6   3.9   39  364-402    26-64  (352)
353 TIGR03575 selen_PSTK_euk L-ser  95.5   0.018 4.7E-07   37.5   3.9   24  370-393     3-26  (340)
354 TIGR03265 PhnT2 putative 2-ami  95.5   0.018 4.5E-07   37.6   3.8   39  364-402    28-66  (353)
355 cd03223 ABCD_peroxisomal_ALDP   95.5   0.016 4.1E-07   37.9   3.6   27  364-390    25-51  (166)
356 PRK10418 nikD nickel transport  95.5  0.0031   8E-08   43.3  -0.0   29  364-392    27-55  (254)
357 PRK11860 bifunctional 3-phosph  95.5   0.033 8.3E-07   35.6   5.2   35  361-395   437-471 (662)
358 PRK00091 miaA tRNA delta(2)-is  95.5   0.015 3.8E-07   38.1   3.4   34  364-399     2-35  (304)
359 PRK13540 cytochrome c biogenes  95.4   0.018 4.6E-07   37.6   3.7   38  364-401    25-62  (200)
360 cd03299 ABC_ModC_like Archeal   95.4    0.02   5E-07   37.3   3.9   38  364-401    23-60  (235)
361 PRK05541 adenylylsulfate kinas  95.4   0.012 3.1E-07   38.8   2.9   33  361-393     2-34  (176)
362 cd03231 ABC_CcmA_heme_exporter  95.4   0.021 5.4E-07   37.0   4.1   39  364-402    24-62  (201)
363 PRK13808 adenylate kinase; Pro  95.4   0.023 5.9E-07   36.7   4.3   58  369-435     3-60  (297)
364 cd02023 UMPK Uridine monophosp  95.4   0.023 5.7E-07   36.8   4.1   34  368-401     1-35  (198)
365 pfam00006 ATP-synt_ab ATP synt  95.4   0.071 1.8E-06   33.0   6.6   36  358-393     7-42  (213)
366 cd03278 ABC_SMC_barmotin Barmo  95.4   0.021 5.4E-07   37.0   3.9   26  365-391    22-47  (197)
367 PRK11650 ugpC glycerol-3-phosp  95.3   0.021 5.3E-07   37.0   3.8   38  364-401    28-65  (358)
368 COG0802 Predicted ATPase or ki  95.3   0.017 4.4E-07   37.7   3.4   54  364-440    23-77  (149)
369 PRK13764 ATPase; Provisional    95.3   0.023 5.8E-07   36.8   4.0   46  336-392   239-285 (605)
370 cd02028 UMPK_like Uridine mono  95.3   0.024   6E-07   36.6   4.0   34  368-401     1-37  (179)
371 KOG2485 consensus               95.3   0.084 2.1E-06   32.5   6.8   76  364-456   141-218 (335)
372 cd01856 YlqF YlqF.  Proteins o  95.3    0.03 7.6E-07   35.9   4.5   47  341-387    86-136 (171)
373 TIGR03574 selen_PSTK L-seryl-t  95.3   0.021 5.2E-07   37.1   3.6   72  369-442     2-76  (249)
374 PRK13538 cytochrome c biogenes  95.3   0.021 5.4E-07   37.0   3.7   38  364-401    25-62  (204)
375 PRK11124 artP arginine transpo  95.2   0.028 7.2E-07   36.1   4.2   38  364-401    26-63  (242)
376 PRK07004 replicative DNA helic  95.2    0.28   7E-06   28.6  13.0   41  361-401   208-252 (460)
377 PRK06762 hypothetical protein;  95.2    0.11 2.7E-06   31.7   7.2  105  366-479     2-107 (166)
378 PRK11432 fbpC ferric transport  95.2   0.024   6E-07   36.6   3.8   38  364-401    30-67  (351)
379 PRK01184 hypothetical protein;  95.2   0.022 5.7E-07   36.8   3.6   41  367-410     2-43  (183)
380 TIGR01351 adk adenylate kinase  95.2   0.016 4.1E-07   37.9   2.9   43  369-434     2-44  (232)
381 pfam01202 SKI Shikimate kinase  95.2   0.014 3.5E-07   38.4   2.5   23  375-397     1-23  (158)
382 PRK11000 maltose/maltodextrin   95.2   0.025 6.5E-07   36.4   3.8   39  364-402    27-65  (369)
383 PRK09302 circadian clock prote  95.2   0.039   1E-06   35.0   4.8   47  363-411    21-71  (501)
384 smart00487 DEXDc DEAD-like hel  95.1     0.2 5.1E-06   29.6   8.3   95  367-461    25-157 (201)
385 PRK11831 putative ABC transpor  95.1   0.023 5.9E-07   36.7   3.5   38  364-401    32-69  (269)
386 PRK10771 thiQ thiamine transpo  95.1    0.03 7.6E-07   35.9   4.0   39  364-402    23-61  (233)
387 COG4650 RtcR Sigma54-dependent  95.1     0.1 2.7E-06   31.8   6.8  213  364-601   207-446 (531)
388 TIGR02237 recomb_radB DNA repa  95.1   0.018 4.5E-07   37.6   2.8   40  364-403    10-53  (223)
389 cd03290 ABCC_SUR1_N The SUR do  95.1   0.024 6.1E-07   36.6   3.4   39  364-402    25-63  (218)
390 TIGR03600 phage_DnaB phage rep  95.1    0.12   3E-06   31.4   6.9   40  361-400   189-232 (421)
391 TIGR03415 ABC_choXWV_ATP choli  95.0    0.04   1E-06   34.9   4.5   44  347-390    26-74  (382)
392 PRK05480 uridine kinase; Provi  95.0   0.033 8.5E-07   35.5   4.1   38  364-401     4-42  (209)
393 PRK10247 putative ABC transpor  95.0   0.029 7.4E-07   35.9   3.8   38  364-401    31-68  (225)
394 cd03253 ABCC_ATM1_transporter   95.0   0.023 5.9E-07   36.7   3.3   39  364-402    25-63  (236)
395 PRK13768 GTPase; Provisional    95.0   0.038 9.8E-07   35.1   4.4   38  367-404     3-43  (253)
396 PRK08082 consensus              95.0    0.32 8.1E-06   28.1  13.9   40  362-401   199-242 (453)
397 cd00984 DnaB_C DnaB helicase C  95.0   0.043 1.1E-06   34.7   4.6   40  361-400     8-51  (242)
398 PRK11701 phnK phosphonates tra  95.0   0.027 6.8E-07   36.2   3.5   38  364-401    30-67  (258)
399 cd03297 ABC_ModC_molybdenum_tr  95.0   0.032 8.1E-07   35.7   3.9   39  363-401    20-58  (214)
400 pfam00519 PPV_E1_C Papillomavi  95.0   0.089 2.3E-06   32.3   6.2   45  351-395   245-291 (432)
401 TIGR03258 PhnT 2-aminoethylpho  95.0   0.033 8.4E-07   35.5   3.9   38  364-401    29-68  (362)
402 PRK10619 histidine/lysine/argi  95.0   0.031 7.8E-07   35.8   3.8   38  364-401    29-66  (257)
403 cd01123 Rad51_DMC1_radA Rad51_  95.0   0.019 4.8E-07   37.4   2.7   31  363-393    16-46  (235)
404 cd03238 ABC_UvrA The excision   95.0   0.044 1.1E-06   34.6   4.6   24  364-387    19-42  (176)
405 cd01124 KaiC KaiC is a circadi  95.0   0.033 8.4E-07   35.5   3.9   30  370-399     3-35  (187)
406 pfam00485 PRK Phosphoribulokin  95.0   0.021 5.2E-07   37.1   2.8   28  368-395     1-28  (196)
407 PRK11231 fecE iron-dicitrate t  95.0   0.031 7.9E-07   35.7   3.7   39  364-402    26-64  (255)
408 PRK08006 replicative DNA helic  95.0    0.33 8.4E-06   28.0  13.5   41  361-401   219-263 (471)
409 PRK04132 replication factor C   94.9    0.12   3E-06   31.4   6.6   14  612-625   742-755 (863)
410 PRK10895 putative ABC transpor  94.9   0.028 7.2E-07   36.1   3.5   38  364-401    27-64  (241)
411 PRK13539 cytochrome c biogenes  94.9   0.022 5.7E-07   36.8   3.0   28  364-391    26-53  (206)
412 cd03222 ABC_RNaseL_inhibitor T  94.9   0.026 6.7E-07   36.3   3.3   69  364-441    23-97  (177)
413 cd03224 ABC_TM1139_LivF_branch  94.9   0.036 9.2E-07   35.2   4.0   38  364-401    24-61  (222)
414 PRK11264 putative amino-acid A  94.9   0.029 7.5E-07   35.9   3.5   39  364-402    25-63  (248)
415 cd03295 ABC_OpuCA_Osmoprotecti  94.9   0.037 9.3E-07   35.2   4.0   38  364-401    25-62  (242)
416 cd01859 MJ1464 MJ1464.  This f  94.9   0.039   1E-06   35.0   4.1   43  339-386    79-121 (156)
417 PRK10253 iron-enterobactin tra  94.9   0.034 8.6E-07   35.5   3.7   38  364-401    31-68  (265)
418 PRK10575 iron-hydroxamate tran  94.8   0.034 8.8E-07   35.4   3.7   38  364-401    35-72  (265)
419 PRK11144 modC molybdate transp  94.8   0.039 9.9E-07   35.0   4.0   38  364-401    22-59  (352)
420 PRK13644 cbiO cobalt transport  94.8   0.031 7.9E-07   35.7   3.5   38  364-401    26-63  (274)
421 TIGR03410 urea_trans_UrtE urea  94.8   0.039   1E-06   35.0   3.9   38  364-401    24-61  (230)
422 TIGR03596 GTPase_YlqF ribosome  94.8   0.047 1.2E-06   34.4   4.3   53  366-441   117-170 (276)
423 PRK10419 nikE nickel transport  94.8   0.035 8.9E-07   35.4   3.6   38  364-401    36-73  (266)
424 cd03245 ABCC_bacteriocin_expor  94.8   0.019   5E-07   37.3   2.3   39  364-402    28-66  (220)
425 PRK10867 signal recognition pa  94.8    0.36 9.2E-06   27.7  13.6  105  365-502    99-205 (453)
426 COG0467 RAD55 RecA-superfamily  94.8   0.047 1.2E-06   34.4   4.3   39  363-401    20-61  (260)
427 COG1419 FlhF Flagellar GTP-bin  94.8   0.037 9.5E-07   35.1   3.8   39  365-403   202-245 (407)
428 cd03234 ABCG_White The White s  94.8   0.025 6.3E-07   36.5   2.9   27  364-390    31-57  (226)
429 PRK13548 hmuV hemin importer A  94.8   0.034 8.7E-07   35.4   3.5   39  364-402    26-64  (257)
430 cd03301 ABC_MalK_N The N-termi  94.7   0.042 1.1E-06   34.7   4.0   39  364-402    24-62  (213)
431 PRK12337 2-phosphoglycerate ki  94.7    0.37 9.5E-06   27.6  13.4  172  190-395   113-291 (492)
432 PRK05748 replicative DNA helic  94.7    0.37 9.5E-06   27.6  13.9   41  361-401   198-242 (448)
433 PRK09580 sufC cysteine desulfu  94.7   0.039   1E-06   35.0   3.8   25  364-388    25-49  (248)
434 PRK03846 adenylylsulfate kinas  94.7   0.043 1.1E-06   34.7   4.0   33  360-392    18-50  (198)
435 KOG3079 consensus               94.7   0.052 1.3E-06   34.0   4.4   66  363-436     5-70  (195)
436 cd03235 ABC_Metallic_Cations A  94.7   0.039   1E-06   35.0   3.8   38  364-401    23-60  (213)
437 PRK09165 replicative DNA helic  94.7    0.38 9.6E-06   27.5  18.3   28  361-388   200-227 (484)
438 COG0194 Gmk Guanylate kinase [  94.7    0.05 1.3E-06   34.2   4.3   26  365-390     3-28  (191)
439 PRK10261 glutathione transport  94.7   0.034 8.6E-07   35.5   3.4   38  364-401   348-385 (623)
440 PRK13542 consensus              94.7   0.044 1.1E-06   34.6   4.0   39  364-402    42-80  (224)
441 PRK13631 cbiO cobalt transport  94.7   0.033 8.4E-07   35.6   3.3   41  364-404    50-90  (320)
442 TIGR03608 L_ocin_972_ABC putat  94.7    0.04   1E-06   34.9   3.7   38  364-401    22-59  (206)
443 cd01122 GP4d_helicase GP4d_hel  94.7   0.075 1.9E-06   32.9   5.1   42  360-401    24-69  (271)
444 CHL00131 ycf16 sulfate ABC tra  94.7   0.037 9.4E-07   35.2   3.5   25  364-388    30-54  (252)
445 PRK10789 putative multidrug tr  94.7   0.041   1E-06   34.9   3.8   38  365-402   340-377 (569)
446 TIGR01448 recD_rel helicase, R  94.7    0.26 6.6E-06   28.7   7.9  260  329-623   335-667 (769)
447 COG4240 Predicted kinase [Gene  94.7    0.26 6.6E-06   28.8   7.8  202  349-575    31-279 (300)
448 cd03229 ABC_Class3 This class   94.7   0.045 1.2E-06   34.5   4.0   39  364-402    24-62  (178)
449 pfam03029 ATP_bind_1 Conserved  94.7   0.032 8.2E-07   35.6   3.2   33  372-404     2-37  (234)
450 PRK13541 cytochrome c biogenes  94.6   0.043 1.1E-06   34.7   3.8   38  364-401    24-61  (195)
451 KOG0479 consensus               94.6   0.051 1.3E-06   34.1   4.2  159  334-511   296-509 (818)
452 KOG1803 consensus               94.6   0.036 9.2E-07   35.2   3.4  140  482-661   477-620 (649)
453 cd03257 ABC_NikE_OppD_transpor  94.6   0.039   1E-06   35.0   3.6   38  364-401    29-66  (228)
454 PRK10584 putative ABC transpor  94.6    0.05 1.3E-06   34.2   4.1   38  364-401    34-71  (228)
455 pfam01583 APS_kinase Adenylyls  94.6   0.035 8.9E-07   35.4   3.2   27  365-391     1-27  (157)
456 PRK13638 cbiO cobalt transport  94.6   0.048 1.2E-06   34.3   3.9   38  364-401    25-62  (271)
457 PRK09452 potA putrescine/sperm  94.6   0.049 1.2E-06   34.2   3.9   39  364-402    41-79  (378)
458 PRK09536 btuD corrinoid ABC tr  94.6   0.046 1.2E-06   34.5   3.8   39  364-402    26-64  (409)
459 cd03226 ABC_cobalt_CbiO_domain  94.6   0.042 1.1E-06   34.8   3.6   38  364-401    24-61  (205)
460 cd03261 ABC_Org_Solvent_Resist  94.5   0.044 1.1E-06   34.6   3.7   28  364-391    24-51  (235)
461 cd01673 dNK Deoxyribonucleosid  94.5   0.042 1.1E-06   34.7   3.6   33  368-400     1-33  (193)
462 KOG0964 consensus               94.5    0.41   1E-05   27.3  13.0   11  120-130   130-140 (1200)
463 cd03218 ABC_YhbG The ABC trans  94.5   0.051 1.3E-06   34.1   3.9   38  364-401    24-61  (232)
464 PRK13635 cbiO cobalt transport  94.5    0.04   1E-06   34.9   3.4   39  364-402    31-69  (279)
465 pfam03796 DnaB_C DnaB-like hel  94.5   0.061 1.6E-06   33.5   4.3   40  361-400    14-57  (186)
466 cd03291 ABCC_CFTR1 The CFTR su  94.5   0.044 1.1E-06   34.6   3.6   28  364-391    61-88  (282)
467 cd03225 ABC_cobalt_CbiO_domain  94.5   0.038 9.7E-07   35.1   3.3   38  364-401    25-62  (211)
468 PRK13544 consensus              94.5   0.047 1.2E-06   34.3   3.7   39  364-402    25-63  (208)
469 COG2425 Uncharacterized protei  94.5    0.42 1.1E-05   27.1   9.3  124  330-491   242-378 (437)
470 cd03289 ABCC_CFTR2 The CFTR su  94.5   0.053 1.4E-06   34.0   3.9   37  364-401    28-64  (275)
471 cd03214 ABC_Iron-Siderophores_  94.4   0.051 1.3E-06   34.1   3.8   39  364-402    23-61  (180)
472 PRK09563 rbgA ribosomal biogen  94.4   0.057 1.5E-06   33.7   4.0   50  369-441   124-173 (282)
473 cd03296 ABC_CysA_sulfate_impor  94.4   0.054 1.4E-06   33.9   3.9   38  364-401    26-63  (239)
474 TIGR00064 ftsY signal recognit  94.4     0.3 7.7E-06   28.3   7.6  179  265-502     4-187 (284)
475 PRK04837 ATP-dependent RNA hel  94.4    0.33 8.4E-06   28.0   7.8   56  397-452   117-178 (423)
476 cd03269 ABC_putative_ATPase Th  94.4   0.033 8.4E-07   35.5   2.7   38  364-401    24-61  (210)
477 cd03369 ABCC_NFT1 Domain 2 of   94.4    0.06 1.5E-06   33.6   4.0   39  364-402    32-70  (207)
478 cd03232 ABC_PDR_domain2 The pl  94.3   0.063 1.6E-06   33.4   4.1   25  364-388    31-55  (192)
479 COG1428 Deoxynucleoside kinase  94.3   0.048 1.2E-06   34.3   3.4   29  366-394     4-32  (216)
480 PRK13546 teichoic acids export  94.3   0.054 1.4E-06   34.0   3.7   28  364-391    48-75  (264)
481 cd01129 PulE-GspE PulE/GspE Th  94.3    0.23   6E-06   29.1   6.9   98  338-443    58-159 (264)
482 cd03247 ABCC_cytochrome_bd The  94.3   0.038 9.6E-07   35.1   2.8   45  364-409    26-70  (178)
483 TIGR03411 urea_trans_UrtD urea  94.3   0.065 1.7E-06   33.3   4.0   39  364-402    26-64  (242)
484 PRK11629 lolD lipoprotein tran  94.2   0.059 1.5E-06   33.6   3.8   27  364-390    33-59  (233)
485 cd01393 recA_like RecA is a  b  94.2   0.051 1.3E-06   34.1   3.5   31  363-393    16-46  (226)
486 cd03249 ABC_MTABC3_MDL1_MDL2 M  94.2   0.058 1.5E-06   33.7   3.7   39  364-402    27-65  (238)
487 cd03298 ABC_ThiQ_thiamine_tran  94.2   0.057 1.4E-06   33.8   3.7   39  364-402    22-60  (211)
488 cd03237 ABC_RNaseL_inhibitor_d  94.2   0.057 1.4E-06   33.8   3.7   30  364-393    23-52  (246)
489 PRK11147 ABC transporter ATPas  94.2   0.051 1.3E-06   34.1   3.4   28  364-391   343-370 (632)
490 PRK06067 flagellar accessory p  94.2   0.049 1.2E-06   34.3   3.3   37  362-398    28-67  (241)
491 PRK13642 cbiO cobalt transport  94.2   0.055 1.4E-06   33.9   3.6   29  364-392    31-59  (277)
492 cd04155 Arl3 Arl3 subfamily.    94.2   0.051 1.3E-06   34.1   3.4   31  358-388     6-36  (173)
493 PRK10744 phosphate transporter  94.2   0.033 8.5E-07   35.5   2.5   35  357-391    26-61  (257)
494 cd03256 ABC_PhnC_transporter A  94.2   0.067 1.7E-06   33.2   4.0   38  364-401    25-62  (241)
495 cd03254 ABCC_Glucan_exporter_l  94.2   0.026 6.6E-07   36.4   1.8   39  364-402    27-65  (229)
496 PRK13634 cbiO cobalt transport  94.1   0.063 1.6E-06   33.4   3.8   39  364-402    18-56  (276)
497 cd03259 ABC_Carb_Solutes_like   94.1   0.067 1.7E-06   33.2   3.9   38  364-401    24-61  (213)
498 PRK13547 hmuV hemin importer A  94.1   0.074 1.9E-06   32.9   4.1   27  364-390    25-51  (273)
499 cd03215 ABC_Carb_Monos_II This  94.1   0.044 1.1E-06   34.6   2.9   38  364-401    24-61  (182)
500 cd03281 ABC_MSH5_euk MutS5 hom  94.1    0.17 4.5E-06   30.1   6.0  109  366-476    29-156 (213)

No 1  
>TIGR00763 lon ATP-dependent protease La; InterPro: IPR004815   Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes . They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence . Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases .   Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base . The geometric orientations of the catalytic residues are similar between families, despite different protein folds . The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) , .   Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins.   Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule.    This signature defines the bacterial and eukaryotic lon proteases, which are ATP-dependent serine peptidases belonging to the MEROPS peptidase family S16 (lon protease family, clan SF). This family of sequences does not include the archaeal lon homologs, IPR004663 from INTERPRO. In the eukaryotes the majority of the proteins are located in the mitochondrial matrix , . In yeast, Pim1, is located in the mitochondrial matrix, is required for mitochondrial function, is constitutively expressed but is increased after thermal stress, suggesting that Pim1 may play a role in the heat shock response .; GO: 0004176 ATP-dependent peptidase activity, 0005524 ATP binding, 0006510 ATP-dependent proteolysis.
Probab=100.00  E-value=0  Score=2345.15  Aligned_cols=759  Identities=51%  Similarity=0.850  Sum_probs=739.2

Q ss_pred             EEEEECCCEECCCEEEEEECC--CHHHHHHHHHHHHCCCEEE---EEECCCCCCCCC-----CHHHEECCCEEEEEEEEE
Q ss_conf             566317825688714306429--4899999999997298499---997368677788-----865602531489999979
Q gi|254780270|r   29 PLLPLRDIVVFPYMIVPLFVG--REKSVRALDEAMNSHKKII---LVTQMNSNDENP-----IASSVYRIGTIVDIVQIL   98 (820)
Q Consensus        29 PIlPLrn~VLFPG~vlPL~V~--eprsi~aIe~al~~d~~I~---vV~qkD~~~e~p-----~~edLy~VGTlakI~qi~   98 (820)
                      |++|+|+.|||||+++||+|+  |++++++|++++..++.++   +|+|||.+.++|     ..+|+|++||+|+|+++.
T Consensus         1 p~Lp~~~~~lFPg~~~~i~v~~D~~~~~~~i~~~~~~~~~~~G~~~f~~kd~~~~~~~~~i~~~~d~Y~~Gv~a~I~~~~   80 (941)
T TIGR00763         1 PLLPLRRRPLFPGMIKPIVVGSDREKSIKLIKEALRLKQPYLGIVVFLQKDDDNEEPKLVITEEDDIYSVGVVAQILEML   80 (941)
T ss_pred             CCCCCCCCCCCCCCEEEEEEECCCHHHHHHHHHHHHHCCCHHHHHHEEECCCCCCCCCCCCCCCCCCCCCCCEEEEEEEE
T ss_conf             95411782016844189986058789999999998721100102110010056667432014621100676215445420


Q ss_pred             ECCC-----CEEEEEEEEEEEEEEEEEEE---------------------------------------------------
Q ss_conf             9889-----80999999754799998870---------------------------------------------------
Q gi|254780270|r   99 RLPD-----GTVKILVEGSVRARIVEYIE---------------------------------------------------  122 (820)
Q Consensus        99 klpD-----G~~~ILVeGl~RvkI~ei~~---------------------------------------------------  122 (820)
                      +++|     ++++++++|++|++|.++++                                                   
T Consensus        81 ~~~~~~~~~~~~~~~v~Gl~R~~i~e~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~P~~~~~~v~~eL~~~~~~e~~~~  160 (941)
T TIGR00763        81 KLPDEKSGTATYKVVVEGLRRIRIKELVDPDEEVDPEEEEAEDARKPRDKKSASKKSPKLEDAEVESELSAKEPKEEKEE  160 (941)
T ss_pred             CCCCCCCCCCCEEEEEECCCEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCEECHHHHCCCCCCCCCC
T ss_conf             26777656551689986033057743268887888766650113311013341777887244201503311367875568


Q ss_pred             -----------CCCEEEEEEEEEC---CCC--CCCHHHHHHHHHHHHHHHHHHHHCC--CCCHHHHHHHHC----CCCHH
Q ss_conf             -----------7981999999804---888--8847899999999999999998545--577788876412----68867
Q gi|254780270|r  123 -----------REDFLEAITQVLP---DPT--EDPVELEALSRSVIAEFSNYIKLNK--KISPEVIGITSQ----IEGFS  180 (820)
Q Consensus       123 -----------~~pyl~A~Ve~l~---d~~--~d~~eleAL~~~L~e~f~eli~l~~--~i~~E~~~~l~~----iddp~  180 (820)
                                 +.+|+.|+|+.++   +.+  .++.+++|+.+.+++.|++++++++  +.+.+.......    +++|.
T Consensus       161 ~~~~~~~~~~~~~~~~~v~v~~l~m~~~~~~~~~~~~~~Al~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~S~~v~~~P~  240 (941)
T TIGR00763       161 ESEELPEITLQKEEYLVVRVDNLKMEKDEPFDKDDEEIKALTREIKETFRELISLSKLFREQPALLSALEDSANVIDEPG  240 (941)
T ss_pred             CCCCCCCHHHHCCCEEEEEEEEEECCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCCCH
T ss_conf             87544300110167558986421001024530002023478999999999998523120003777432544475104622


Q ss_pred             HHHHHHHHHCCCC-HHHHHHHHHHHHHH-HHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHH
Q ss_conf             8999988523589-89999987432479-99999999999865---5666777754333322233211221011110000
Q gi|254780270|r  181 KLADVIAANLSIK-VAERQKILEAVSVK-ERLEMLLVFMESEI---SVLQVEKRIRSRVKRQMEKTQREYYLHEQMKAIQ  255 (820)
Q Consensus       181 ~LAD~IAs~L~l~-~eeKQeLLE~~Di~-eRLe~Ll~lL~~Ei---EilkLq~eI~~kVk~kidk~QREyyLREQLKaIq  255 (820)
                      +|||++|+.+.+. ..++|++||+.|+. +||++++.+|++|+   +.++|+++|.++|++||+++|||||||||||+||
T Consensus       241 ~LaD~~Aa~~~~~e~~e~Q~vLe~~n~~h~RL~k~l~l~~~E~Ghi~~~kl~~~I~~~V~~k~~~~QreYyL~EQLKaIk  320 (941)
T TIGR00763       241 RLADLVAASLQLKEIEELQEVLETVNIEHKRLKKALELLKKELGHIELLKLQNKIAKKVEEKMEKTQREYYLREQLKAIK  320 (941)
T ss_pred             HHHHHHHHHHHHCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             58889998632036268999987408525789999999886310467899999988999998777667888888999988


Q ss_pred             H--HCCCCCCCCHHH-HHHHHHHCCCC--CCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCCCCCCC--CC
Q ss_conf             1--012466550467-89998522247--88578888899999998753110257899999876540415876632--21
Q gi|254780270|r  256 K--ELDNGEEGRDEI-SDFEARISKIR--LSKEAREKALSELQKLRQMNPLSAESSVVRNYLDWLLGVPWDKKSKT--KK  328 (820)
Q Consensus       256 k--ELGe~ed~~~Ei-~el~~Ki~~~~--lp~e~~~~~~kEl~rL~~m~~~s~E~~v~r~Yld~~~~lPW~~~t~~--~~  328 (820)
                      +  |||+.+|.++++ ++|++||++++  ||+++++++++||+||++|+|+|+||+|+|||||||++|||+++|++  ++
T Consensus       321 kyhELG~~~d~~~~~~~~~~~kle~~~e~~P~~~~k~~~~El~kL~~l~~~SsE~~v~RnYLDwl~~lPW~~~S~~f~n~  400 (941)
T TIGR00763       321 KYHELGIEKDDKDELIEKLKEKLEELKEFLPEEVKKVIEKELTKLELLEPSSSEFTVTRNYLDWLTDLPWGKYSKEFDNL  400 (941)
T ss_pred             HHHHCCCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHH
T ss_conf             87525899986478999999998740574774689999999987505883353046799999999837722147026652


Q ss_pred             HHHHHHHHHHHHHHCHHHHHHHHHHHHHHH-----------HHCCCCCCC-EEEEECCCCCCHHHHHHHHHHHHCCCEEE
Q ss_conf             068899877665201168999999999999-----------842444673-59986056565027999999770882499
Q gi|254780270|r  329 NLDFAIRILDQDHFGLEKVKERIIEYLAVQ-----------MRVIKNKGL-ILCFVGPPGVGKTSLAQSIAKATGRQYVR  396 (820)
Q Consensus       329 dl~~a~~iLd~~hyGl~~vK~rile~lav~-----------~~~~~~~g~-il~l~gppgvGKts~~~sia~al~r~f~~  396 (820)
                      ||.+|++|||+|||||++|||||||||||+           +|+++.+|| ||||||||||||||||+|||+||||+|+|
T Consensus       401 Dl~~A~~~LD~DHYGL~~VK~RIlEYlAV~qllemrrkkkPkL~~~~~GpqIlClvGPPGVGKTSlg~SIA~ALnRkFvR  480 (941)
T TIGR00763       401 DLKRAKEILDEDHYGLKKVKERILEYLAVQQLLEMRRKKKPKLRGKMKGPQILCLVGPPGVGKTSLGKSIAKALNRKFVR  480 (941)
T ss_pred             HHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCEEEE
T ss_conf             18999998316788887730341358889899987640364447788887678720726954222789999996880499


Q ss_pred             EECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECHHHHH--HHCCCCHHHHHHHHCCCCCCCCEEEEEC
Q ss_conf             86188888888356320014567128999998327887399993315542--3117711556655406001681332010
Q gi|254780270|r  397 MSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMG--SDLRGDPSAALLEVLDPAQNSSFVDHYL  474 (820)
Q Consensus       397 islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~ldeidk~~--~~~~gdp~~allevldp~qn~~f~d~y~  474 (820)
                      ||||||+||||||||||||||||||||||||++|||+|||||||||||||  +|+|||||||||||||||||++|.||||
T Consensus       481 ~SlGG~~DeAEIrGHRRTYvGAMPGriiQ~lk~~~t~NPl~LlDEIDK~~~~~~~~GDPaSALLEvLDPEQN~~F~DHYl  560 (941)
T TIGR00763       481 FSLGGVRDEAEIRGHRRTYVGAMPGRIIQGLKKAKTKNPLILLDEIDKIGLKSSFRGDPASALLEVLDPEQNNAFSDHYL  560 (941)
T ss_pred             EEECCCEEHHHCCCCCCCCCCCCHHHHHHHHHHCCCCCCEEEEEEEEEECCCCCCCCCHHHHHHHHCCHHHCCCCCCCCC
T ss_conf             95267220311278643203467257899987604158806862022001678865563788864128643604255300


Q ss_pred             CCCCCCCCEE--EEEECCCCC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHC
Q ss_conf             3523644279--999348655-4413117247998258786899989998608989986257813132289999999731
Q gi|254780270|r  475 EVEYDLSDVM--FIMTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRL  551 (820)
Q Consensus       475 ~~~~dls~v~--fi~tan~~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~  551 (820)
                      |||||||+||  ||||||+++ ||+|||||||||+|||||.+||++||++||+||+++.|||+++++.|+|+||..||+.
T Consensus       561 dvp~DLS~V~CyFi~TAN~~d~IP~PLLDRMEvI~lsGY~~~EK~~IA~~yLiP~~~~~~GL~~~~l~~~d~al~~lI~~  640 (941)
T TIGR00763       561 DVPFDLSKVLCYFIATANSIDTIPRPLLDRMEVIELSGYTEEEKLEIAKKYLIPKALEDHGLKPDELKISDEALLLLIKY  640 (941)
T ss_pred             CCCCCHHHHHHHEEECCCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHCCHHHHHHHHCCCCCCEEECHHHHHHHHHH
T ss_conf             23400420021000244757677722137402452388876789999985471367987088813221268999999987


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHCC------------------C---------------------------------
Q ss_conf             7741023478887999989876542117------------------8---------------------------------
Q gi|254780270|r  552 FTHEAGVRSFERALMKIARKAVTKIVKN------------------S---------------------------------  580 (820)
Q Consensus       552 Yt~EaGvR~l~r~i~~i~r~~~~~~~~~------------------~---------------------------------  580 (820)
                      ||||||||||+|+|++||||+|+++++.                  .                                 
T Consensus       641 YtREaGVRNL~r~I~~i~RK~A~~~~~~~~~~~~P~~~~dp~ea~~~e~~~e~~~k~~~e~~~~~~~~~~~~~~~~~~~~  720 (941)
T TIGR00763       641 YTREAGVRNLERQIEKICRKAAVKLVEQVKEEEEPAEAADPKEAEGGEKKKERTKKKTSEKSSDQESEKEKSEIQLKKSE  720 (941)
T ss_pred             HHHHHCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             51320213389999999999999998714633377634771120466655675546567656433457740001001376


Q ss_pred             CCEECCCHHHHHHHHCCCCCCCC-CHHCCCCCCCCCEEEECCCCCEEEEEEEEEECC--------CCCEEECCCHHHHHH
Q ss_conf             52012796786753052000332-000223365000000000168079999999748--------997244325689999
Q gi|254780270|r  581 DTTVSINENNLQDYLGVPRYKYG-KIEGEDQVGIVTGLAWTEVGGEILTVEGVIMPG--------KGEITITGNLKEIMK  651 (820)
Q Consensus       581 ~~~~~i~~~~l~~~lg~~~~~~~-~~~~~~~~G~v~GLa~t~~GG~~l~IE~~~~~g--------~g~l~lTG~lg~vmk  651 (820)
                      ..++.|+.++|++|||+|+|+.+ +.++...||||||||||++||++|+||++.+.|        +|.|++|||||||||
T Consensus       721 ~~~~~i~~~~L~~ylG~p~F~~~E~~~~~~~pGvV~GLAWT~~GG~~L~iEt~~~~gq~Dl~~~kkG~L~lTGqLGDVMK  800 (941)
T TIGR00763       721 KESVEITEDNLKKYLGKPVFTSEERAYETTPPGVVMGLAWTPMGGDTLFIETTKVAGQKDLKGDKKGSLELTGQLGDVMK  800 (941)
T ss_pred             CCEEEECHHHHHHHCCCCCCCCCCCCCCCCCCCEEECCEECCCCCEEEEEEEEEECCCCCCCCCCCCCEEECCCCCHHHH
T ss_conf             31378546788865289630645455457898568733223247713104479763740346688986677156525999


Q ss_pred             HHHHHHHHHHHHHHHHCCCCH----HHHHHCCCEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEEEECC
Q ss_conf             999999999999888629985----5742078147448888478887306899999999983688875610663685030
Q gi|254780270|r  652 ESILAASSYVRSKATTFGIIP----SAFNEINIHVHVPEGATPKDGPSAGIAMATAIVSIMTCIPVYKNVAMTGELTLRG  727 (820)
Q Consensus       652 ES~~~A~s~~k~~~~~~~~~~----~~~~~~diHih~p~Ga~pKDGPSAGi~i~tal~S~~~~~~v~~~iAmTGEitl~G  727 (820)
                      |||++|+||+|+++..+++++    +||+++||||||||||||||||||||||+|||+|++||+|||+|+||||||||||
T Consensus       801 ESA~~Alt~~r~~~~~~~i~~~~~l~ff~~~diH~HvPEGAtPKDGPSAG~tm~TaL~Sl~~~~~Vr~~~AMTGE~TLrG  880 (941)
T TIGR00763       801 ESAQIALTYVRSIAEDLGISPPKVLKFFEKADIHLHVPEGATPKDGPSAGITMATALLSLATGKPVRADVAMTGEITLRG  880 (941)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEECC
T ss_conf             99999999999999861888702342532265202137889898862479999999999970879885535510041023


Q ss_pred             EEEEECCHHHHHHHHHHCCCCEEECCHHHH-HHHHHCCHHHHCCCEEEECCCHHHHHHHHH
Q ss_conf             250006568999999970996998036775-507761488770979998193999888760
Q gi|254780270|r  728 RVLPIGGLKEKLLAALRAGVTKVLIPEENI-KDLMDIPENVKNGLEIIPVSFMGEVLKHAL  787 (820)
Q Consensus       728 ~VlpiGGi~eK~laA~raGi~~viiP~~N~-~d~~~ip~~~~~~l~~~~v~~~~evl~~al  787 (820)
                      +||||||||||++||||||||+||+|++|+ +||+|||++|+++|+||||+||+|||++||
T Consensus       881 ~VLpiGGlKEK~iAA~R~Gik~iilP~~N~e~Dl~elP~~v~e~L~~~~V~~~~ev~~~af  941 (941)
T TIGR00763       881 KVLPIGGLKEKTIAAKRAGIKTIILPEKNRERDLEELPENVKEGLEIHFVKHYDEVLKKAF  941 (941)
T ss_pred             CEEEECCHHHHHHHHHHHCEEEEECCCHHHCCCHHHHHHHHHHCCCEEEHHHHHHHHHHHC
T ss_conf             5620050468888853505007774612001526620398872784110032789999829


No 2  
>PRK10787 DNA-binding ATP-dependent protease La; Provisional
Probab=100.00  E-value=0  Score=2210.86  Aligned_cols=777  Identities=58%  Similarity=0.933  Sum_probs=764.8

Q ss_pred             CCCCEEEEEEEECCCEECCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHEECCCEEEEEEEEEECC
Q ss_conf             67763675663178256887143064294899999999997298499997368677788865602531489999979988
Q gi|254780270|r   22 GADGIIYPLLPLRDIVVFPYMIVPLFVGREKSVRALDEAMNSHKKIILVTQMNSNDENPIASSVYRIGTIVDIVQILRLP  101 (820)
Q Consensus        22 ~~~~~~LPIlPLrn~VLFPG~vlPL~V~eprsi~aIe~al~~d~~I~vV~qkD~~~e~p~~edLy~VGTlakI~qi~klp  101 (820)
                      .+..+.||++||||+|+|||+++||+|+|++|+++++.|+++++.+++++|+|+..++|+.+|||+|||+|+|+|+.++|
T Consensus         5 ~~e~l~LPvLPLRd~VvFPgmviPL~VGR~kSI~AlE~A~~~d~~I~LVaQKD~~~deP~~eDLY~VGTlAkI~QviklP   84 (784)
T PRK10787          5 RSERIEIPVLPLRDVVVYPHMVIPLFVGREKSIRCLEAAMDHDKKIMLVAQKEASTDEPGVNDLFTVGTVASILQMLKLP   84 (784)
T ss_pred             CCCCCEEEEEEECCCCCCCCCCEEEEECCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHCCCCCEEEEEEEEEECC
T ss_conf             78862467998589102799205899688899999999996499799997568887999814522562799999967879


Q ss_pred             CCEEEEEEEEEEEEEEEEEEECCCEEEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCHHH
Q ss_conf             98099999975479999887079819999998048888847899999999999999998545577788876412688678
Q gi|254780270|r  102 DGTVKILVEGSVRARIVEYIEREDFLEAITQVLPDPTEDPVELEALSRSVIAEFSNYIKLNKKISPEVIGITSQIEGFSK  181 (820)
Q Consensus       102 DG~~~ILVeGl~RvkI~ei~~~~pyl~A~Ve~l~d~~~d~~eleAL~~~L~e~f~eli~l~~~i~~E~~~~l~~iddp~~  181 (820)
                      ||+++|+|+|++||+|.++.+.+||+.|.+++++++..++.+.+++++.+++.|++|+++++.+++++...+.++++|++
T Consensus        85 DG~vkVLVeGl~RvkI~~~~~~~pyl~A~Ve~l~~~~~d~~E~EAL~r~li~~f~~~v~l~~~ip~E~l~~l~~iddp~k  164 (784)
T PRK10787         85 DGTVKVLVEGLQRARISALSDNGEHFSAKAEYLESPTIDEREQEVLVRTAISQFEGYIKLNKKIPPEVLTSLNSIDDPAR  164 (784)
T ss_pred             CCCEEEEEEEEEEEEEEEEECCCCCEEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCHHH
T ss_conf             99489999987789999997478968999998068888966899999999999999998576799999999983788899


Q ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHCCCC
Q ss_conf             99998852358989999987432479999999999998655666777754333322233211221011110000101246
Q gi|254780270|r  182 LADVIAANLSIKVAERQKILEAVSVKERLEMLLVFMESEISVLQVEKRIRSRVKRQMEKTQREYYLHEQMKAIQKELDNG  261 (820)
Q Consensus       182 LAD~IAs~L~l~~eeKQeLLE~~Di~eRLe~Ll~lL~~EiEilkLq~eI~~kVk~kidk~QREyyLREQLKaIqkELGe~  261 (820)
                      |+|++|++++++.++||++||+.|+.+|+++++.+|++|+++++++++|+++|+++|+++|||||||||||+||+|||++
T Consensus       165 LAD~IAs~L~ls~eeKQeLLE~~dvkeRLekll~lL~kElEileLe~kI~~kVkekm~K~QREyyLREQLkaIq~ELGe~  244 (784)
T PRK10787        165 LADTIAAHMPLKLADKQSVLEMSDVNERLEYLMAMMESEIDLLQVEKRIRNRVKKQMEKSQREYYLNEQMKAIQKELGEM  244 (784)
T ss_pred             HHHHHHHCCCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHCCC
T ss_conf             99998732799999999998638999999999999999999999999999999976406778999874102220220567


Q ss_pred             CCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             65504678999852224788578888899999998753110257899999876540415876632210688998776652
Q gi|254780270|r  262 EEGRDEISDFEARISKIRLSKEAREKALSELQKLRQMNPLSAESSVVRNYLDWLLGVPWDKKSKTKKNLDFAIRILDQDH  341 (820)
Q Consensus       262 ed~~~Ei~el~~Ki~~~~lp~e~~~~~~kEl~rL~~m~~~s~E~~v~r~Yld~~~~lPW~~~t~~~~dl~~a~~iLd~~h  341 (820)
                      ++..+|+++|++||++++||+++++++.+|++||++|+|+||||+|+||||||+++|||+++|++.+||++|+++||+||
T Consensus       245 ~~~~~e~~~~~~ki~~~~~p~~~~~~~~~El~rl~~~~~~s~E~~v~r~YLd~l~~LPW~~~t~d~~dl~~A~~iLd~dH  324 (784)
T PRK10787        245 DDAPDENEALKRKIDAAKMPKEAKEKAEAELQKLKMMSPMSAEATVVRGYIDWMVQVPWNARSKVKKDLRQAQEILDTDH  324 (784)
T ss_pred             CCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             64124899999999877999899999999999997189989418899999999975998888787569999999876543


Q ss_pred             HCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCH
Q ss_conf             01168999999999999842444673599860565650279999997708824998618888888835632001456712
Q gi|254780270|r  342 FGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPG  421 (820)
Q Consensus       342 yGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg  421 (820)
                      |||+||||||||||||++++++.+||||||||||||||||||||||+||||+|+||||||||||||||||||||||||||
T Consensus       325 yGL~~vKeRile~lAv~~~~~~~kg~IlclvGpPGvGKTSl~~sIA~al~r~f~rislGGv~DeaeirGHrrTYvgampG  404 (784)
T PRK10787        325 YGLERVKDRILEYLAVQSRVNKIKGPILCLVGPPGVGKTSLGQSIAKATGRKYVRMALGGVRDEAEIRGHRRTYIGSMPG  404 (784)
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCH
T ss_conf             06577999999999999862467787799646998772469999999858986998068878888825643343443683


Q ss_pred             HHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCCCCHHHCCC
Q ss_conf             89999983278873999933155423117711556655406001681332010352364427999934865544131172
Q gi|254780270|r  422 RIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLNIPLPLMDR  501 (820)
Q Consensus       422 ~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~i~~~l~dr  501 (820)
                      ||||+|++|||+|||||||||||+|++|||||+||||||||||||++|+|||||+|||||+||||||||+++||+||+||
T Consensus       405 rii~~l~~a~~~nPv~llDEiDK~~~~~~Gdp~salLEvLDpeQN~~F~Dhyl~~~~DlS~v~Fi~TaN~~~ip~pLlDR  484 (784)
T PRK10787        405 KLIQKMAKVGVKNPLFLLDEIDKMSSDMRGDPASALLEVLDPEQNVAFSDHYLEVDYDLSDVMFVATSNSMNIPAPLLDR  484 (784)
T ss_pred             HHHHHHHHHCCCCCEEEEHHHHHHCCCCCCCHHHHHHHHCCHHHCCCCCCCEEECCCCHHHEEEEEECCCCCCCHHHHHH
T ss_conf             89999997489885665003555224558998899998459765564000322046452225899732767787677631


Q ss_pred             EEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             47998258786899989998608989986257813132289999999731774102347888799998987654211785
Q gi|254780270|r  502 MEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSD  581 (820)
Q Consensus       502 me~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~~~  581 (820)
                      ||+|+++|||.+||++||++||+|||+++|||++.++.|++++|.+||++||||||||+|||+|++||||+|++++.++.
T Consensus       485 mE~i~~~gYt~~eK~~Ia~~~l~p~~~~~~gl~~~~~~~~~~~~~~ii~~ytrEaGvR~ler~i~~i~rk~~~~~~~~~~  564 (784)
T PRK10787        485 MEVIRLSGYTEDEKLNIAKRHLLPKQIERNALKKGELTVDDSAIIGIIRYYTREAGVRSLEREISKLCRKAVKQLLLDKS  564 (784)
T ss_pred             EEEEEECCCCHHHHHHHHHHHCHHHHHHHHCCCCCCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHCCCC
T ss_conf             21554116767889999997453999998289965674399999998753365444251688999999999999970788


Q ss_pred             -CEECCCHHHHHHHHCCCCCCCCCHHCCCCCCCCCEEEECCCCCEEEEEEEEEECCCCCEEECCCHHHHHHHHHHHHHHH
Q ss_conf             -2012796786753052000332000223365000000000168079999999748997244325689999999999999
Q gi|254780270|r  582 -TTVSINENNLQDYLGVPRYKYGKIEGEDQVGIVTGLAWTEVGGEILTVEGVIMPGKGEITITGNLKEIMKESILAASSY  660 (820)
Q Consensus       582 -~~~~i~~~~l~~~lg~~~~~~~~~~~~~~~G~v~GLa~t~~GG~~l~IE~~~~~g~g~l~lTG~lg~vmkES~~~A~s~  660 (820)
                       .+++|+.+++.+|||+++|..+....+++||+|||||||++||++|+||++.+||+|++++||||||||||||++|+||
T Consensus       565 ~~~~~i~~~~l~~~lg~~~~~~~~~~~~~~~Gv~~GLawt~~GG~~l~iE~~~~~gkg~l~lTG~lg~vmkES~~~A~s~  644 (784)
T PRK10787        565 LKHIEINGDNLHDYLGVQRFDYGRADNENRVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTV  644 (784)
T ss_pred             CCCEEECHHHHHHHHCCCCCCHHHHHCCCCCCEEEEEEEECCCCEEEEEEEEEECCCCCEEEECCCHHHHHHHHHHHHHH
T ss_conf             78558889999998299878812441368885799999815797689999998169886788624068999999999999


Q ss_pred             HHHHHHHCCCCHHHHHHCCCEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEEEECCEEEEECCHHHHHH
Q ss_conf             99988862998557420781474488884788873068999999999836888756106636850302500065689999
Q gi|254780270|r  661 VRSKATTFGIIPSAFNEINIHVHVPEGATPKDGPSAGIAMATAIVSIMTCIPVYKNVAMTGELTLRGRVLPIGGLKEKLL  740 (820)
Q Consensus       661 ~k~~~~~~~~~~~~~~~~diHih~p~Ga~pKDGPSAGi~i~tal~S~~~~~~v~~~iAmTGEitl~G~VlpiGGi~eK~l  740 (820)
                      +||++.+++++++||+++|||||||+||||||||||||||||||+|++|++|||+|+||||||||||+||||||||||++
T Consensus       645 ~r~~~~~~~i~~~~~~~~diHiH~P~Ga~pKDGPSAGit~~tal~S~~~~~~v~~~~amTGEitL~G~VlpiGG~keK~l  724 (784)
T PRK10787        645 VRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPSAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLL  724 (784)
T ss_pred             HHHHHHHHCCCCCCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEECEEEEEECCHHHHHH
T ss_conf             99989985899430126754895799999898742899999999999869998999655565660202782078999999


Q ss_pred             HHHHCCCCEEECCHHHHHHHHHCCHHHHCCCEEEECCCHHHHHHHHHCCCCCCCCCCC
Q ss_conf             9997099699803677550776148877097999819399988876027887655555
Q gi|254780270|r  741 AALRAGVTKVLIPEENIKDLMDIPENVKNGLEIIPVSFMGEVLKHALLRMPDPLESEG  798 (820)
Q Consensus       741 aA~raGi~~viiP~~N~~d~~~ip~~~~~~l~~~~v~~~~evl~~al~~~~~~~~~~~  798 (820)
                      ||+|+||++||||++|++|++|||++|+++|+||||+||+|||++||.+.|.+.+...
T Consensus       725 aA~r~gi~~vi~P~~N~~d~~~ip~~v~~~l~~~~v~~~~ev~~~al~~~p~~~~~~~  782 (784)
T PRK10787        725 AAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEPSGMQVVT  782 (784)
T ss_pred             HHHHCCCCEEEECHHHHHHHHHCCHHHHCCCEEEEECCHHHHHHHHHHCCCCCCCCCC
T ss_conf             9998499899945212355987499988698999939499999999756998861424


No 3  
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]
Probab=100.00  E-value=0  Score=2183.19  Aligned_cols=769  Identities=62%  Similarity=0.992  Sum_probs=756.3

Q ss_pred             EEEEEEECCCEECCCEEEEEECCCHHHHHHHHHHHHCC-CEEEEEECCCCCCCCCCHHHEECCCEEEEEEEEEECCCCEE
Q ss_conf             67566317825688714306429489999999999729-84999973686777888656025314899999799889809
Q gi|254780270|r   27 IYPLLPLRDIVVFPYMIVPLFVGREKSVRALDEAMNSH-KKIILVTQMNSNDENPIASSVYRIGTIVDIVQILRLPDGTV  105 (820)
Q Consensus        27 ~LPIlPLrn~VLFPG~vlPL~V~eprsi~aIe~al~~d-~~I~vV~qkD~~~e~p~~edLy~VGTlakI~qi~klpDG~~  105 (820)
                      .||++|||+.|+||+|++||+|+|++|+++++.++.++ ++|++++|+|...++|..+|+|+|||+|+|.|+.++|||++
T Consensus         9 ~lpvlplr~~vvfP~m~~pl~vgr~~si~ale~a~~~~~k~i~l~~qk~~~~d~p~~~dly~vGt~a~I~q~~~lpdg~~   88 (782)
T COG0466           9 ELPVLPLRDVVVFPGMVIPLFVGREKSIKALEEAMKNDQKYILLVTQKDASTDEPTEDDLYEVGTLAKILQILKLPDGTV   88 (782)
T ss_pred             CCEEEEECCCEECCCCEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCHHHHHHCCCCEEEEEEEECCCCCE
T ss_conf             63068715852078851668727753799999997278877999981376657997011331200116345355799847


Q ss_pred             EEEEEEEEEEEEEEEEECCCEEEEEEEEECCCCCC-CHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCHHHHHH
Q ss_conf             99999754799998870798199999980488888-47899999999999999998545577788876412688678999
Q gi|254780270|r  106 KILVEGSVRARIVEYIEREDFLEAITQVLPDPTED-PVELEALSRSVIAEFSNYIKLNKKISPEVIGITSQIEGFSKLAD  184 (820)
Q Consensus       106 ~ILVeGl~RvkI~ei~~~~pyl~A~Ve~l~d~~~d-~~eleAL~~~L~e~f~eli~l~~~i~~E~~~~l~~iddp~~LAD  184 (820)
                      +|+++|++|++|.++...++|+.|.++.+++...+ ..+.+|+.+.+.+.|++|+++++.++++....+..+++|++|||
T Consensus        89 kvlveg~~R~~I~~~~~~~~~~~a~~~~i~~~~~~~~~~~~al~~~i~~~~~~~~~l~~~~~~e~l~~~~~i~~~~klad  168 (782)
T COG0466          89 KVLVEGLQRVRISKLSDEEEFFEAEIELLPDEPIDEEREIEALVRSILSEFEEYAKLNKKIPPEELQSLNSIDDPGKLAD  168 (782)
T ss_pred             EEEEEEEEEEEEEEECCCCCCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCHHHHHH
T ss_conf             99997641689875426777169998863777654326799999999999999998455789999977751564578999


Q ss_pred             HHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHCCCCCCC
Q ss_conf             98852358989999987432479999999999998655666777754333322233211221011110000101246655
Q gi|254780270|r  185 VIAANLSIKVAERQKILEAVSVKERLEMLLVFMESEISVLQVEKRIRSRVKRQMEKTQREYYLHEQMKAIQKELDNGEEG  264 (820)
Q Consensus       185 ~IAs~L~l~~eeKQeLLE~~Di~eRLe~Ll~lL~~EiEilkLq~eI~~kVk~kidk~QREyyLREQLKaIqkELGe~ed~  264 (820)
                      ++|++++++.+++|++||+.|+.+||++++.+|..|++.++++++|+++|+++|+|+|||||||||||+||+|||++++.
T Consensus       169 ~iaa~l~~~~~~kQ~iLe~~~v~~Rlek~l~~l~~ei~~~~~ek~I~~kVk~~meK~QREyyL~EQlKaIqkELG~~~d~  248 (782)
T COG0466         169 TIAAHLPLKLEEKQEILETLDVKERLEKLLDLLEKEIDLLQLEKRIRKKVKEQMEKSQREYYLREQLKAIQKELGEDDDD  248 (782)
T ss_pred             HHHHHCCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             99985778789999998718899999999999999999999999999999998778889999999999999985888654


Q ss_pred             CHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHCH
Q ss_conf             04678999852224788578888899999998753110257899999876540415876632210688998776652011
Q gi|254780270|r  265 RDEISDFEARISKIRLSKEAREKALSELQKLRQMNPLSAESSVVRNYLDWLLGVPWDKKSKTKKNLDFAIRILDQDHFGL  344 (820)
Q Consensus       265 ~~Ei~el~~Ki~~~~lp~e~~~~~~kEl~rL~~m~~~s~E~~v~r~Yld~~~~lPW~~~t~~~~dl~~a~~iLd~~hyGl  344 (820)
                      .+|+++|++||++..||++|++++++|++||++|+|+||||+|+||||||+++|||+++|+++.||++|+++||+|||||
T Consensus       249 ~~e~~~~~~kie~~~~p~evkek~~~El~kL~~m~~~SaE~~ViRnYlDwll~lPW~~~sk~~~Dl~~a~~iLd~dHYGL  328 (782)
T COG0466         249 KDEVEELREKIEKLKLPKEAKEKAEKELKKLETMSPMSAEATVIRNYLDWLLDLPWGKRSKDKLDLKKAEKILDKDHYGL  328 (782)
T ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCCC
T ss_conf             55899999997516999899999999999985079999168899899999982887655421322999998744355671


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHH
Q ss_conf             68999999999999842444673599860565650279999997708824998618888888835632001456712899
Q gi|254780270|r  345 EKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRII  424 (820)
Q Consensus       345 ~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii  424 (820)
                      ++|||||+|||||++++++.+||||||||||||||||||+|||+||||+|+|||||||||||||||||||||||||||||
T Consensus       329 ekVKeRIlEyLAV~~l~~~~kGpILcLVGPPGVGKTSLgkSIA~al~RkfvR~sLGGvrDEAEIRGHRRTYIGaMPGrIi  408 (782)
T COG0466         329 EKVKERILEYLAVQKLTKKLKGPILCLVGPPGVGKTSLGKSIAKALGRKFVRISLGGVRDEAEIRGHRRTYIGAMPGKII  408 (782)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHH
T ss_conf             16899999999999861467885799978998870118999999958977999547654277753553123356872899


Q ss_pred             HHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHHHCCCEE
Q ss_conf             999832788739999331554231177115566554060016813320103523644279999348655-4413117247
Q gi|254780270|r  425 QSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLPLMDRME  503 (820)
Q Consensus       425 ~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~drme  503 (820)
                      |+|++||++|||||||||||||+|||||||||||||||||||++|.|||+|+|||||+||||||||+++ ||+||+||||
T Consensus       409 Q~mkka~~~NPv~LLDEIDKm~ss~rGDPaSALLEVLDPEQN~~F~DhYLev~yDLS~VmFiaTANsl~tIP~PLlDRME  488 (782)
T COG0466         409 QGMKKAGVKNPVFLLDEIDKMGSSFRGDPASALLEVLDPEQNNTFSDHYLEVPYDLSKVMFIATANSLDTIPAPLLDRME  488 (782)
T ss_pred             HHHHHHCCCCCEEEEECHHHCCCCCCCCHHHHHHHHCCHHHCCCHHHCCCCCCCCHHHEEEEEECCCCCCCCHHHHCCEE
T ss_conf             99998677687478640333167777886888886269765676122201676644325888603751329867843030


Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCE
Q ss_conf             99825878689998999860898998625781313228999999973177410234788879999898765421178520
Q gi|254780270|r  504 IIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDTT  583 (820)
Q Consensus       504 ~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~~~~~  583 (820)
                      +|+++|||.+||++||++||+|+++++|||++.++.|+|+||.+||++||||||||+|+|+|++||||++++++.++.+.
T Consensus       489 iI~lsgYt~~EKl~IAk~~LiPk~~~~~gL~~~el~i~d~ai~~iI~~YTREAGVR~LeR~i~ki~RK~~~~i~~~~~k~  568 (782)
T COG0466         489 VIRLSGYTEDEKLEIAKRHLIPKQLKEHGLKKGELTITDEAIKDIIRYYTREAGVRNLEREIAKICRKAAKKILLKKEKS  568 (782)
T ss_pred             EEEECCCCHHHHHHHHHHHCCHHHHHHCCCCCCCEEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             56426888699999999844568999759982335565899999999876762103899999999999999997257566


Q ss_pred             -ECCCHHHHHHHHCCCCCCCCCHHCCCCCCCCCEEEECCCCCEEEEEEEEEECCCCCEEECCCHHHHHHHHHHHHHHHHH
Q ss_conf             -1279678675305200033200022336500000000016807999999974899724432568999999999999999
Q gi|254780270|r  584 -VSINENNLQDYLGVPRYKYGKIEGEDQVGIVTGLAWTEVGGEILTVEGVIMPGKGEITITGNLKEIMKESILAASSYVR  662 (820)
Q Consensus       584 -~~i~~~~l~~~lg~~~~~~~~~~~~~~~G~v~GLa~t~~GG~~l~IE~~~~~g~g~l~lTG~lg~vmkES~~~A~s~~k  662 (820)
                       +.|+.++|++|||.++|++++..+.++||+|||||||++||++|+||++.+||+|++++||||||||||||++|+||+|
T Consensus       569 ~~~i~~~~l~~yLG~~~f~~~~~~~~~~vGvVtGLAWT~vGGd~L~IE~~~~~Gkg~l~lTG~LGdVMKESa~~A~s~vr  648 (782)
T COG0466         569 IVKIDEKNLKKYLGVPVFRYGKAEEEDQVGVVTGLAWTEVGGDLLTIEAVKMPGKGKLTLTGSLGDVMKESAQAALSYVR  648 (782)
T ss_pred             CEEECHHHHHHHHCCCCCCCCCCCCCCCCEEEEEEEEECCCCEEEEEEEEEECCCCCEEEECCHHHHHHHHHHHHHHHHH
T ss_conf             24427889999739863475311247887058544442478648999888716875079960579999999999999999


Q ss_pred             HHHHHCCCCHHHHHHCCCEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEEEECCEEEEECCHHHHHHHH
Q ss_conf             98886299855742078147448888478887306899999999983688875610663685030250006568999999
Q gi|254780270|r  663 SKATTFGIIPSAFNEINIHVHVPEGATPKDGPSAGIAMATAIVSIMTCIPVYKNVAMTGELTLRGRVLPIGGLKEKLLAA  742 (820)
Q Consensus       663 ~~~~~~~~~~~~~~~~diHih~p~Ga~pKDGPSAGi~i~tal~S~~~~~~v~~~iAmTGEitl~G~VlpiGGi~eK~laA  742 (820)
                      |++.+++++++||+++||||||||||||||||||||||||||+|++|++|||+++||||||||||+||||||+|||++||
T Consensus       649 s~a~~~~i~~~~fek~dIHiHVPeGAtPKDGPSAGitm~TAlvS~lt~~~V~~~vAMTGEITLrG~VLpIGGLKEKllAA  728 (782)
T COG0466         649 SRAEKLGIDPDFFEKRDIHIHVPEGATPKDGPSAGITMATALVSLLTGKPVRADVAMTGEITLRGRVLPIGGLKEKLLAA  728 (782)
T ss_pred             HHHHHCCCCCCCCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEEEEEEECCCHHHHHHHH
T ss_conf             98987199833333451388789999999886158999999999973999888854124578630246225598999999


Q ss_pred             HHCCCCEEECCHHHHHHHHHCCHHHHCCCEEEECCCHHHHHHHHHCCCCCCCC
Q ss_conf             97099699803677550776148877097999819399988876027887655
Q gi|254780270|r  743 LRAGVTKVLIPEENIKDLMDIPENVKNGLEIIPVSFMGEVLKHALLRMPDPLE  795 (820)
Q Consensus       743 ~raGi~~viiP~~N~~d~~~ip~~~~~~l~~~~v~~~~evl~~al~~~~~~~~  795 (820)
                      +|+|||+||+|++|++|++|||++|+++|+||||+||+|||++||+..|.+.+
T Consensus       729 ~R~GIk~viiP~~N~~DleeiP~~vk~~l~i~~V~~~deVlk~al~~~~~~~~  781 (782)
T COG0466         729 HRGGIKTVIIPKDNERDLEEIPDNVKEGLEIHPVKTIDEVLKLALVGNPEPIS  781 (782)
T ss_pred             HHCCCCEEECCCCCCCCHHHCCHHHHCCCEEEEECCHHHHHHHHHCCCCCCCC
T ss_conf             86598589646545014876779887497499925099999997168988777


No 4  
>KOG2004 consensus
Probab=100.00  E-value=0  Score=1865.71  Aligned_cols=773  Identities=40%  Similarity=0.648  Sum_probs=716.7

Q ss_pred             CCCCCCEEEEEEEECCCEECCCEEEEEECCCHHHHHHHHHHHHC-CCEEEEEECCCCCCCCCCHH---------------
Q ss_conf             14677636756631782568871430642948999999999972-98499997368677788865---------------
Q gi|254780270|r   20 RCGADGIIYPLLPLRDIVVFPYMIVPLFVGREKSVRALDEAMNS-HKKIILVTQMNSNDENPIAS---------------   83 (820)
Q Consensus        20 ~~~~~~~~LPIlPLrn~VLFPG~vlPL~V~eprsi~aIe~al~~-d~~I~vV~qkD~~~e~p~~e---------------   83 (820)
                      .....+..+|++|++..|||||.++++.|..++.+++|++.+.. ..++|++..||...++....               
T Consensus        61 ~~~~~~~~l~~Lpi~~~pLfPGf~~~i~v~~~~~~~~i~~~l~~~qpyiG~fl~kdd~~~~~~~t~~~~vyi~~~~~~~~  140 (906)
T KOG2004          61 SVPDVPPRLPALPITRGPLFPGFYKRIEVKSPKVLALIREKLRRQQPYIGAFLLKDDSSGDSVITSINEVYILEVFPGKD  140 (906)
T ss_pred             CCCCCCCCCCEEECCCCCCCCCCEEEEEECCHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCEEECCCCCEEEEECCCC
T ss_conf             88655754524333677767772368882688899999999973086412143036777874044415331245412776


Q ss_pred             ------HEECCCEE---EEEEEEEECCCCEEEEEEEEEEEEEEEEEEECCC--EEEEEEEEECCCC-CCCHHHHHHHHHH
Q ss_conf             ------60253148---9999979988980999999754799998870798--1999999804888-8847899999999
Q gi|254780270|r   84 ------SVYRIGTI---VDIVQILRLPDGTVKILVEGSVRARIVEYIERED--FLEAITQVLPDPT-EDPVELEALSRSV  151 (820)
Q Consensus        84 ------dLy~VGTl---akI~qi~klpDG~~~ILVeGl~RvkI~ei~~~~p--yl~A~Ve~l~d~~-~d~~eleAL~~~L  151 (820)
                            -.|+.+.+   +.|.+-.+...+.+.+++.|.+|+++.+...+.+  .+...++.+.+.+ ..+.++.|+..++
T Consensus       141 ~~~~~l~~hRr~~~~~~~~~~~g~~~~~~~~~~~~~~~~r~~i~e~~~e~~~~vl~v~v~~v~~e~~~~~~~~ka~~~ei  220 (906)
T KOG2004         141 KLRMVLYPHRRIRITELAPISEGKEDAEVEYSLLVTGLSRLNITEMKEEKEAEVLSVEVENVKDEPFKKDEEIKALTSEI  220 (906)
T ss_pred             CHHHHHHHHHEEEEEEECCCCCCCCCCCCCEEECCCCCCCCCCHHHHCCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHH
T ss_conf             12333403330342221145544445666443235652124501210246677425653105677667653778999999


Q ss_pred             HHHHHHHHHHCCCCCHHHHHHHH--CCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999854557778887641--2688678999988523589899999874324799999999999986556667777
Q gi|254780270|r  152 IAEFSNYIKLNKKISPEVIGITS--QIEGFSKLADVIAANLSIKVAERQKILEAVSVKERLEMLLVFMESEISVLQVEKR  229 (820)
Q Consensus       152 ~e~f~eli~l~~~i~~E~~~~l~--~iddp~~LAD~IAs~L~l~~eeKQeLLE~~Di~eRLe~Ll~lL~~EiEilkLq~e  229 (820)
                      ...++++++.++.+.+.......  ..++|.+|||+.|+....+..+.|++|++.|+.+||++.+.+|++|++..+|+++
T Consensus       221 ~~t~rdii~~n~l~r~~v~~~~~~~~~~~~~~LaD~~aai~~~~~~elq~vL~~~di~~Rl~~al~llkke~e~~klq~k  300 (906)
T KOG2004         221 LKTLRDIIAVNSLFREQVATLSQLIVEDNPIKLADFGAAISGAEFHELQEVLEETDIEKRLEKALELLKKELELAKLQQK  300 (906)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999752778999999998734467567889988885147789999987438788999999999999999999988


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCHHHHCCCCCCCCH-HHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCHHHHHH
Q ss_conf             5433332223321122101111000010124665504-678999852224788578888899999998753110257899
Q gi|254780270|r  230 IRSRVKRQMEKTQREYYLHEQMKAIQKELDNGEEGRD-EISDFEARISKIRLSKEAREKALSELQKLRQMNPLSAESSVV  308 (820)
Q Consensus       230 I~~kVk~kidk~QREyyLREQLKaIqkELGe~ed~~~-Ei~el~~Ki~~~~lp~e~~~~~~kEl~rL~~m~~~s~E~~v~  308 (820)
                      |.+.|++++.+.||+|+||||||+|++|||...|.++ ..++|++|++...||+++.+++.+|+.||+.|+++||||+++
T Consensus       301 i~k~vE~k~~~~~r~ylL~eQlk~IKkeLg~e~Ddkd~~~~~~~er~~~~~~P~~v~kv~~eEl~kL~~le~~~sEfnvt  380 (906)
T KOG2004         301 IGKEVEEKIKQDHREYLLREQLKAIKKELGIEKDDKDALVEKFRERIKSLKMPDHVLKVIDEELTKLKLLEPSSSEFNVT  380 (906)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCCHHHH
T ss_conf             53677766657789999999999988761777563166899999886211276999999999999874257556404389


Q ss_pred             HHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             99987654041587663221068899877665201168999999999999842444673599860565650279999997
Q gi|254780270|r  309 RNYLDWLLGVPWDKKSKTKKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAK  388 (820)
Q Consensus       309 r~Yld~~~~lPW~~~t~~~~dl~~a~~iLd~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~  388 (820)
                      ||||||+++||||++|.+++||.+|+++||+|||||++||+||||||||++|+++.+|+||||+|||||||||||||||+
T Consensus       381 rNYLdwlt~LPWgk~S~En~dl~~Ak~iLdeDHYgm~dVKeRILEfiAV~kLrgs~qGkIlCf~GPPGVGKTSI~kSIA~  460 (906)
T KOG2004         381 RNYLDWLTSLPWGKSSTENLDLARAKEILDEDHYGMEDVKERILEFIAVGKLRGSVQGKILCFVGPPGVGKTSIAKSIAR  460 (906)
T ss_pred             HHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCHHHHHHH
T ss_conf             89999998488787873530379898763465301688999999999987514667883799868998773218999999


Q ss_pred             HHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCC
Q ss_conf             70882499861888888883563200145671289999983278873999933155423117711556655406001681
Q gi|254780270|r  389 ATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSS  468 (820)
Q Consensus       389 al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~  468 (820)
                      ||||+|+|+|+||++|+||||||||||||||||||||+|+++|+.|||||||||||+|++++|||||||||+||||||++
T Consensus       461 ALnRkFfRfSvGG~tDvAeIkGHRRTYVGAMPGkiIq~LK~v~t~NPliLiDEvDKlG~g~qGDPasALLElLDPEQNan  540 (906)
T KOG2004         461 ALNRKFFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKVKTENPLILIDEVDKLGSGHQGDPASALLELLDPEQNAN  540 (906)
T ss_pred             HHCCCEEEEECCCCCCHHHHCCCCEEEECCCCHHHHHHHHHHCCCCCEEEEEHHHHHCCCCCCCHHHHHHHHCCHHHCCC
T ss_conf             84874699853663427764254211001488489999986177886588532234178877986899987439653553


Q ss_pred             EEEEECCCCCCCCCEEEEEECCCCC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHH
Q ss_conf             3320103523644279999348655-441311724799825878689998999860898998625781313228999999
Q gi|254780270|r  469 FVDHYLEVEYDLSDVMFIMTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLD  547 (820)
Q Consensus       469 f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~  547 (820)
                      |.|||||||||||+|+||||||.++ ||+|||||||+|+++||+.+||++||++||+|++++.+||+++++.++++|+..
T Consensus       541 FlDHYLdVp~DLSkVLFicTAN~idtIP~pLlDRMEvIelsGYv~eEKv~IA~~yLip~a~~~~gl~~e~v~is~~al~~  620 (906)
T KOG2004         541 FLDHYLDVPVDLSKVLFICTANVIDTIPPPLLDRMEVIELSGYVAEEKVKIAERYLIPQALKDCGLKPEQVKISDDALLA  620 (906)
T ss_pred             HHHHCCCCCCCHHHEEEEEECCCCCCCCHHHHHHHHEEECCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHCCCCHHHHHH
T ss_conf             45420266421110688985364456985664122322036722798999999841257898749987865862999999


Q ss_pred             HHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCC-----------------------------------CCEECCCHHHHH
Q ss_conf             973177410234788879999898765421178-----------------------------------520127967867
Q gi|254780270|r  548 IIRLFTHEAGVRSFERALMKIARKAVTKIVKNS-----------------------------------DTTVSINENNLQ  592 (820)
Q Consensus       548 ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~~-----------------------------------~~~~~i~~~~l~  592 (820)
                      +|++||||||||||+|+|++||||+|++++++.                                   ..++.|+.+||.
T Consensus       621 lI~~YcrEaGVRnLqk~iekI~Rk~Al~vv~~~~~~~~~~~~~~~~~~~~~~e~~~~~t~~~~~~~~~~~~i~I~~~nL~  700 (906)
T KOG2004         621 LIERYCREAGVRNLQKQIEKICRKVALKVVEGENSKEESAEKNGRESTEKSIEEAESSTSGADLLPEMPENIEIDESNLQ  700 (906)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECHHHHH
T ss_conf             99999888767789999999999999999986402335432232224432101344567544666677630365388999


Q ss_pred             HHHCCCCCCCCCHHCCCCCCCCCEEEECCCCCEEEEEEEEEECCC--CCEEECCCHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             530520003320002233650000000001680799999997489--972443256899999999999999998886299
Q gi|254780270|r  593 DYLGVPRYKYGKIEGEDQVGIVTGLAWTEVGGEILTVEGVIMPGK--GEITITGNLKEIMKESILAASSYVRSKATTFGI  670 (820)
Q Consensus       593 ~~lg~~~~~~~~~~~~~~~G~v~GLa~t~~GG~~l~IE~~~~~g~--g~l~lTG~lg~vmkES~~~A~s~~k~~~~~~~~  670 (820)
                      +|||+|.|+.++.++..+||||+|||||++||.+||||++.+.|.  |.|++|||||||||||+++|+||+|+++.++.+
T Consensus       701 d~lG~P~f~~e~~y~~tp~GVvmGLaWT~mGG~~lyvEts~~~~~~~g~l~~TGqLGDVMKESa~iA~t~ar~~~~~~~p  780 (906)
T KOG2004         701 DILGPPVFTSERMYEVTPPGVVMGLAWTAMGGSTLYVETSLMRGLGDGSLEITGQLGDVMKESAQIAYTWARAFLSKKEP  780 (906)
T ss_pred             HHHCCCCCCHHHHHCCCCCEEEEEEEEECCCCEEEEEEEEEECCCCCCCEEEECCHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             87489722077775037983699878853787578999887315778856883303888999999999999999876482


Q ss_pred             CHHHHHHCCCEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEEEECCEEEEECCHHHHHHHHHHCCCCEE
Q ss_conf             85574207814744888847888730689999999998368887561066368503025000656899999997099699
Q gi|254780270|r  671 IPSAFNEINIHVHVPEGATPKDGPSAGIAMATAIVSIMTCIPVYKNVAMTGELTLRGRVLPIGGLKEKLLAALRAGVTKV  750 (820)
Q Consensus       671 ~~~~~~~~diHih~p~Ga~pKDGPSAGi~i~tal~S~~~~~~v~~~iAmTGEitl~G~VlpiGGi~eK~laA~raGi~~v  750 (820)
                      .+.||++.|||+|||+||||||||||||||+|||+|+++++|||+|+||||||||||+||||||||||++||+|+|+|+|
T Consensus       781 ~n~~l~~~~IHlH~PeGAtpKDGPSAGvTmvTsLlSLa~~kpVr~d~AMTGEvTLtG~VLpiGGiKEK~iAA~RsG~k~i  860 (906)
T KOG2004         781 ENKFLENSDIHLHVPEGATPKDGPSAGVTMVTALLSLALGKPVRQDLAMTGEVTLTGKVLPVGGIKEKTIAARRSGVKTI  860 (906)
T ss_pred             CCCHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCEEEEEEEEEEEECCCHHHHHHHHHHHCCEEE
T ss_conf             31001156258856899889998753078999999997099755554212357764446742763788999887288289


Q ss_pred             ECCHHHHHHHHHCCHHHHCCCEEEECCCHHHHHHHHHCCCCC
Q ss_conf             803677550776148877097999819399988876027887
Q gi|254780270|r  751 LIPEENIKDLMDIPENVKNGLEIIPVSFMGEVLKHALLRMPD  792 (820)
Q Consensus       751 iiP~~N~~d~~~ip~~~~~~l~~~~v~~~~evl~~al~~~~~  792 (820)
                      |+|++|++|++++|++|+++|++|||++|+|||++||...+.
T Consensus       861 i~P~~N~~D~eelp~~vkegLev~~a~~yedv~~~aF~~~~~  902 (906)
T KOG2004         861 IFPEANRRDFEELPENVKEGLEVHFAETYEDVFEAAFDDGPT  902 (906)
T ss_pred             EECCCCHHHHHHHHHHHHHCCEEEEHHHHHHHHHHHHCCCCH
T ss_conf             725643666987458887067066388899999997278850


No 5  
>pfam05362 Lon_C Lon protease (S16) C-terminal proteolytic domain. The Lon serine proteases must hydrolyse ATP to degrade protein substrates. In Escherichia coli, these proteases are involved in turnover of intracellular proteins, including abnormal proteins following heat-shock. The active site for protease activity resides in a C-terminal domain. The Lon proteases are classified as family S16 in Merops.
Probab=100.00  E-value=0  Score=554.26  Aligned_cols=204  Identities=68%  Similarity=1.092  Sum_probs=201.9

Q ss_pred             CCCHHHHHHHHCCCCCCCCCHHCCCCCCCCCEEEECCCCCEEEEEEEEEECCCCCEEECCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             27967867530520003320002233650000000001680799999997489972443256899999999999999998
Q gi|254780270|r  585 SINENNLQDYLGVPRYKYGKIEGEDQVGIVTGLAWTEVGGEILTVEGVIMPGKGEITITGNLKEIMKESILAASSYVRSK  664 (820)
Q Consensus       585 ~i~~~~l~~~lg~~~~~~~~~~~~~~~G~v~GLa~t~~GG~~l~IE~~~~~g~g~l~lTG~lg~vmkES~~~A~s~~k~~  664 (820)
                      +||+++|.+|||+|+|.++++++.++||+|||||||++||.+|+||++.+||+|++++||+||||||||+++|+||+|++
T Consensus         1 ti~~~~l~~~lG~~~~~~~~~~~~~~iG~vnGLa~t~~GG~il~IE~~~~~g~g~l~lTG~lg~vmkES~~~A~s~~ks~   80 (205)
T pfam05362         1 TITAKNLEKYLGVPRFRYEEAEKEDQVGVVTGLAWTEVGGDLLTIEATIMPGKGKLTLTGQLGDVMKESAQAALSYVRSR   80 (205)
T ss_pred             CCCHHHHHHHCCCCCCCCCCCCCCCCCEEEEEEEEECCCCEEEEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             94978999965997677753446898719999899279978899999995588840034755789999999999999999


Q ss_pred             HHHCCCCHHHHHHCCCEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEEEECCEEEEECCHHHHHHHHHH
Q ss_conf             88629985574207814744888847888730689999999998368887561066368503025000656899999997
Q gi|254780270|r  665 ATTFGIIPSAFNEINIHVHVPEGATPKDGPSAGIAMATAIVSIMTCIPVYKNVAMTGELTLRGRVLPIGGLKEKLLAALR  744 (820)
Q Consensus       665 ~~~~~~~~~~~~~~diHih~p~Ga~pKDGPSAGi~i~tal~S~~~~~~v~~~iAmTGEitl~G~VlpiGGi~eK~laA~r  744 (820)
                      +.+++++.++|+++|||||||+||+||||||||+||+|||+|+++++||++++||||||||+|+|+||||++||++||+|
T Consensus        81 ~~~~~~~~~~~~~~diHih~p~Ga~pkDGPSAGiai~~Ai~S~l~~~pV~~~iAmTGEIsL~G~VlpIGGv~eKi~aA~r  160 (205)
T pfam05362        81 AEELGIDPDFFEKKDIHIHVPEGATPKDGPSAGVTMATALVSALTGIPVRKDVAMTGEITLRGRVLPIGGLKEKLLAAHR  160 (205)
T ss_pred             HHHHCCCCCHHHHEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCEEEEECCEEEEEEEEECCHHHHHHHHHH
T ss_conf             99808993246614599972466667777630389999999999488767887996033135679984899999999999


Q ss_pred             CCCCEEECCHHHHHHHHHCCHHHHCCCEEEECCCHHHHHHHHHC
Q ss_conf             09969980367755077614887709799981939998887602
Q gi|254780270|r  745 AGVTKVLIPEENIKDLMDIPENVKNGLEIIPVSFMGEVLKHALL  788 (820)
Q Consensus       745 aGi~~viiP~~N~~d~~~ip~~~~~~l~~~~v~~~~evl~~al~  788 (820)
                      +|+|+||||++|++|++|+|++++++++|+||+|++|||++||+
T Consensus       161 aGik~ViiP~~N~~dl~~ip~~i~~~i~i~~V~~i~evl~~al~  204 (205)
T pfam05362       161 AGIKTVIIPKENEKDLEEIPENVREGLEIIPVEHVDEVLKHALV  204 (205)
T ss_pred             HCCCEEEECHHHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHC
T ss_conf             39988997477766799834999769999996939999999747


No 6  
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family; InterPro: IPR014252   This entry shows some relation to the widely distributed ATP-dependent protease La, also called Lon or LonA (IPR004815 from INTERPRO), but is more closely related to LonB (IPR014251 from INTERPRO), a LonA paralog found only in endospore-forming bacteria. Proteins in this entry are unassigned peptidases belonging to the MEROPS peptidase family S16 (lon protease family, clan SJ). They are restricted to a subset of endospore-forming species, and probably participate in the program of endospore formation. We propose the designation LonC..
Probab=100.00  E-value=0  Score=496.85  Aligned_cols=466  Identities=30%  Similarity=0.519  Sum_probs=344.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CCCCHHHHCCCCCCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHH
Q ss_conf             99998655666777754333322233211221011-11000010124665504678999852224788578888899999
Q gi|254780270|r  215 VFMESEISVLQVEKRIRSRVKRQMEKTQREYYLHE-QMKAIQKELDNGEEGRDEISDFEARISKIRLSKEAREKALSELQ  293 (820)
Q Consensus       215 ~lL~~EiEilkLq~eI~~kVk~kidk~QREyyLRE-QLKaIqkELGe~ed~~~Ei~el~~Ki~~~~lp~e~~~~~~kEl~  293 (820)
                      +++..-+..--++++|.++|+.+|.+.|-+|| +| ++-+|+++-|-  +...-+++| +||++                
T Consensus        76 ~~iad~~A~R~v~~~iE~~ve~~l~erq~~Yl-~Eir~~vlk~~~g~--En~sTLKkl-~~Le~----------------  135 (616)
T TIGR02903        76 DHIADILARRTVENEIERKVEKKLQERQNKYL-EEIRLQVLKEEKGP--ENSSTLKKL-ERLEK----------------  135 (616)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHCCCC--CHHHHHHHH-HHHHH----------------
T ss_conf             99999886433567889999999887666899-99988775205788--616788999-98752----------------


Q ss_pred             HHHHHHHCCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHCHHHH--HHHHHHHHHHHHHCCCCCCCEEEE
Q ss_conf             998753110257899999876540415876632210688998776652011689--999999999998424446735998
Q gi|254780270|r  294 KLRQMNPLSAESSVVRNYLDWLLGVPWDKKSKTKKNLDFAIRILDQDHFGLEKV--KERIIEYLAVQMRVIKNKGLILCF  371 (820)
Q Consensus       294 rL~~m~~~s~E~~v~r~Yld~~~~lPW~~~t~~~~dl~~a~~iLd~~hyGl~~v--K~rile~lav~~~~~~~~g~il~l  371 (820)
                       |++..-+.+=.+.+|         |-.                      +.++  .||-|.-|  ..--.+.-++.+.|
T Consensus       136 -Lek~kl~~s~~slLR---------P~~----------------------f~EiVGQerAI~aL--laK~aSPfPQHiiL  181 (616)
T TIGR02903       136 -LEKKKLAKSIQSLLR---------PRA----------------------FSEIVGQERAIKAL--LAKLASPFPQHIIL  181 (616)
T ss_pred             -HHHHHHHHHHHHHCC---------CCC----------------------CCCCCCHHHHHHHH--HHHHCCCCCCCEEE
T ss_conf             -447889999998628---------766----------------------76433346899999--97631888660785


Q ss_pred             ECCCCCCHHHHHHHH---HHHHCC-------CEEEEE---------------CCCCCCHHHHCCCCCCCCCCCCHHHHHH
Q ss_conf             605656502799999---977088-------249986---------------1888888883563200145671289999
Q gi|254780270|r  372 VGPPGVGKTSLAQSI---AKATGR-------QYVRMS---------------LGGVYDEADIRGHRRTYIGSMPGRIIQS  426 (820)
Q Consensus       372 ~gppgvGKts~~~si---a~al~r-------~f~~is---------------lgg~~d~~~i~gh~~ty~ga~pg~ii~~  426 (820)
                      +||||||||+.||-.   ||-|+.       +|+-+.               ||.|||               |  |.|+
T Consensus       182 YGPPGVGKTTaARl~LEe~K~~~~tPF~~DA~FvEVDGtTLRWDPREvTNPLLGSVHD---------------P--IYQG  244 (616)
T TIGR02903       182 YGPPGVGKTTAARLALEEAKKLKNTPFAEDAPFVEVDGTTLRWDPREVTNPLLGSVHD---------------P--IYQG  244 (616)
T ss_pred             ECCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCC---------------C--CCCC
T ss_conf             5733884789999987621368744761137857515762667741014776776257---------------6--5567


Q ss_pred             HHH----CCCCCE-----------EEEEECHHHHHHHCCCCH--HHHHHHHC------------CCCCCC--CEEEEEC-
Q ss_conf             983----278873-----------999933155423117711--55665540------------600168--1332010-
Q gi|254780270|r  427 LKR----AKRSNP-----------LLLLDEIDKMGSDLRGDP--SAALLEVL------------DPAQNS--SFVDHYL-  474 (820)
Q Consensus       427 l~~----~~~~np-----------v~~ldeidk~~~~~~gdp--~~allevl------------dp~qn~--~f~d~y~-  474 (820)
                      -++    +|+..|           |.++|||.-|      ||  .+-||-||            ||.-.+  .|.-..| 
T Consensus       245 a~RDLAE~GvPEPk~GLVT~AHGGvLFIDEIGEL------D~lLQnKLLKVLEDKrV~F~SsYYDpdD~NvPkYIK~lFe  318 (616)
T TIGR02903       245 ARRDLAETGVPEPKLGLVTDAHGGVLFIDEIGEL------DPLLQNKLLKVLEDKRVEFSSSYYDPDDENVPKYIKKLFE  318 (616)
T ss_pred             CCHHHCCCCCCCCCCCCCCCCCCCEEEEECHHHH------HHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCHHHHHHHC
T ss_conf             6401104787989898710047756765021122------2787632444322643665321248753786558888522


Q ss_pred             -CCCCCCCCEEEE---EECCCC-CCCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHH
Q ss_conf             -352364427999---934865-544131172479982587868999899986089899862578131322899999997
Q gi|254780270|r  475 -EVEYDLSDVMFI---MTANTL-NIPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDII  549 (820)
Q Consensus       475 -~~~~dls~v~fi---~tan~~-~i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii  549 (820)
                       +-|-|     ||   ||--+- +|.++||.|---|.+.+.|.+|=..|..+     .-+     +-++.+.++ +..+|
T Consensus       319 ~GAPAD-----FvLIGATTr~P~eINpALRSRCaEvfFePL~p~dI~~Iv~~-----AA~-----klnv~L~~g-V~e~I  382 (616)
T TIGR02903       319 EGAPAD-----FVLIGATTRDPEEINPALRSRCAEVFFEPLTPEDIKEIVLN-----AAE-----KLNVKLAEG-VEELI  382 (616)
T ss_pred             CCCCCC-----EEEECCCCCCHHHCCHHHHCCCCEEECCCCCHHHHHHHHHH-----HHH-----HCCCCCCCC-HHHHH
T ss_conf             688825-----68726615882440512330143132179887899999999-----888-----617700036-48787


Q ss_pred             HCCCCCCHHHHHHHHHHHHHHHHHHHHHCC--CCCEECCCHHHHHHHHCCCCC---CCCCHHCCCCCCCCCEEEECCCCC
Q ss_conf             317741023478887999989876542117--852012796786753052000---332000223365000000000168
Q gi|254780270|r  550 RLFTHEAGVRSFERALMKIARKAVTKIVKN--SDTTVSINENNLQDYLGVPRY---KYGKIEGEDQVGIVTGLAWTEVGG  624 (820)
Q Consensus       550 ~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~--~~~~~~i~~~~l~~~lg~~~~---~~~~~~~~~~~G~v~GLa~t~~GG  624 (820)
                      ..||-| | |.-=-.|+..+..+-.+-...  ...+++|+.+++.+.++..|.   ...+...+..||.|.||++..+=|
T Consensus       383 a~YTie-G-RkAvnILAD~Yg~~ly~~~~~~~~~d~~~I~~~dv~evv~~sRl~Py~~~~~~~~~EvG~vFGLGV~gy~G  460 (616)
T TIGR02903       383 ARYTIE-G-RKAVNILADVYGYALYKKAEALKEEDKVTITADDVKEVVQISRLSPYEKVKASDTYEVGHVFGLGVSGYLG  460 (616)
T ss_pred             HHCCCC-C-HHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEHHHHHHHHHHCCCCCHHHCCCCCCCCEEEEEECCCCCCCC
T ss_conf             214713-1-12223465467676530455567777426618677767753045750112468886304687042121002


Q ss_pred             EEEEEEEEEE----CCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHCCCEEECCCCC-CCCCCCCHHHH
Q ss_conf             0799999997----489972443256899999999999999998886299855742078147448888-47888730689
Q gi|254780270|r  625 EILTVEGVIM----PGKGEITITGNLKEIMKESILAASSYVRSKATTFGIIPSAFNEINIHVHVPEGA-TPKDGPSAGIA  699 (820)
Q Consensus       625 ~~l~IE~~~~----~g~g~l~lTG~lg~vmkES~~~A~s~~k~~~~~~~~~~~~~~~~diHih~p~Ga-~pKDGPSAGi~  699 (820)
                      ++|.||+..+    ||+|.+.+.-..|.+.|.|+..|.|.+|      .++..++.+|||||+|=.|+ +  ||||||.|
T Consensus       461 S~lEIEa~aF~A~~~GkG~~RfNdTAGSMaKDSvFNAasviR------k~T~~D~~~yD~HVNViGGG~I--DGPSAG~A  532 (616)
T TIGR02903       461 SVLEIEAVAFEAKEKGKGTVRFNDTAGSMAKDSVFNAASVIR------KITGKDLKDYDIHVNVIGGGRI--DGPSAGAA  532 (616)
T ss_pred             CEEEEEEEEECCCCCCCEEEEEECCCCCCHHHHHHHHHHHHH------HHCCCCCCCCCEEEEEECCCCC--CCCCHHHH
T ss_conf             333555044237789950588615655303577898899986------5304683416517888527701--75325799


Q ss_pred             HHHHHHHHHHCCCCCCCCEEEEEEEECCEEEEECCHHHHHHHHHHCCCCEEECCHHHHHHHHHCCHHHHCCCEEEECCCH
Q ss_conf             99999999836888756106636850302500065689999999709969980367755077614887709799981939
Q gi|254780270|r  700 MATAIVSIMTCIPVYKNVAMTGELTLRGRVLPIGGLKEKLLAALRAGVTKVLIPEENIKDLMDIPENVKNGLEIIPVSFM  779 (820)
Q Consensus       700 i~tal~S~~~~~~v~~~iAmTGEitl~G~VlpiGGi~eK~laA~raGi~~viiP~~N~~d~~~ip~~~~~~l~~~~v~~~  779 (820)
                      |+.||+||++++||||||||||||||+|+|.|||||.|||.||+|+||++|+||++|.||   +|..+ .+|++.+|+++
T Consensus       533 i~~~~~SA~~~~p~rQDvAiTGEiS~~G~ikpVGGi~EKIYGAk~~gi~~V~~P~~N~kd---vPqg~-~~I~v~~v~~i  608 (616)
T TIGR02903       533 ITLCIISAILDKPIRQDVAITGEISLRGKIKPVGGIFEKIYGAKRAGIKTVVIPEDNLKD---VPQGL-KGIEVKAVKTI  608 (616)
T ss_pred             HHHHHHHHHCCCCCEEEEEEEEEEEEECEEEECCCCCCCCHHHHHCCCCEEECCCCCCCC---CCCCC-CCCEEEEECCH
T ss_conf             999999987089830225651038860216512663333214553474354367300213---56678-87158970518


Q ss_pred             HHHHHHHH
Q ss_conf             99888760
Q gi|254780270|r  780 GEVLKHAL  787 (820)
Q Consensus       780 ~evl~~al  787 (820)
                      +|++++++
T Consensus       609 EE~~~iv~  616 (616)
T TIGR02903       609 EELLEIVF  616 (616)
T ss_pred             HHHHHHHC
T ss_conf             98998609


No 7  
>TIGR02902 spore_lonB ATP-dependent protease LonB; InterPro: IPR014251   This entry represents LonB, a paralog of the ATP-dependent protease La (LonA, IPR004815 from INTERPRO). LonB proteins are unassigned peptidases belonging to the MEROPS peptidase family S16 (lon protease family, clan SJ) and are found strictly, and almost universally, in endospore-forming bacteria. This protease was shown, in Bacillus subtilis, to be expressed specifically in the forespore during sporulation, under control of sigmaF . The lonB gene, despite being located immediately upstream of lonA, was shown to be monocistronic. LonB appears to be involved in the post-translation control of sigmaH, but lonB mutation did not produce an obvious sporulation defect under the conditions tested . Note that additional paralogs of LonA and LonB occur in the Clostridium lineage and these are excluded from this entry. .
Probab=100.00  E-value=0  Score=443.19  Aligned_cols=417  Identities=33%  Similarity=0.477  Sum_probs=305.1

Q ss_pred             HHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCCCCC-CCCCH-HHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCC-
Q ss_conf             888999999987531102578999998765404158766-32210-688998776652011689999999999998424-
Q gi|254780270|r  286 EKALSELQKLRQMNPLSAESSVVRNYLDWLLGVPWDKKS-KTKKN-LDFAIRILDQDHFGLEKVKERIIEYLAVQMRVI-  362 (820)
Q Consensus       286 ~~~~kEl~rL~~m~~~s~E~~v~r~Yld~~~~lPW~~~t-~~~~d-l~~a~~iLd~~hyGl~~vK~rile~lav~~~~~-  362 (820)
                      +.-+|||++|.+|-.=+             |+-|-.+.| +.++| |.-           -|   +      ..+.|+- 
T Consensus        34 kESkKEl~kLn~mR~I~-------------Lt~PL~Ek~RP~SF~EIiG-----------Qe---~------GI~ALKAA   80 (532)
T TIGR02902        34 KESKKELDKLNKMRAIR-------------LTEPLSEKTRPKSFDEIIG-----------QE---E------GIKALKAA   80 (532)
T ss_pred             ECCHHHHHHHHCCCEEE-------------CCCCCCCCCCCCCCCCCCC-----------CH---H------HHHHHHHH
T ss_conf             04768998761114341-------------6788774667776332567-----------35---5------68999986


Q ss_pred             --CCCCCEEEEECCCCCCHHHHHHHH-HHHHCC---------CEEEEE---------------CCCCCCHHHHCCCCCCC
Q ss_conf             --446735998605656502799999-977088---------249986---------------18888888835632001
Q gi|254780270|r  363 --KNKGLILCFVGPPGVGKTSLAQSI-AKATGR---------QYVRMS---------------LGGVYDEADIRGHRRTY  415 (820)
Q Consensus       363 --~~~g~il~l~gppgvGKts~~~si-a~al~r---------~f~~is---------------lgg~~d~~~i~gh~~ty  415 (820)
                        -.+.+..-++||||||||--||=+ -.|-.-         +||-|.               +|.|||.        =|
T Consensus        81 LCGPNPQHVIiYGPPGVGKTAAARLVLeeAKk~~~SPFke~A~FVEiDATT~RFDERGIADPLIGSVHDP--------IY  152 (532)
T TIGR02902        81 LCGPNPQHVIIYGPPGVGKTAAARLVLEEAKKNPASPFKEEAAFVEIDATTARFDERGIADPLIGSVHDP--------IY  152 (532)
T ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCC--------CC
T ss_conf             0686896389878869617899999999865087537898866898505103602146666567761585--------33


Q ss_pred             CCCCCHHHHHHHHHCCCCCE-----------EEEEECHHHHHHHCCCCHHHHHHHHC---------------CCCCCCCE
Q ss_conf             45671289999983278873-----------99993315542311771155665540---------------60016813
Q gi|254780270|r  416 IGSMPGRIIQSLKRAKRSNP-----------LLLLDEIDKMGSDLRGDPSAALLEVL---------------DPAQNSSF  469 (820)
Q Consensus       416 ~ga~pg~ii~~l~~~~~~np-----------v~~ldeidk~~~~~~gdp~~allevl---------------dp~qn~~f  469 (820)
                      =||-|      |=.||---|           |.++|||--+-.-    -++-||-||               ||+==+.-
T Consensus       153 QGAGp------lG~AGIPQPK~GAVT~AHGGvLFIDEIGELHP~----~MNKLLKVLEDRKVFLdSAYY~s~~pniP~hI  222 (532)
T TIGR02902       153 QGAGP------LGVAGIPQPKPGAVTKAHGGVLFIDEIGELHPV----QMNKLLKVLEDRKVFLDSAYYSSEDPNIPSHI  222 (532)
T ss_pred             CCCCC------CCCCCCCCCCCCCCCCCCCCEEEECCCCCCCHH----HHHHHHHHHHCCCCHHHCCCCCCCCCCCCHHH
T ss_conf             37654------578855758777632025865512124665824----35314113302220000123587778654278


Q ss_pred             EEEEC-CCCCCCCCEEEEEECCCCCCCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHH
Q ss_conf             32010-35236442799993486554413117247998258786899989998608989986257813132289999999
Q gi|254780270|r  470 VDHYL-EVEYDLSDVMFIMTANTLNIPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDI  548 (820)
Q Consensus       470 ~d~y~-~~~~dls~v~fi~tan~~~i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~i  548 (820)
                      +|=|= ++|-|+= -.==+|-|--.||++||.|-=-|..-+.-.+|=.+|||+     .-+     +-.++++.+|++. 
T Consensus       223 ~dIFqnGlPADFR-LiGATTR~PeEIpPAlRSRC~EIFFR~L~~EEi~~iAk~-----Aae-----KIg~~l~~~Al~~-  290 (532)
T TIGR02902       223 RDIFQNGLPADFR-LIGATTRNPEEIPPALRSRCVEIFFRPLLKEEIKEIAKN-----AAE-----KIGLNLEKEALDL-  290 (532)
T ss_pred             HHHHCCCCCCCEE-CCCCCCCCCCCCCHHHHCCCEEEEECCCCHHHHHHHHHH-----HHH-----HCCCCCCHHHHHH-
T ss_conf             9972067873401-213336987767834650522677168887899999876-----565-----3046547547999-


Q ss_pred             HHCCC---CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHCCCCCC---CCCHHCCCCCCCCCEEEECCC
Q ss_conf             73177---410234788879999898765421178520127967867530520003---320002233650000000001
Q gi|254780270|r  549 IRLFT---HEAGVRSFERALMKIARKAVTKIVKNSDTTVSINENNLQDYLGVPRYK---YGKIEGEDQVGIVTGLAWTEV  622 (820)
Q Consensus       549 i~~Yt---~EaGvR~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~lg~~~~~---~~~~~~~~~~G~v~GLa~t~~  622 (820)
                      |..||   ||| | ||       +- .|--++-++. .-.|..++++...-.-.|+   ..++..+|+||.|||||++.-
T Consensus       291 I~~Ya~nGREA-v-N~-------~Q-LAaG~a~~E~-Rk~I~~~DieWV~~~G~y~Pk~~~k~~~~P~iG~VNGLaV~Gp  359 (532)
T TIGR02902       291 IAKYASNGREA-V-NL-------VQ-LAAGIALGEN-RKRILAEDIEWVIESGNYHPKPEIKLSSEPQIGLVNGLAVYGP  359 (532)
T ss_pred             HHHHHCCCCHH-H-HH-------HH-HHHHHEECCC-CCEECHHHHHHHHHHCCCCCCCCEEECCCCCEEEEECCEECCC
T ss_conf             99874054067-7-89-------99-9731401288-7612054644555304787743402078885356655446067


Q ss_pred             C-CEEEEEEEEEEC---C-CCCEEECCCH--------------HHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHCCCEEE
Q ss_conf             6-807999999974---8-9972443256--------------8999999999999999988862998557420781474
Q gi|254780270|r  623 G-GEILTVEGVIMP---G-KGEITITGNL--------------KEIMKESILAASSYVRSKATTFGIIPSAFNEINIHVH  683 (820)
Q Consensus       623 G-G~~l~IE~~~~~---g-~g~l~lTG~l--------------g~vmkES~~~A~s~~k~~~~~~~~~~~~~~~~diHih  683 (820)
                      - |.+|.||+++.+   + .|++.+||=.              ....|=|+..++|.+|+.   +++++   ++|||||+
T Consensus       360 n~G~vl~~E~~a~~a~~~~qG~i~vtGIiEEE~~gg~~~~~~rKS~a~gSvENV~~Vl~~~---~~i~p---~~YDIHiN  433 (532)
T TIGR02902       360 NSGAVLEVEVTAERAENKRQGSINVTGIIEEEEIGGSGKSVRRKSSAKGSVENVLAVLKSV---FNINP---KDYDIHIN  433 (532)
T ss_pred             CCCCEEEEEEEEEECCCCCCCEEEEEEEEEECEECCCCCEEEHHHHHHHHHHHHHHHHHHH---HCCCC---CCCCEEEE
T ss_conf             7551302343776601148842899888710001798961520022443088999999988---47882---12647885


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEEEECCEEEEECCHHHHHHHHHHCCCCEEECCHHHHHHHHHC
Q ss_conf             48888478887306899999999983688875610663685030250006568999999970996998036775507761
Q gi|254780270|r  684 VPEGATPKDGPSAGIAMATAIVSIMTCIPVYKNVAMTGELTLRGRVLPIGGLKEKLLAALRAGVTKVLIPEENIKDLMDI  763 (820)
Q Consensus       684 ~p~Ga~pKDGPSAGi~i~tal~S~~~~~~v~~~iAmTGEitl~G~VlpiGGi~eK~laA~raGi~~viiP~~N~~d~~~i  763 (820)
                      || |.+|-|||||||||++|++||+++.||++.+||||||||+|.|.|||||..||-||+|||.|+||||++|.....  
T Consensus       434 Fp-GG~PvDGPSAG~aiA~aiySA~~~~PIdn~vAmTGEISL~G~VKPVGGV~~Ki~AA~~AGak~ViIP~eNwqe~~--  510 (532)
T TIGR02902       434 FP-GGIPVDGPSAGVAIAVAIYSAIKKVPIDNKVAMTGEISLNGLVKPVGGVVSKIEAAKKAGAKKVIIPYENWQESF--  510 (532)
T ss_pred             CC-CCCCCCCHHHHHHHHHHHHHHHHCCCCCCCEEEEEEEEEEEEEEECCCCCHHHHHHHHCCCCEEECCCCHHHHHH--
T ss_conf             48-788422600899999999998717888772111333864010520178612689999749726534752078999--


Q ss_pred             CHHHHCCCEEEECCCHHHHHHHHH
Q ss_conf             488770979998193999888760
Q gi|254780270|r  764 PENVKNGLEIIPVSFMGEVLKHAL  787 (820)
Q Consensus       764 p~~~~~~l~~~~v~~~~evl~~al  787 (820)
                       +. -++|++++|++++|||+.+|
T Consensus       511 -~~-~~~I~vipVk~~~E~l~~~l  532 (532)
T TIGR02902       511 -ES-ISGIKVIPVKNIDEVLEVAL  532 (532)
T ss_pred             -HH-HCCEEEEECCCHHHHHHHHC
T ss_conf             -85-52715863263899998839


No 8  
>PRK13765 ATP-dependent protease Lon; Provisional
Probab=100.00  E-value=0  Score=382.30  Aligned_cols=352  Identities=28%  Similarity=0.418  Sum_probs=257.7

Q ss_pred             CCCCCCCCCCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEE--EE-------E---CCCCC
Q ss_conf             320014567128999998327887399993315542311771155665540600168133--20-------1---03523
Q gi|254780270|r  411 HRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFV--DH-------Y---LEVEY  478 (820)
Q Consensus       411 h~~ty~ga~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~--d~-------y---~~~~~  478 (820)
                      |.|-.-||..          +..-.|.++|||+-+....    ..+||.+|   ||..|.  ++       -   -.+|.
T Consensus       214 h~Rv~aGAiH----------kA~gGvL~IDei~~L~~~~----q~~Ll~al---q~~k~~I~g~~e~SsgA~v~tepvP~  276 (637)
T PRK13765        214 HERVEAGAIH----------KAHKGVLFIDEINTLRLES----QQSLLTAM---QEKKYPITGQSERSSGAMVRTEPVPC  276 (637)
T ss_pred             EEEECCCHHH----------HCCCCEEEEEHHHHCCHHH----HHHHHHHH---HCCCEECCCCCCCCCCCCCCCCCCCE
T ss_conf             1000266121----------1358569984456479889----99999999---65915323688666776257898661


Q ss_pred             CCCCEEEEEECCCC-CCCHHHCCCE----EEEEECCCCHHHHHHHHHHHH--HHHHHHHHCCCCCCCCCCHHHHHHHHHC
Q ss_conf             64427999934865-5441311724----799825878689998999860--8989986257813132289999999731
Q gi|254780270|r  479 DLSDVMFIMTANTL-NIPLPLMDRM----EIIRIAGYTEEEKLQIAKNHL--VKKVLTEHALKQEECCISDGVLLDIIRL  551 (820)
Q Consensus       479 dls~v~fi~tan~~-~i~~~l~drm----e~i~~~~y~~~ek~~i~~~~l--~p~~~~~~~~~~~~~~~~~~~i~~ii~~  551 (820)
                      |+ +++-.|+.+++ ++.++|++|.    .-+.+.... ++--+..++|+  +-+..++.|.-   -.|+.+|+..||++
T Consensus       277 Df-~lV~aGn~d~~~~m~palrsri~g~gyev~~~~~m-~dt~enr~k~arfiaqev~~dg~i---Phfdr~AVaeII~e  351 (637)
T PRK13765        277 DF-IMVAAGNLDAIENMHPALRSRIRGYGYEVYMNDTM-EDTPENRKKLVRFVAQEVKRDGKI---PHFDREAVEEIIRE  351 (637)
T ss_pred             EE-EEEEECCHHHHHHCCHHHHHHHHCCCEEEEECCCC-CCCHHHHHHHHHHHHHHHHHCCCC---CCCCHHHHHHHHHH
T ss_conf             36-99995372766643998886510477499823567-787889999999999999743888---99998999999999


Q ss_pred             CCCCCHHHH---HH-HHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHCCCCCC---------------CCCHHCCCCCC
Q ss_conf             774102347---88-879999898765421178520127967867530520003---------------32000223365
Q gi|254780270|r  552 FTHEAGVRS---FE-RALMKIARKAVTKIVKNSDTTVSINENNLQDYLGVPRYK---------------YGKIEGEDQVG  612 (820)
Q Consensus       552 Yt~EaGvR~---l~-r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~lg~~~~~---------------~~~~~~~~~~G  612 (820)
                      ..|-||-++   |+ |.|+.++|.+.---..+.  .-.|+.+++.+.+...+..               .-.....+++|
T Consensus       352 A~R~AG~k~kLTLrLReL~~LIReAgdiA~~eg--~~~Vta~hV~~A~~~~~~~e~qi~d~~~e~~k~~~l~~~~G~~VG  429 (637)
T PRK13765        352 ARRRAGRKGHLTLKLRDLGGLVRVAGDIARSEG--ADLVTAEHVLEAKKISRSIEQQIADRYIERRKDYELFVTEGSEVG  429 (637)
T ss_pred             HHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCC--CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCEEE
T ss_conf             997405456630528988749999889999759--996649999999998887999999999876536168853886678


Q ss_pred             CCCEEEECC-CCCEEEEEEEEEE----CCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHCCCEEECCCC
Q ss_conf             000000000-1680799999997----48997244325689999999999999999888629985574207814744888
Q gi|254780270|r  613 IVTGLAWTE-VGGEILTVEGVIM----PGKGEITITGNLKEIMKESILAASSYVRSKATTFGIIPSAFNEINIHVHVPEG  687 (820)
Q Consensus       613 ~v~GLa~t~-~GG~~l~IE~~~~----~g~g~l~lTG~lg~vmkES~~~A~s~~k~~~~~~~~~~~~~~~~diHih~p~G  687 (820)
                      .|||||+.. .+|.+++|++..+    .|+|.++.||.+|++-++|+++..+|+|.++.+   +   ..++|+||.|..-
T Consensus       430 qVNGLAV~G~~~G~~~pI~a~vt~~~~~g~g~vi~tg~lg~Ia~~aV~~vsa~lkk~~~~---~---~~~~~~~I~FeQs  503 (637)
T PRK13765        430 RVNGLAVMGGDSGIVLPIMAEVTPAQSKGEGKIIATGKLKEIAKEAVQNVSAIIKKFTGK---D---ISNYDIHIQFVGT  503 (637)
T ss_pred             EEEEEEEECCCCCCEEEEEEEEEECCCCCCCEEEEECCHHHHHHHHHHHHHHHHHHHHCC---C---CCCCCEEEEEEEC
T ss_conf             986689965888860115789986556888608972410677898887899999998557---8---7666179998305


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEEEECCEEEEECCHHHHHHHHHHCCCCEEECCHHHHHHHHHCCHHH
Q ss_conf             84788873068999999999836888756106636850302500065689999999709969980367755077614887
Q gi|254780270|r  688 ATPKDGPSAGIAMATAIVSIMTCIPVYKNVAMTGELTLRGRVLPIGGLKEKLLAALRAGVTKVLIPEENIKDLMDIPENV  767 (820)
Q Consensus       688 a~pKDGPSAGi~i~tal~S~~~~~~v~~~iAmTGEitl~G~VlpiGGi~eK~laA~raGi~~viiP~~N~~d~~~ip~~~  767 (820)
                      .-+-||+||++|++||++|++++.||+|++||||+++++|+|+|||||.|||.||.++|+++||||+.|..|+. |.++.
T Consensus       504 Y~gVeGDSAS~Ae~~AliSAL~~iPi~Q~~AvTGSl~q~G~VqpIGGVneKIEaa~~~G~k~ViIP~sN~~dv~-~~~~~  582 (637)
T PRK13765        504 YEGVEGDSASVSIATAVISALENIPVDQSVAMTGSLSVRGDVLPVGGVTYKIEAAAEAGIKKVIIPKSNEKDVL-IEKEY  582 (637)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCEEECCCHHHHHHHHHHCCCCEEEECCCHHHHHH-HHHHH
T ss_conf             78867860789999999998747984244357764236773454367079999999808866872400034343-20765


Q ss_pred             HCCCEEEECCCHHHHHHHHHCCCCCC
Q ss_conf             70979998193999888760278876
Q gi|254780270|r  768 KNGLEIIPVSFMGEVLKHALLRMPDP  793 (820)
Q Consensus       768 ~~~l~~~~v~~~~evl~~al~~~~~~  793 (820)
                      .+.++|+||+|++|||++||+..+..
T Consensus       583 ~~~i~iipv~~i~evl~~al~~~~~~  608 (637)
T PRK13765        583 EDKIEIIPVSTISEVLEHALVGEPEK  608 (637)
T ss_pred             CCCEEEEECCCHHHHHHHHHCCCCHH
T ss_conf             08469997373999999874488017


No 9  
>COG1067 LonB Predicted ATP-dependent protease [Posttranslational modification, protein turnover, chaperones]
Probab=100.00  E-value=1.5e-38  Score=310.67  Aligned_cols=345  Identities=24%  Similarity=0.324  Sum_probs=255.3

Q ss_pred             CCEEEEEECHHHHHHHCCCCHHHHHHH--HCCCCCCCCEEEEEC---CCCCCCCCEEEEEECCCC-CCCHHHCCCEEE--
Q ss_conf             873999933155423117711556655--406001681332010---352364427999934865-544131172479--
Q gi|254780270|r  433 SNPLLLLDEIDKMGSDLRGDPSAALLE--VLDPAQNSSFVDHYL---EVEYDLSDVMFIMTANTL-NIPLPLMDRMEI--  504 (820)
Q Consensus       433 ~npv~~ldeidk~~~~~~gdp~~alle--vldp~qn~~f~d~y~---~~~~dls~v~fi~tan~~-~i~~~l~drme~--  504 (820)
                      .-.|.++||++-++.-..-.---||++  -.+..||..+.--=+   .+|.|+ ++.-++...++ ++-+|+.||.+-  
T Consensus       225 ngGVLiIdei~lL~~~~~w~~LKa~~~k~~~~~~~~~~s~~~~v~~e~vP~d~-klI~~Gn~~~l~~l~~~~~~r~~g~~  303 (647)
T COG1067         225 NGGVLIIDEIGLLAQPLQWKLLKALLDKEQPIWGSSEPSSGAPVRPESVPLDL-KLILAGNREDLEDLHEPDRSRIEGFG  303 (647)
T ss_pred             CCCEEEEEHHHHHCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCE-EEEEECCHHHHHHHCCCCHHHHHHCC
T ss_conf             58479997566328398999999998244566576740248615788855654-89940889999765534777884055


Q ss_pred             --EEECCCCH-HHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHH---HH-HHHHHHHHHHHHHHH
Q ss_conf             --98258786-899989998608989986257813132289999999731774102347---88-879999898765421
Q gi|254780270|r  505 --IRIAGYTE-EEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRS---FE-RALMKIARKAVTKIV  577 (820)
Q Consensus       505 --i~~~~y~~-~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~---l~-r~i~~i~r~~~~~~~  577 (820)
                        .++..+.. .+.-....=-.+-+.+.+.|   .-..++.+|+..||.+--|.||-|+   |. |.|+.++| .|-.++
T Consensus       304 y~ae~~~~m~~~~~nr~k~~~~~~q~v~~d~---~ip~~~~~Av~~li~~a~R~Ag~~~~Ltl~~rdl~~lv~-~A~~ia  379 (647)
T COG1067         304 YEAEFEDTMPITDANRSKLVQFYVQELARDG---NIPHLDKDAVEELIREAARRAGDQNKLTLRLRDLGNLVR-EAGDIA  379 (647)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHHCC---CCCCCCHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHH-HHHHHH
T ss_conf             6899768889986899999999999998628---999888899999999999861656502148999999999-866888


Q ss_pred             CCCCCEECCCHHHHHHHHCCCCCCC---------CC-------HHCCCCCCCCCEEEECCCCCE-E----EEEEEEEECC
Q ss_conf             1785201279678675305200033---------20-------002233650000000001680-7----9999999748
Q gi|254780270|r  578 KNSDTTVSINENNLQDYLGVPRYKY---------GK-------IEGEDQVGIVTGLAWTEVGGE-I----LTVEGVIMPG  636 (820)
Q Consensus       578 ~~~~~~~~i~~~~l~~~lg~~~~~~---------~~-------~~~~~~~G~v~GLa~t~~GG~-~----l~IE~~~~~g  636 (820)
                      ..+..+ .|+.+++.+.+.......         +.       ....+.+|.||||++...+|. .    --|-++...|
T Consensus       380 ~~~~~~-~I~ae~Ve~a~~~~~~~e~~l~e~~~~~~~~~~~li~t~G~~VG~ingLsV~~~~~~~~~g~p~~is~~~~~g  458 (647)
T COG1067         380 VSEGRK-LITAEDVEEALQKRELREGQLAERYIEDIKGGQILIETEGERVGQINGLSVIEVPGHHAFGEPARISCAVHKG  458 (647)
T ss_pred             HCCCCC-CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCEEEEEEEEEEEECCCCCCCCCCEEEEEEEECC
T ss_conf             537866-4769999999987466789999998998755658986536220046015898517864356203787777517


Q ss_pred             CCCEEECCCHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHCCCEEECCCCCCC------CCCCCHHHHHHHHHHHHHHC
Q ss_conf             997244325689999999999999999888629985574207814744888847------88873068999999999836
Q gi|254780270|r  637 KGEITITGNLKEIMKESILAASSYVRSKATTFGIIPSAFNEINIHVHVPEGATP------KDGPSAGIAMATAIVSIMTC  710 (820)
Q Consensus       637 ~g~l~lTG~lg~vmkES~~~A~s~~k~~~~~~~~~~~~~~~~diHih~p~Ga~p------KDGPSAGi~i~tal~S~~~~  710 (820)
                      +|.+.-++..++.- +|++.+-+.++..   +..+   ..++|+||.|+.+.+=      -|||||++|++|||+||+++
T Consensus       459 ~g~i~d~er~~~la-g~I~~k~~mI~~~---~~~~---~~~~d~~i~fs~s~~~eqsy~~vDGDSAS~A~~~aliSAl~~  531 (647)
T COG1067         459 DGEIVDIERKAELA-GNIHNKGMMIKQA---FLMS---ILNYDIHIPFSASLVFEQSYGEVDGDSASLAEACALISALSK  531 (647)
T ss_pred             CCCEEEHHHHHHHH-HHHHHHHHHHHHH---HCCC---CCCCCEEEEEEEEEEEEEECCCCCCCHHHHHHHHHHHHHHHC
T ss_conf             88513213455555-6677889999998---5577---435855667766898875236666864889999999999854


Q ss_pred             CCCCCCCEEEEEEEECCEEEEECCHHHHHH-------HHHHCCCCEEECCHHHHHHHHHCCHHHH-----CCCEEEECCC
Q ss_conf             888756106636850302500065689999-------9997099699803677550776148877-----0979998193
Q gi|254780270|r  711 IPVYKNVAMTGELTLRGRVLPIGGLKEKLL-------AALRAGVTKVLIPEENIKDLMDIPENVK-----NGLEIIPVSF  778 (820)
Q Consensus       711 ~~v~~~iAmTGEitl~G~VlpiGGi~eK~l-------aA~raGi~~viiP~~N~~d~~~ip~~~~-----~~l~~~~v~~  778 (820)
                      .||+|++||||+|+++|+|+|||||.|||.       ||.++|.+.||||+.|.+|+. +.+++.     ..++|++|+|
T Consensus       532 ~Pv~Q~iAiTGsi~q~G~VqpVGGV~eKIEgf~~~c~~~~~~G~q~ViIP~~N~~~l~-l~~~v~~av~~g~f~I~~V~~  610 (647)
T COG1067         532 IPVDQDIAITGSIDQFGEVQPVGGVNEKIEGFFRVCQAAGLTGEQGVIIPKANVKDLS-LSEDVVKAVKEGKFEIWPVET  610 (647)
T ss_pred             CCCCCCEEEEEEECCCCCEEECCCCCHHHHHHHHHHHHHHHCCCCEEEECCCHHHHHH-CCHHHHHHHHCCCEEEEEECC
T ss_conf             8875634678633367724544773053000488888876158854883313186640-238788775448469999572


Q ss_pred             HHHHHHHHHCCCC
Q ss_conf             9998887602788
Q gi|254780270|r  779 MGEVLKHALLRMP  791 (820)
Q Consensus       779 ~~evl~~al~~~~  791 (820)
                      ++||++++|.+.+
T Consensus       611 i~eal~~~~~~~~  623 (647)
T COG1067         611 IDEALELLLGKGE  623 (647)
T ss_pred             HHHHHHHHHCCCC
T ss_conf             9999999827874


No 10 
>pfam02190 LON ATP-dependent protease La (LON) domain.
Probab=99.98  E-value=6.2e-30  Score=245.49  Aligned_cols=190  Identities=37%  Similarity=0.613  Sum_probs=159.9

Q ss_pred             EEEEEEECCCEECCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHEECCCEEEEEEEEEECCCCEEE
Q ss_conf             67566317825688714306429489999999999729849999736867778886560253148999997998898099
Q gi|254780270|r   27 IYPLLPLRDIVVFPYMIVPLFVGREKSVRALDEAMNSHKKIILVTQMNSNDENPIASSVYRIGTIVDIVQILRLPDGTVK  106 (820)
Q Consensus        27 ~LPIlPLrn~VLFPG~vlPL~V~eprsi~aIe~al~~d~~I~vV~qkD~~~e~p~~edLy~VGTlakI~qi~klpDG~~~  106 (820)
                      .||+|||+++|+|||+++||+||||||++|+++|+++++.++++... +..+++..+++|+|||+|+|.++.++|||+++
T Consensus         1 ~lPl~pl~~~vlfPg~~~pl~i~e~r~~~~i~~~l~~~~~~~~~~~~-~~~~~~~~~~~~~vG~~~~I~~~~~~~dg~~~   79 (193)
T pfam02190         1 ELPLLPLRNVVLFPGMVLPLHVFEPRYIAAIEEALESDRPFFGLVLV-SQKDPPSPDDLYEVGTLARIIQIVKLPDGRLK   79 (193)
T ss_pred             CCCEEECCCCEECCCCCEEEEECCHHHHHHHHHHHHCCCCEEEEEEE-CCCCCCCCCCHHHEEEEEEEEEEEECCCCEEE
T ss_conf             98889748900179966747989789999999998459978999984-67788884334227689999996506997299


Q ss_pred             EEEEEEEEEEEEEEE-ECCCEEEEEEEEECCCCCC--CHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCHHHHH
Q ss_conf             999975479999887-0798199999980488888--4789999999999999999854557778887641268867899
Q gi|254780270|r  107 ILVEGSVRARIVEYI-EREDFLEAITQVLPDPTED--PVELEALSRSVIAEFSNYIKLNKKISPEVIGITSQIEGFSKLA  183 (820)
Q Consensus       107 ILVeGl~RvkI~ei~-~~~pyl~A~Ve~l~d~~~d--~~eleAL~~~L~e~f~eli~l~~~i~~E~~~~l~~iddp~~LA  183 (820)
                      |+++|.+||+|.++. +++||+.|+|++.++...+  ..+..++...+.+.+..+...  ..+.+....+.+.++++.|+
T Consensus        80 v~v~G~~R~kI~~~~~~~~~~~~a~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~l~  157 (193)
T pfam02190        80 ILVEGLERFRILELEEQEEPYLVAEVEDLPEEESEELEEALEALVKELIELLKELLPL--LLPLELLLKIDNIEDPGRLA  157 (193)
T ss_pred             EEEEEEEEEEEEEEECCCCCEEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHCC--CCCHHHHHHHHCCCCHHHHH
T ss_conf             9999899899988750578708999986577787545799999999999999997342--69888998776658999999


Q ss_pred             HHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             998852358989999987432479999999999998
Q gi|254780270|r  184 DVIAANLSIKVAERQKILEAVSVKERLEMLLVFMES  219 (820)
Q Consensus       184 D~IAs~L~l~~eeKQeLLE~~Di~eRLe~Ll~lL~~  219 (820)
                      |++|++++++.++||+|||+.|+.+|+++++++|++
T Consensus       158 ~~~a~~l~~~~~~kq~lLe~~~~~~Rl~~l~~~L~~  193 (193)
T pfam02190       158 DLIASLLPLSPEEKQELLETLDVKERLEKLLELLKR  193 (193)
T ss_pred             HHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHHCC
T ss_conf             999983898999999988479999999999999678


No 11 
>COG2802 Uncharacterized protein, similar to the N-terminal domain of Lon protease [General function prediction only]
Probab=99.95  E-value=1.9e-25  Score=211.44  Aligned_cols=198  Identities=21%  Similarity=0.300  Sum_probs=159.0

Q ss_pred             CCCEEEEEEEECCCEECCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEE-CCCCCCCCCCHHHEECCCEEEEEEEEEECC
Q ss_conf             7763675663178256887143064294899999999997298499997-368677788865602531489999979988
Q gi|254780270|r   23 ADGIIYPLLPLRDIVVFPYMIVPLFVGREKSVRALDEAMNSHKKIILVT-QMNSNDENPIASSVYRIGTIVDIVQILRLP  101 (820)
Q Consensus        23 ~~~~~LPIlPLrn~VLFPG~vlPL~V~eprsi~aIe~al~~d~~I~vV~-qkD~~~e~p~~edLy~VGTlakI~qi~klp  101 (820)
                      ..+..||+|||++.|+|||..+||+|||+||+.|+++|+++++.||++. +++.+...+....+..|||+|+|+++..++
T Consensus         7 ~~p~~LplFPL~~~vLlPg~~LpL~IFEpRY~~Mv~~~~~~~r~fGvv~i~~~~~~~~~~~~~ls~VGcla~I~~~~~~~   86 (221)
T COG2802           7 DLPLELPLFPLPGAVLLPGGLLPLNIFEPRYLAMVRTCLAEGRRFGVVLIDRGREVGGGLPPELSDVGCLARITEFEELG   86 (221)
T ss_pred             CCCCEEECCCCCCCCCCCCCCCCHHHCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCHHHCCCEEEEEEEEEECC
T ss_conf             76523331346661036898772655269999999998734885147874256444678865011045047886735758


Q ss_pred             CCEEEEEEEEEEEEEEEEEEE-CCCEEEEEEEEECCCCCCCHHHHHHHHH----HHHHHHHHHHHCCCCCHHHHHHHHCC
Q ss_conf             980999999754799998870-7981999999804888884789999999----99999999985455777888764126
Q gi|254780270|r  102 DGTVKILVEGSVRARIVEYIE-REDFLEAITQVLPDPTEDPVELEALSRS----VIAEFSNYIKLNKKISPEVIGITSQI  176 (820)
Q Consensus       102 DG~~~ILVeGl~RvkI~ei~~-~~pyl~A~Ve~l~d~~~d~~eleAL~~~----L~e~f~eli~l~~~i~~E~~~~l~~i  176 (820)
                      ||++.|.++|.+||||.++.- .+||.++.+++++|.+.......+.-+.    +...++.|.+.+..   +.......-
T Consensus        87 DGr~~I~~~G~~RFRv~~~~~~~~pyr~~~~~~~~D~~~~~~~a~evdr~~~~~l~~~~r~~~~~~~l---~~d~~~~~~  163 (221)
T COG2802          87 DGRYLILVRGGQRFRVLEELADDDPYRRARVPFWPDLPSDPDGAEEVDRRLDALLMRAARAYLQRLEL---LADWESYER  163 (221)
T ss_pred             CCCEEEEEEEEEEEEEEEEECCCCCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCH---HHHHCCCCC
T ss_conf             98289999757889988776056750440204678876671068999999999999999987652231---333014665


Q ss_pred             CCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             88678999988523589899999874324799999999999986556
Q gi|254780270|r  177 EGFSKLADVIAANLSIKVAERQKILEAVSVKERLEMLLVFMESEISV  223 (820)
Q Consensus       177 ddp~~LAD~IAs~L~l~~eeKQeLLE~~Di~eRLe~Ll~lL~~EiEi  223 (820)
                      .++..+++.++..+|++..+||.+|+..|+..|++.+..+++.-...
T Consensus       164 ~~~~~l~n~L~~llp~~~~~k~~ll~a~d~~~r~~~L~~~~e~l~a~  210 (221)
T COG2802         164 ASNADLANRLYMLLPFDPAEKQALLEAPDLPTRAERLIRLLEQLLAR  210 (221)
T ss_pred             CCHHHHHHHHHHHCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
T ss_conf             36799999999857888467888872665677999999999998887


No 12 
>TIGR00764 lon_rel ATP-dependent protease, putative; InterPro: IPR004663   Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes . They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence . Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases .   Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base . The geometric orientations of the catalytic residues are similar between families, despite different protein folds . The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) , .   Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins.   Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule.    This signature defines the archaeal lon protease homologs, which are ATP-dependent serine peptidases belonging to the MEROPS peptidase family S16 (lon protease family, clan SF). Members of this family from Pyrococcus horikoshii and Pyrococcus abyssi each contain a predicted intein conserved region.; GO: 0004176 ATP-dependent peptidase activity, 0005524 ATP binding, 0030163 protein catabolic process.
Probab=99.93  E-value=1.9e-24  Score=204.03  Aligned_cols=383  Identities=27%  Similarity=0.417  Sum_probs=260.3

Q ss_pred             HHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCC--CC
Q ss_conf             7708824998618888888835632001456712899999832788739999331554231177115566554060--01
Q gi|254780270|r  388 KATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDP--AQ  465 (820)
Q Consensus       388 ~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp--~q  465 (820)
                      ..-.-||.-+.-||+...+    |.|.-.|+..          .....++++|||.-+.-..+-.-..||-+---|  -|
T Consensus       204 d~~h~p~~c~~~~~lg~p~----h~~~~~g~~h----------~~~~g~l~~d~~~~~~~~~~~~~l~~~~~~~~p~~g~  269 (662)
T TIGR00764       204 DVRHDPFGCFGSGGLGTPA----HERVEAGAIH----------RAHKGVLYIDEIGTLPLEVQQYLLTALQDKKFPITGQ  269 (662)
T ss_pred             HHCCCCCCCCCCCCCCCCC----HHHHHHHHHH----------HHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCC
T ss_conf             1002520003788888750----1232322123----------3205505540113221135788887654113543567


Q ss_pred             CCCEEEEEC---CCCCCCCCEEEEEECCC--C-CCCHHHCCCEEEEEECCCCH------HHHHHHHHHHHHHHHHHHHCC
Q ss_conf             681332010---35236442799993486--5-54413117247998258786------899989998608989986257
Q gi|254780270|r  466 NSSFVDHYL---EVEYDLSDVMFIMTANT--L-NIPLPLMDRMEIIRIAGYTE------EEKLQIAKNHLVKKVLTEHAL  533 (820)
Q Consensus       466 n~~f~d~y~---~~~~dls~v~fi~tan~--~-~i~~~l~drme~i~~~~y~~------~ek~~i~~~~l~p~~~~~~~~  533 (820)
                      |..-..-.+   -+|.|   .+.+++.|-  + .+.++|++|++-.-..-|..      -|...-.-+|+..+. ++.| 
T Consensus       270 ~~~~~g~~~~~~p~pcd---f~l~~~g~~~~~~~~~~~l~~~~~g~gy~~~~~~~~~~~~~~~~~l~~f~~~~~-~~~g-  344 (662)
T TIGR00764       270 SENSSGAMVRTEPVPCD---FILVASGNLDDLEGLHPALRSRIRGYGYEVYLKDTMPDTPENRDKLVQFVAQEV-KKDG-  344 (662)
T ss_pred             CCCCCCCEEECCCCCCC---EEEEECCCHHHHHHCCHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHHH-HHCC-
T ss_conf             76555641211566621---445514654565410045665430144168872667775024789999999987-6247-


Q ss_pred             CCCCCCCCHHHHHHHHHCCCCCCHHHH---HH-HHHHHHHHHHHH--------HHHCCC--------------CCEECCC
Q ss_conf             813132289999999731774102347---88-879999898765--------421178--------------5201279
Q gi|254780270|r  534 KQEECCISDGVLLDIIRLFTHEAGVRS---FE-RALMKIARKAVT--------KIVKNS--------------DTTVSIN  587 (820)
Q Consensus       534 ~~~~~~~~~~~i~~ii~~Yt~EaGvR~---l~-r~i~~i~r~~~~--------~~~~~~--------------~~~~~i~  587 (820)
                        .--.|+.+++..+++...+.+|-++   |+ |.++.++|...-        +++.+.              .....++
T Consensus       345 --~~~~~~~~~~~~~~~~~~~~~g~~~~l~l~l~~l~~~~~~~~d~~~g~d~~~~~g~~dd~g~~~p~~~~d~~~~~~~~  422 (662)
T TIGR00764       345 --RLPHFTRDAVEEIVREAQRRAGRKDHLTLRLRELGGLVRAAGDIAKGKDVEELLGNFDDKGEYHPETQKDSSGKEYVT  422 (662)
T ss_pred             --CCCCCCHHHHHHHHHHHHHHCCCCCCCEEHHHHHHHHHHHHCCHHCCCCHHHHHCCCCCCCCCCCCCCCCCCCCHHHH
T ss_conf             --888642678999999988622764420102566633665310011144368873354444444763123334520001


Q ss_pred             HHHH----------------HHHHCC-CCCCCCCHHCCCCCCCCCEEEECC-CCCEEEEEEEEEE----CCCCCEEECCC
Q ss_conf             6786----------------753052-000332000223365000000000-1680799999997----48997244325
Q gi|254780270|r  588 ENNL----------------QDYLGV-PRYKYGKIEGEDQVGIVTGLAWTE-VGGEILTVEGVIM----PGKGEITITGN  645 (820)
Q Consensus       588 ~~~l----------------~~~lg~-~~~~~~~~~~~~~~G~v~GLa~t~-~GG~~l~IE~~~~----~g~g~l~lTG~  645 (820)
                      .+++                ..|+.. .+|..-...+.+.+|.++|||... .+|.++++++...    +..|.+.+||.
T Consensus       423 ~~~~~~~~~~~~~~~~~~~~~~y~~~~~~y~~~~p~~~~~~g~~~gl~~~g~~~g~~~~~~~~~~~~~~~~~g~~~~~g~  502 (662)
T TIGR00764       423 AEHVLKAKKLGKTSLEKQLADNYIERKKRYKVFVPNEGGEVGRVNGLAVLGEAGGIGLPIKAEVAPAESKEEGRILLTGK  502 (662)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEECCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHCCCCCCEEECCC
T ss_conf             56778877642234678888888764210203302677631023101233145552024555543320257772675042


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH--CCCCHH--HHHHCCCEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEE
Q ss_conf             6899999999999999998886--299855--742078147448888478887306899999999983688875610663
Q gi|254780270|r  646 LKEIMKESILAASSYVRSKATT--FGIIPS--AFNEINIHVHVPEGATPKDGPSAGIAMATAIVSIMTCIPVYKNVAMTG  721 (820)
Q Consensus       646 lg~vmkES~~~A~s~~k~~~~~--~~~~~~--~~~~~diHih~p~Ga~pKDGPSAGi~i~tal~S~~~~~~v~~~iAmTG  721 (820)
                      +|++.+|++..+-..++.....  +-+..+  .+.++|+|+.|-..--.-||.||.+++++|++|++.+.|+++++||||
T Consensus       503 ~g~~~~~~~~~~~~~~~~~~~~~~~p~p~~d~d~~~~~~~~~f~~~y~~~~gd~~~~~~~~~~~~~~~~~p~~~~~~~~g  582 (662)
T TIGR00764       503 LGEIAKEAVLNVSALIKKYTGEKKLPLPKKDIDLSNYDIHIQFLQTYEGVEGDSASISVATAVISALEEIPVDQDVALTG  582 (662)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEC
T ss_conf             24567788878888887641111367762224445421566430000234554025788999998875066422101002


Q ss_pred             EEEECCEEEEECCHHHHHHHHHHCCCCEEECCHHHHHHHHHCCHHHHCCCEEEECCCHHHHHHHHHCCCCC
Q ss_conf             68503025000656899999997099699803677550776148877097999819399988876027887
Q gi|254780270|r  722 ELTLRGRVLPIGGLKEKLLAALRAGVTKVLIPEENIKDLMDIPENVKNGLEIIPVSFMGEVLKHALLRMPD  792 (820)
Q Consensus       722 Eitl~G~VlpiGGi~eK~laA~raGi~~viiP~~N~~d~~~ip~~~~~~l~~~~v~~~~evl~~al~~~~~  792 (820)
                      .++++|.|+|+||+.+|+-||.++|++++++|+.|..|+. +..+....++++||++++|+++++|.....
T Consensus       583 ~l~~~g~~l~~gg~~~~~~~~~~~g~~~~~~p~~~~~d~~-~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~  652 (662)
T TIGR00764       583 SLSLRGEVLPVGGVTEKIEAAIEAGLKKVIIPKSNLGDVL-LDPETEGKIEIIPVETLDEVLEHVLDLDKK  652 (662)
T ss_pred             CCCCCCCEEECCCCCHHHHHHHHCCCCEEECCCCCCCCEE-ECCCCCCCEEEECCHHHHHHHHHHHHCCCC
T ss_conf             2112554232176523567887505203430354432002-223234724663001233455544303654


No 13 
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB. Members of this protein family are the bacterial ATP-dependent chaperone ClpB. This protein belongs to the AAA family, ATPases associated with various cellular activities (pfam00004). This molecular chaperone does not act as a protease, but rather serves to disaggregate misfolded and aggregated proteins.
Probab=99.90  E-value=1.5e-19  Score=166.91  Aligned_cols=262  Identities=23%  Similarity=0.370  Sum_probs=201.5

Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCC-HHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHC-CCCCCC--EEEEECCCCCCHHH
Q ss_conf             89999987654041587663221-068899877665201168999999999999842-444673--59986056565027
Q gi|254780270|r  306 SVVRNYLDWLLGVPWDKKSKTKK-NLDFAIRILDQDHFGLEKVKERIIEYLAVQMRV-IKNKGL--ILCFVGPPGVGKTS  381 (820)
Q Consensus       306 ~v~r~Yld~~~~lPW~~~t~~~~-dl~~a~~iLd~~hyGl~~vK~rile~lav~~~~-~~~~g~--il~l~gppgvGKts  381 (820)
                      .-+..-+.-++.+|-++-+++.. -|...++.|.+..+|-+++-+.|.+-+-.-+.. .+.+-|  ...|+||+|||||-
T Consensus       531 ~~ia~vvs~~tgIPv~~~~~~e~~~L~~Le~~L~~rViGQd~AI~~I~~aI~~sraGL~dp~rP~GsFlf~GptGvGKTE  610 (852)
T TIGR03346       531 EEIAEVVSRWTGIPVSKMLEGEREKLLHMEEVLHERVVGQDEAVEAVSDAIRRSRAGLSDPNRPIGSFLFLGPTGVGKTE  610 (852)
T ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHH
T ss_conf             99999999996886676665479999878888998971709999999999999971888899974589986788776899


Q ss_pred             HHHHHHHHH---CCCEEEEECCCCCC---HHHHCCCCCCCCCCCC-HHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHH
Q ss_conf             999999770---88249986188888---8883563200145671-2899999832788739999331554231177115
Q gi|254780270|r  382 LAQSIAKAT---GRQYVRMSLGGVYD---EADIRGHRRTYIGSMP-GRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPS  454 (820)
Q Consensus       382 ~~~sia~al---~r~f~~islgg~~d---~~~i~gh~~ty~ga~p-g~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~  454 (820)
                      +||.+|+.|   ...+.||.|.--.+   .|-+.|--=-|||--. |....++++  ....|+|||||+|-..    |..
T Consensus       611 LAKaLAe~Lfg~~~~LIriDMSEy~E~hsvsrLiGaPPGYVGy~egG~Lte~vr~--~PysVvL~DEIEKAh~----~V~  684 (852)
T TIGR03346       611 LAKALAEFLFDDEDAMVRIDMSEYMEKHSVARLIGAPPGYVGYEEGGQLTEAVRR--KPYSVVLFDEVEKAHP----DVF  684 (852)
T ss_pred             HHHHHHHHHHCCCCCEEEECHHHHCCHHHHHHHCCCCCCCCCCCCCCEECHHHHH--CCCEEEEECCHHHHCH----HHH
T ss_conf             9999999985585206984304430122477855899976776878742398981--9887998530543076----899


Q ss_pred             HHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCC------------------------C-C-CCHHHCCCE-EEEEE
Q ss_conf             5665540600168133201035236442799993486------------------------5-5-441311724-79982
Q gi|254780270|r  455 AALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANT------------------------L-N-IPLPLMDRM-EIIRI  507 (820)
Q Consensus       455 ~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~------------------------~-~-i~~~l~drm-e~i~~  507 (820)
                      +.||.|||   +-..+|.+ +-.+|++++++|+|.|-                        + . -+|.+++|+ ++|-+
T Consensus       685 ~~lLQilD---~G~ltD~~-Gr~vdF~NtiiimTSN~Ga~~i~~~~~~~~~~~~~~~~~~~~~~~F~PEflnRid~ii~F  760 (852)
T TIGR03346       685 NVLLQVLD---DGRLTDGQ-GRTVDFRNTVIIMTSNLGSQFIQELAGGDDYEEMREAVMEVLRAHFRPEFLNRIDEIVVF  760 (852)
T ss_pred             HHHHHHHC---CCEEECCC-CCEEEEEEEEEEEECCCCHHHHHHHCCCCCHHHHHHHHHHHHHHHCCHHHHHHCCEEEEE
T ss_conf             99998823---67430799-988853556898615406599974114555799999999999965899899637868983


Q ss_pred             CCCCHHHHHHHHHHHH--HHHHHHHHCCCCCCCCCCHHHHHHHH-HCCCCCCHHHHHHHHHHHH-HHHHHHHHHCCC
Q ss_conf             5878689998999860--89899862578131322899999997-3177410234788879999-898765421178
Q gi|254780270|r  508 AGYTEEEKLQIAKNHL--VKKVLTEHALKQEECCISDGVLLDII-RLFTHEAGVRSFERALMKI-ARKAVTKIVKNS  580 (820)
Q Consensus       508 ~~y~~~ek~~i~~~~l--~p~~~~~~~~~~~~~~~~~~~i~~ii-~~Yt~EaGvR~l~r~i~~i-~r~~~~~~~~~~  580 (820)
                      .+.+.++-..|+..+|  +-+.+.+.|+   .+.+++++..+|+ ..|..+.|.|.|+|.|..- ....+..++.+.
T Consensus       761 ~~L~~~~l~~I~~~~l~~l~~~l~~~~i---~l~~~~~~~~~l~~~g~~~~~GAR~l~r~i~~~i~~~la~~iL~g~  834 (852)
T TIGR03346       761 HPLGREQIARIVEIQLGRLRKRLAERKI---TLELSDAALDFLAEAGYDPVYGARPLKRAIQREIENPLAKKILAGE  834 (852)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHCCC---EEEECHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             7899999999999999999999997798---4998889999999848897747156999999998899999997488


No 14 
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Members of this protein family are homologs of ClpB, an ATPase associated with chaperone-related functions. These ClpB homologs, designated ClpV1, are a key component of the bacterial pathogenicity-associated type VI secretion system.
Probab=99.88  E-value=7e-19  Score=161.78  Aligned_cols=434  Identities=18%  Similarity=0.257  Sum_probs=253.9

Q ss_pred             EECCCEEEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCC--------CCHHH---HHHHHHHH
Q ss_conf             70798199999980488888478999999999999999985455777888764126--------88678---99998852
Q gi|254780270|r  121 IEREDFLEAITQVLPDPTEDPVELEALSRSVIAEFSNYIKLNKKISPEVIGITSQI--------EGFSK---LADVIAAN  189 (820)
Q Consensus       121 ~~~~pyl~A~Ve~l~d~~~d~~eleAL~~~L~e~f~eli~l~~~i~~E~~~~l~~i--------ddp~~---LAD~IAs~  189 (820)
                      ...++.+.-+.+.+.-..++..+.-...+.++..++.+-.  -.+.++.....-.+        --|.+   |.|-.|+.
T Consensus       332 iEkD~AL~RRFq~V~V~EPs~eeti~IL~glk~~yE~hH~--V~i~d~Ai~aAv~LS~RYI~dR~LPDKAIDLlDeA~A~  409 (852)
T TIGR03345       332 FEKDPALTRRFQVVKVEEPDEETAIRMLRGLAPVLEKHHG--VLILDEAVVAAVELSHRYIPGRQLPDKAVSLLDTACAR  409 (852)
T ss_pred             HHCCHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHCCC--EEEEHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHH
T ss_conf             6426889962475527999879999999987999855479--68708999999999872155455842789999999999


Q ss_pred             CCCCHHHHHHHHHHH-HHHHHHHHHHHHHHHHHH--------HHHHHHHH---HHHHHHHHHHHHHHHHCCCCCCCHHHH
Q ss_conf             358989999987432-479999999999998655--------66677775---433332223321122101111000010
Q gi|254780270|r  190 LSIKVAERQKILEAV-SVKERLEMLLVFMESEIS--------VLQVEKRI---RSRVKRQMEKTQREYYLHEQMKAIQKE  257 (820)
Q Consensus       190 L~l~~eeKQeLLE~~-Di~eRLe~Ll~lL~~EiE--------ilkLq~eI---~~kVk~kidk~QREyyLREQLKaIqkE  257 (820)
                      +.+....+..-|+.. .-...++.-...|.++..        ..++++++   +.+......+-|+|-=+-+++..++.+
T Consensus       410 ~~~~~~~~p~~l~~~~~~~~~~~~e~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~  489 (852)
T TIGR03345       410 VALSQNATPAALEDLRRRIAALELELDALEREAALGADHDERLAELRAELAALEAELAALEARWQQEKELVEAILALRAE  489 (852)
T ss_pred             HHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99860489568999999999999999998744522733299999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCHH---HHHHHHHHHHHHCCCCCCCCCCCC-HHHHH
Q ss_conf             12466550467899985222478857888889999999875311025---789999987654041587663221-06889
Q gi|254780270|r  258 LDNGEEGRDEISDFEARISKIRLSKEAREKALSELQKLRQMNPLSAE---SSVVRNYLDWLLGVPWDKKSKTKK-NLDFA  333 (820)
Q Consensus       258 LGe~ed~~~Ei~el~~Ki~~~~lp~e~~~~~~kEl~rL~~m~~~s~E---~~v~r~Yld~~~~lPW~~~t~~~~-dl~~a  333 (820)
                      +....+...+....         .........+++.+++...+..++   ..-+..-+.-.+.+|-++-+.+.. -+...
T Consensus       490 ~~~~~~~~~~~~~~---------~~~~l~~~~~~l~~~~~~~~~~~~~V~~~~ia~vvs~~tgIPv~~l~~~e~~~l~~l  560 (852)
T TIGR03345       490 LEADADAPADDDAA---------LRAQLAELEAALASAQGEEPLVFPEVDAQAVAEVVADWTGIPVGRMVRDEIEAVLSL  560 (852)
T ss_pred             HHHHHHHHHHHHHH---------HHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHH
T ss_conf             99866514334577---------888999999999974045664435568999999999996898788617888888867


Q ss_pred             HHHHHHHHHCHHHHHHHHHHHHHHHHH-CCCCCCCE--EEEECCCCCCHHHHHHHHHHHH---CCCEEEEECCCCCC---
Q ss_conf             987766520116899999999999984-24446735--9986056565027999999770---88249986188888---
Q gi|254780270|r  334 IRILDQDHFGLEKVKERIIEYLAVQMR-VIKNKGLI--LCFVGPPGVGKTSLAQSIAKAT---GRQYVRMSLGGVYD---  404 (820)
Q Consensus       334 ~~iLd~~hyGl~~vK~rile~lav~~~-~~~~~g~i--l~l~gppgvGKts~~~sia~al---~r~f~~islgg~~d---  404 (820)
                      ++.|.+..+|-+++-+.|.+-+-.... -.+.+.||  .+|.||.|||||-+||.+|+.|   ...++||.+.--.+   
T Consensus       561 e~~L~~~ViGQ~~Av~~v~~ai~~sraGl~d~~rPigsFLFlGPTGVGKTElAK~LA~~LFg~e~~liR~DMSEy~E~hs  640 (852)
T TIGR03345       561 PDRLAERVIGQDHALEAIAERIRTARAGLEDPRKPLGVFLLVGPSGVGKTETALALAELLYGGEQNLITINMSEFQEAHT  640 (852)
T ss_pred             HHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCCEEEECCHHHCCHHH
T ss_conf             99999997284999999999999987179999998568998789987789999999999719861147842243210436


Q ss_pred             HHHHCCCCCCCCCCCCH-HHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCE
Q ss_conf             88835632001456712-89999983278873999933155423117711556655406001681332010352364427
Q gi|254780270|r  405 EADIRGHRRTYIGSMPG-RIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDV  483 (820)
Q Consensus       405 ~~~i~gh~~ty~ga~pg-~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v  483 (820)
                      .|-+.|----|||---| ....++++  ..+.|+|||||+|..    -|..+.||-|||   .-..+|.+ +-.+|++++
T Consensus       641 vsrLiGaPPGYVGy~eGG~LTe~Vrr--~PysVvLfDEIEKAH----pdV~nilLQvlD---~G~LtD~~-Gr~vdF~Nt  710 (852)
T TIGR03345       641 VSRLKGSPPGYVGYGEGGVLTEAVRR--KPYSVVLLDEVEKAH----PDVLELFYQVFD---KGVMEDGE-GREIDFKNT  710 (852)
T ss_pred             HHHHCCCCCCCCCCCCCCHHHHHHHH--CCCEEEEECHHHHCC----HHHHHHHHHHHC---CCEEECCC-CCEEECEEE
T ss_conf             87863899976674877721098880--998688861130028----899999998724---67775799-998845212


Q ss_pred             EEEEECCCC-----------------------------C-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHH--HHHH-H
Q ss_conf             999934865-----------------------------5-44131172479982587868999899986089--8998-6
Q gi|254780270|r  484 MFIMTANTL-----------------------------N-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVK--KVLT-E  530 (820)
Q Consensus       484 ~fi~tan~~-----------------------------~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p--~~~~-~  530 (820)
                      ++|.|.|-=                             . .+|-++.|+++|-+.+.+.++-..|+..+|-.  +.+. +
T Consensus       711 IIImTSN~Gs~~i~~~~~~~~~~~~~~~~~~~v~~~l~~~F~PEFlnRi~ii~F~~L~~~~l~~Iv~~~l~~l~~rL~~~  790 (852)
T TIGR03345       711 VILLTSNAGSDLIMALCADPETAPDPEALLEALRPELLKVFKPAFLGRMTVIPYLPLDDDVLAAIVRLKLDRIARRLKEN  790 (852)
T ss_pred             EEEECCCHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHCCHHHHCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             99975724479998640376555668999999999998347988864566897368999999999999999999999862


Q ss_pred             HCCCCCCCCCCHHHHHHHHH-CCCCCCHHHHHHHHHHHHH-HHHHHHHHC
Q ss_conf             25781313228999999973-1774102347888799998-987654211
Q gi|254780270|r  531 HALKQEECCISDGVLLDIIR-LFTHEAGVRSFERALMKIA-RKAVTKIVK  578 (820)
Q Consensus       531 ~~~~~~~~~~~~~~i~~ii~-~Yt~EaGvR~l~r~i~~i~-r~~~~~~~~  578 (820)
                      +|+   .+.++++++.+|.+ .|..+-|-|.|+|.|..-+ ...+..+++
T Consensus       791 ~~i---~l~~~~~~~~~l~~~g~~~~~GARpl~r~I~~~i~~~la~~iL~  837 (852)
T TIGR03345       791 HGA---ELVYSEALVEHIVARCTEVESGARNIDAILNQTLLPELSRQILE  837 (852)
T ss_pred             CCC---EEEECHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             896---89988999999998289977686438999999988999999999


No 15 
>PRK10865 protein disaggregation chaperone; Provisional
Probab=99.88  E-value=9.9e-19  Score=160.65  Aligned_cols=259  Identities=23%  Similarity=0.348  Sum_probs=201.1

Q ss_pred             HHHHHHHHCCCCCCCCCCCCH-HHHHHHHHHHHHHCHHHHHHHHHHHHHHHHH-CCCCCCC--EEEEECCCCCCHHHHHH
Q ss_conf             999876540415876632210-6889987766520116899999999999984-2444673--59986056565027999
Q gi|254780270|r  309 RNYLDWLLGVPWDKKSKTKKN-LDFAIRILDQDHFGLEKVKERIIEYLAVQMR-VIKNKGL--ILCFVGPPGVGKTSLAQ  384 (820)
Q Consensus       309 r~Yld~~~~lPW~~~t~~~~d-l~~a~~iLd~~hyGl~~vK~rile~lav~~~-~~~~~g~--il~l~gppgvGKts~~~  384 (820)
                      ..-+.-.+.+|-++-+++..+ |...++.|.+..+|-+++-+.|..-+-.-.. -.+.+-|  ..+|+||.|||||-+||
T Consensus       537 a~vvs~~TgIPv~~l~~~e~~~L~~le~~L~~rViGQd~AI~~v~~aI~~sraGL~dp~rPiGsFLFlGPTGVGKTElAK  616 (857)
T PRK10865        537 AEVLARWTGIPVSRMLESEREKLLRMEQELHHRVIGQNEAVEAVSNAIRRSRAGLSDPNRPIGSFLFLGPTGVGKTELCK  616 (857)
T ss_pred             HHHHHHHHCCCCHHCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEECCCCCCHHHHHH
T ss_conf             99999996898302131058999999999987852809999999999999863899999973899986898788899999


Q ss_pred             HHHHHH---CCCEEEEECCCCCC---HHHHCCCCCCCCCCCC-HHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHH
Q ss_conf             999770---88249986188888---8883563200145671-2899999832788739999331554231177115566
Q gi|254780270|r  385 SIAKAT---GRQYVRMSLGGVYD---EADIRGHRRTYIGSMP-GRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAAL  457 (820)
Q Consensus       385 sia~al---~r~f~~islgg~~d---~~~i~gh~~ty~ga~p-g~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~al  457 (820)
                      ++|+.|   ...++||.|.--.+   .|-+.|----|||--- |....++++-  ...|+|||||+|.    +-|..+.|
T Consensus       617 ~LA~~LF~~e~~liriDMSEy~E~hsVSrLiGaPPGYVGy~eGG~LTeaVRr~--PySVvLfDEIEKA----HpdV~nil  690 (857)
T PRK10865        617 ALANFMFDSDDAMVRIDMSEFMEKHSVSRLVGAPPGYVGYEEGGYLTEAVRRR--PYSVILLDEVEKA----HPDVFNIL  690 (857)
T ss_pred             HHHHHHHCCHHHEEEECCHHHCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHC--CCEEEEEHHHHHH----CHHHHHHH
T ss_conf             99999838933425625332113012767558998766757788110999819--8778863257663----85899999


Q ss_pred             HHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCC-------------------------C-CCHHHCCCE-EEEEECCC
Q ss_conf             55406001681332010352364427999934865-------------------------5-441311724-79982587
Q gi|254780270|r  458 LEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTL-------------------------N-IPLPLMDRM-EIIRIAGY  510 (820)
Q Consensus       458 levldp~qn~~f~d~y~~~~~dls~v~fi~tan~~-------------------------~-i~~~l~drm-e~i~~~~y  510 (820)
                      |-|||   +-..+|.. +-.+|+++++.|+|.|-=                         . -+|.++.|+ ++|-+.+.
T Consensus       691 LQvlD---~G~LtD~~-Gr~vdF~NtIIImTSN~Gs~~i~~~~~~~~~~~~~~~~~~~l~~~F~PEFlnRiD~iv~F~pL  766 (857)
T PRK10865        691 LQVLD---DGRLTDGQ-GRTVDFRNTVVIMTSNLGSDLIQERFGELDYAHMKELVLGVVSHNFRPEFINRIDEVVVFHPL  766 (857)
T ss_pred             HHHHC---CCEEECCC-CCEEEEEEEEEEECCCHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCHHHHHCCCEEEEECCC
T ss_conf             98703---68320799-988851334899646233699986506556688999999999864798888237848982789


Q ss_pred             CHHHHHHHHHHHHH--HHHHHHHCCCCCCCCCCHHHHHHHH-HCCCCCCHHHHHHHHHHHH-HHHHHHHHHCCC
Q ss_conf             86899989998608--9899862578131322899999997-3177410234788879999-898765421178
Q gi|254780270|r  511 TEEEKLQIAKNHLV--KKVLTEHALKQEECCISDGVLLDII-RLFTHEAGVRSFERALMKI-ARKAVTKIVKNS  580 (820)
Q Consensus       511 ~~~ek~~i~~~~l~--p~~~~~~~~~~~~~~~~~~~i~~ii-~~Yt~EaGvR~l~r~i~~i-~r~~~~~~~~~~  580 (820)
                      +.++=..|+..+|-  -+.+++.|+   .+.+++++..+|. ..|..+-|-|.|+|.|..- -...+..++.+.
T Consensus       767 ~~~~l~~Iv~~~l~~l~~rL~~~~i---~l~~~~~a~~~l~~~gyd~~~GARpl~r~I~~~i~~~ls~~il~g~  837 (857)
T PRK10865        767 GEQHIASIAQIQLQRLYKRLEERGY---EIHISDEALKLLSENGYDPVYGARPLKRAIQQQIENPLAQQILSGE  837 (857)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHCCC---EEEECHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             9999999999999999999997798---4998889999999848897747137899999998899999997288


No 16 
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional
Probab=99.82  E-value=2.9e-17  Score=149.60  Aligned_cols=301  Identities=20%  Similarity=0.291  Sum_probs=223.9

Q ss_pred             HHHHHHHH-HCCCCCCHHHHHHHHHHHHHHHHHHHC----CHHHHHHHHHHHHHHCCCCCCCCCCCC-HHHHHHHHHHHH
Q ss_conf             67899985-222478857888889999999875311----025789999987654041587663221-068899877665
Q gi|254780270|r  267 EISDFEAR-ISKIRLSKEAREKALSELQKLRQMNPL----SAESSVVRNYLDWLLGVPWDKKSKTKK-NLDFAIRILDQD  340 (820)
Q Consensus       267 Ei~el~~K-i~~~~lp~e~~~~~~kEl~rL~~m~~~----s~E~~v~r~Yld~~~~lPW~~~t~~~~-dl~~a~~iLd~~  340 (820)
                      ..-+|-.| |....+|+.+...+..--.|.+..+..    .-...-+..-+..++.+|-.+-+.+.. -|..-++.|.+.
T Consensus       380 ~av~Ls~rYi~dr~lPDKAIdllDea~a~~~l~~~~~~~~~v~~~di~~vv~~~t~ip~~~~~~~~~~~l~~le~~l~~~  459 (758)
T PRK11034        380 AAVELAVKYINDRHLPDKAIDVIDEAGARARLMPVSKRKKTVNVADIESVVARIARIPEKSVSQSDRDTLKNLGDRLKML  459 (758)
T ss_pred             HHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCHHHHHCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999976502688961999999999888751345663165899999999987503607677677999999899998778


Q ss_pred             HHCHHHHHHHHHHHHHHHH--HC-CCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCC---HHHHCCCCCC
Q ss_conf             2011689999999999998--42-4446735998605656502799999977088249986188888---8883563200
Q gi|254780270|r  341 HFGLEKVKERIIEYLAVQM--RV-IKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYD---EADIRGHRRT  414 (820)
Q Consensus       341 hyGl~~vK~rile~lav~~--~~-~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d---~~~i~gh~~t  414 (820)
                      .+|-+++=+.|.+-+-...  ++ ++..--..+|+||.|||||-+||.+|+.|+..++||.+.--.+   .|-+.|----
T Consensus       460 viGQ~~Ai~~v~~ai~~~raGL~~~~rPigsFlf~GPTGVGKTElak~LA~~L~~~lir~DMSEy~e~hsvsrLiGaPPG  539 (758)
T PRK11034        460 VFGQDKAIEALTEAIKMSRAGLGHEHKPVGSFLFAGPTGVGKTEVTVQLSKALGIELLRFDMSEYMERHTVSRLIGAPPG  539 (758)
T ss_pred             HHCCHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCHHHHCCHHHHHHHCCCCCC
T ss_conf             74549999999999999863888999970589997899877799999999998667721426653120147774489986


Q ss_pred             CCCC-CCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCC-
Q ss_conf             1456-71289999983278873999933155423117711556655406001681332010352364427999934865-
Q gi|254780270|r  415 YIGS-MPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTL-  492 (820)
Q Consensus       415 y~ga-~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~-  492 (820)
                      |||- ..|....++++  ..+.|+|||||+|...    |..+.||.|||   +-..+|.. +-.+|++++++|.|.|-= 
T Consensus       540 YVGy~eGG~Lte~Vr~--~PysVvL~DEIEKAhp----dV~nilLQvlD---~G~LtD~~-Gr~vdF~NtiIImTSN~Ga  609 (758)
T PRK11034        540 YVGFDQGGLLTDAVIK--HPHAVLLLDEIEKAHP----DVFNLLLQVMD---NGTLTDNN-GRKADFRNVVLVMTTNAGV  609 (758)
T ss_pred             CCCCCCCCCCCHHHHH--CCCEEEEEHHHHHHCH----HHHHHHHHHCC---CCCCCCCC-CCEEECEEEEEEEECCCCH
T ss_conf             6676777701287873--9877997336756398----99998873237---78301799-9988440019998256174


Q ss_pred             -CC------------------------CHHHCCCE-EEEEECCCCHHHHHHHHHHHHHH--HHHHHHCCCCCCCCCCHHH
Q ss_conf             -54------------------------41311724-79982587868999899986089--8998625781313228999
Q gi|254780270|r  493 -NI------------------------PLPLMDRM-EIIRIAGYTEEEKLQIAKNHLVK--KVLTEHALKQEECCISDGV  544 (820)
Q Consensus       493 -~i------------------------~~~l~drm-e~i~~~~y~~~ek~~i~~~~l~p--~~~~~~~~~~~~~~~~~~~  544 (820)
                       .+                        +|-+++|+ ++|-..+.+.++=..|+..+|-.  +.+++.++   .+.+++++
T Consensus       610 ~~~~~~~~gf~~~~~~~~~~~~l~~~F~PEFlNRiD~ii~F~~L~~~~l~~Iv~~~l~~l~~rL~~~~i---~l~~~~~a  686 (758)
T PRK11034        610 RETERKSIGLIHQDNSTDAMEEIKKIFTPEFRNRLDNIIWFDHLSTDVIHQVVDKFIVELQAQLDQKGV---SLEVSQEA  686 (758)
T ss_pred             HHHHHHCCCCCCCCCHHHHHHHHHHHCCHHHHHHCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHCCC---EEEECHHH
T ss_conf             878642147554203599999999547986772367478638899999999999999999999997898---59988999


Q ss_pred             HHHHHH-CCCCCCHHHHHHHHHHHHH-HHHHHHHHCCC
Q ss_conf             999973-1774102347888799998-98765421178
Q gi|254780270|r  545 LLDIIR-LFTHEAGVRSFERALMKIA-RKAVTKIVKNS  580 (820)
Q Consensus       545 i~~ii~-~Yt~EaGvR~l~r~i~~i~-r~~~~~~~~~~  580 (820)
                      +.++.+ .|..+-|.|.|+|.|.+-+ ...+..++.++
T Consensus       687 ~~~l~~~gyd~~~GARpl~R~I~~~i~~~La~~il~g~  724 (758)
T PRK11034        687 RDWLAEKGYDRAMGARPMARVIQDNLKKPLANELLFGS  724 (758)
T ss_pred             HHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             99999848894537112889999998899999997298


No 17 
>CHL00095 clpC Clp protease ATP binding subunit
Probab=99.82  E-value=1.5e-16  Score=144.12  Aligned_cols=260  Identities=21%  Similarity=0.347  Sum_probs=200.8

Q ss_pred             HHHHHHHHHCCCCCCCCCCCCH-HHHHHHHHHHHHHCHHHHHHHHHHHHHHHHH-CCCCCCC--EEEEECCCCCCHHHHH
Q ss_conf             9999876540415876632210-6889987766520116899999999999984-2444673--5998605656502799
Q gi|254780270|r  308 VRNYLDWLLGVPWDKKSKTKKN-LDFAIRILDQDHFGLEKVKERIIEYLAVQMR-VIKNKGL--ILCFVGPPGVGKTSLA  383 (820)
Q Consensus       308 ~r~Yld~~~~lPW~~~t~~~~d-l~~a~~iLd~~hyGl~~vK~rile~lav~~~-~~~~~g~--il~l~gppgvGKts~~  383 (820)
                      +..-+.-.+.+|-++-+++..+ |...++.|.+..+|-+++-+.|..-+-.... -.+.+-|  ...|+||.|||||-+|
T Consensus       477 I~~vvs~~tgiPv~~~~~~e~~~l~~le~~L~~~ViGQd~AI~~vs~ai~rsraGl~~~~rPigsFlf~GPTGvGKTElA  556 (823)
T CHL00095        477 IAEIVSAWTGIPVNKLTKSESEKLIHMEETLHKRIIGQDEAVVAVSKAIRRARVGLKNPNRPIASFIFCGPTGVGKTELT  556 (823)
T ss_pred             HHHHHHHHHCCCHHHHCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHHHH
T ss_conf             99999998689847633458899987888787784076999999999999997089989997468998789988779999


Q ss_pred             HHHHHHH---CCCEEEEECCCCCC---HHHHCCCCCCCCCCCC-HHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHH
Q ss_conf             9999770---88249986188888---8883563200145671-289999983278873999933155423117711556
Q gi|254780270|r  384 QSIAKAT---GRQYVRMSLGGVYD---EADIRGHRRTYIGSMP-GRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAA  456 (820)
Q Consensus       384 ~sia~al---~r~f~~islgg~~d---~~~i~gh~~ty~ga~p-g~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~a  456 (820)
                      |.+|+.|   ...++||.+.--.+   .|-+-|----|||--- |....++++-  ...|+|||||.|.    +-|..+.
T Consensus       557 K~LA~~LFg~e~~liR~DMSEy~E~hsvsrLIGaPPGYVGy~eGG~LTeaVrr~--PysVvLfDEIEKA----HpdV~ni  630 (823)
T CHL00095        557 KALASYFFGSEEAMIRLDMSEYMEKHTVSKLIGSPPGYVGYNEGGQLTEAVRKK--PYTVVLFDEIEKA----HPDIFNL  630 (823)
T ss_pred             HHHHHHHCCCCCCEEEECCCCCCCCCCHHHHCCCCCCCCCCCCCCCHHHHHHCC--CCEEEEECHHHHC----CHHHHHH
T ss_conf             999999747820258853510155420767458998766778788201988719--9869986213113----8899998


Q ss_pred             HHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCC-C---------------------------------------CCH
Q ss_conf             655406001681332010352364427999934865-5---------------------------------------441
Q gi|254780270|r  457 LLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTL-N---------------------------------------IPL  496 (820)
Q Consensus       457 llevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~-~---------------------------------------i~~  496 (820)
                      ||-|||   .-..+|.. +-.+|++++++|+|.|-= .                                       -+|
T Consensus       631 lLQvlD---dG~LtD~~-Gr~vdF~NtIIImTSNlGs~~i~~~~~~~gf~~~~~~~~~~~~~~~~~~~~v~~~l~~~F~P  706 (823)
T CHL00095        631 LLQILD---DGRLTDSK-GRTIDFKNTLIIMTSNLGSKVIEKGGGSLGFKLLEDGTKLDEKQYKRLSNLVNEELKQYFRP  706 (823)
T ss_pred             HHHHCC---CCCCCCCC-CCEEECEEEEEEECCCCCHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCH
T ss_conf             876516---88434899-99884310399971650558887413443433344543220235899999999999843798


Q ss_pred             HHCCCE-EEEEECCCCHHHHHHHHHHHHH--HHHHHHHCCCCCCCCCCHHHHHHHHH-CCCCCCHHHHHHHHHHHHH-HH
Q ss_conf             311724-7998258786899989998608--98998625781313228999999973-1774102347888799998-98
Q gi|254780270|r  497 PLMDRM-EIIRIAGYTEEEKLQIAKNHLV--KKVLTEHALKQEECCISDGVLLDIIR-LFTHEAGVRSFERALMKIA-RK  571 (820)
Q Consensus       497 ~l~drm-e~i~~~~y~~~ek~~i~~~~l~--p~~~~~~~~~~~~~~~~~~~i~~ii~-~Yt~EaGvR~l~r~i~~i~-r~  571 (820)
                      -++.|+ ++|-..+.+.++=..|+..+|-  -+.+++.|+   .+.+++++..++.+ .|..+-|.|.|+|.|..-+ ..
T Consensus       707 EFlnRiDeii~F~~L~~~~l~~Iv~~~l~~l~~rl~~~~i---~l~~~~~a~~~l~~~gy~~~~GARpl~R~I~~~i~~~  783 (823)
T CHL00095        707 EFLNRLDEIIVFRPLTKDEVWEIAEIMLKELFKRLNNQGI---QLEVDERFKTLLAKEGYNPLYGARPLRRAIMRLLEDP  783 (823)
T ss_pred             HHHHHCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHCCC---EEEECHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             7873278278618999999999999999999999996898---5998889999999958797768136889999998899


Q ss_pred             HHHHHHCCC
Q ss_conf             765421178
Q gi|254780270|r  572 AVTKIVKNS  580 (820)
Q Consensus       572 ~~~~~~~~~  580 (820)
                      .+..++.+.
T Consensus       784 ls~~il~g~  792 (823)
T CHL00095        784 LAEEVLSFK  792 (823)
T ss_pred             HHHHHHCCC
T ss_conf             999997488


No 18 
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]
Probab=99.78  E-value=1.6e-15  Score=136.28  Aligned_cols=263  Identities=25%  Similarity=0.354  Sum_probs=194.2

Q ss_pred             HHHHHCCCCCCCCC-CCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHC-----CCCCCCEEEEECCCCCCHHHHHHH
Q ss_conf             87654041587663-221068899877665201168999999999999842-----444673599860565650279999
Q gi|254780270|r  312 LDWLLGVPWDKKSK-TKKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRV-----IKNKGLILCFVGPPGVGKTSLAQS  385 (820)
Q Consensus       312 ld~~~~lPW~~~t~-~~~dl~~a~~iLd~~hyGl~~vK~rile~lav~~~~-----~~~~g~il~l~gppgvGKts~~~s  385 (820)
                      +.-.+.+|-++-++ +.-.+...++.|.+..+|-+.+=+.|..-  ++.-.     ++..-....|+||-|||||-+||.
T Consensus       463 v~~~TgIPv~~l~~~e~~kll~le~~L~~rViGQd~AV~~v~~a--IrraRaGL~dp~rPigsFlF~GPTGVGKTELAka  540 (786)
T COG0542         463 VARWTGIPVAKLLEDEKEKLLNLERRLKKRVIGQDEAVEAVSDA--IRRARAGLGDPNRPIGSFLFLGPTGVGKTELAKA  540 (786)
T ss_pred             HHHHHCCCHHHHCHHHHHHHHHHHHHHHCCEECHHHHHHHHHHH--HHHHHCCCCCCCCCCEEEEEECCCCCCHHHHHHH
T ss_conf             99987898364133258899867999736501739999999999--9998569999998735788667886569999999


Q ss_pred             HHHHHC---CCEEEEECCCCCC---HHHHCCCCCCCCCCCCHHH-HHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHH
Q ss_conf             997708---8249986188888---8883563200145671289-99998327887399993315542311771155665
Q gi|254780270|r  386 IAKATG---RQYVRMSLGGVYD---EADIRGHRRTYIGSMPGRI-IQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALL  458 (820)
Q Consensus       386 ia~al~---r~f~~islgg~~d---~~~i~gh~~ty~ga~pg~i-i~~l~~~~~~npv~~ldeidk~~~~~~gdp~~all  458 (820)
                      +|+.|.   ..+.||.+.--.+   .|-+.|----|||---|-. -.+.++-  ...|+|||||+|-    +-|....||
T Consensus       541 LA~~Lfg~e~aliR~DMSEy~EkHsVSrLIGaPPGYVGyeeGG~LTEaVRr~--PySViLlDEIEKA----HpdV~nilL  614 (786)
T COG0542         541 LAEALFGDEQALIRIDMSEYMEKHSVSRLIGAPPGYVGYEEGGQLTEAVRRK--PYSVILLDEIEKA----HPDVFNLLL  614 (786)
T ss_pred             HHHHHCCCCCCCEEECHHHHHHHHHHHHHHCCCCCCCEECCCCCHHHHHHCC--CCEEEEECHHHHC----CHHHHHHHH
T ss_conf             9999659974445545687777877998727999872006554003766069--9868884126440----889999999


Q ss_pred             HHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCC-C-C---------------------------CHHHCCCEE-EEEEC
Q ss_conf             5406001681332010352364427999934865-5-4---------------------------413117247-99825
Q gi|254780270|r  459 EVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTL-N-I---------------------------PLPLMDRME-IIRIA  508 (820)
Q Consensus       459 evldp~qn~~f~d~y~~~~~dls~v~fi~tan~~-~-i---------------------------~~~l~drme-~i~~~  508 (820)
                      .|||   +-.-+|.. +-.+|++++++|+|.|-= + |                           ++.++.|+. ||...
T Consensus       615 QVlD---dGrLTD~~-Gr~VdFrNtiIImTSN~Gs~~i~~~~~~~~~~~~~~~~~~v~~~l~~~F~PEFLNRid~II~F~  690 (786)
T COG0542         615 QVLD---DGRLTDGQ-GRTVDFRNTIIIMTSNAGSEEILRDADGDDFADKEALKEAVMEELKKHFRPEFLNRIDEIIPFN  690 (786)
T ss_pred             HHHC---CCCEECCC-CCEEECCEEEEEEECCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHCCCEEECC
T ss_conf             9846---78055489-9888430028998450265989753134321004678899999998538998985126178506


Q ss_pred             CCCHHHHHHHHHHHHHH--HHHHHHCCCCCCCCCCHHHHHHHHHC-CCCCCHHHHHHHHHHH-HHHHHHHHHHCCCC---
Q ss_conf             87868999899986089--89986257813132289999999731-7741023478887999-98987654211785---
Q gi|254780270|r  509 GYTEEEKLQIAKNHLVK--KVLTEHALKQEECCISDGVLLDIIRL-FTHEAGVRSFERALMK-IARKAVTKIVKNSD---  581 (820)
Q Consensus       509 ~y~~~ek~~i~~~~l~p--~~~~~~~~~~~~~~~~~~~i~~ii~~-Yt~EaGvR~l~r~i~~-i~r~~~~~~~~~~~---  581 (820)
                      +.+.++-.+|+...|-.  +.+.+.++   .+.+++++..++.+. |-.+-|-|.|+|.|.. |-...+..++.+..   
T Consensus       691 ~L~~~~l~~Iv~~~L~~l~~~L~~~~i---~l~~s~~a~~~l~~~gyd~~~GARpL~R~Iq~~i~~~La~~iL~~~~~~~  767 (786)
T COG0542         691 PLSKEVLERIVDLQLNRLAKRLAERGI---TLELSDEAKDFLAEKGYDPEYGARPLRRAIQQEIEDPLADEILFGKIEDG  767 (786)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHCCC---EEEECHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             799899999999999999999986895---59988899999999646877673679999999998999999984665799


Q ss_pred             CEECCCHH
Q ss_conf             20127967
Q gi|254780270|r  582 TTVSINEN  589 (820)
Q Consensus       582 ~~~~i~~~  589 (820)
                      ..+.|+.+
T Consensus       768 ~~v~v~~~  775 (786)
T COG0542         768 GTVKVDVD  775 (786)
T ss_pred             CEEEEEEC
T ss_conf             67999951


No 19 
>PRK11823 DNA repair protein RadA; Provisional
Probab=99.73  E-value=8.1e-17  Score=146.18  Aligned_cols=343  Identities=22%  Similarity=0.294  Sum_probs=194.5

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCC-CCEEEEEE
Q ss_conf             44467359986056565027999999770882499861888888883563200145671289999983278-87399993
Q gi|254780270|r  362 IKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKR-SNPLLLLD  440 (820)
Q Consensus       362 ~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~-~npv~~ld  440 (820)
                      +=..|+.++|-|.||+||.+|.--+|..+....--+-+.|=...+.|+.              +| .+.+. .+.++++.
T Consensus        86 GlV~GS~iLlgGePGIGKSTLlLQ~a~~la~~~~vLYvSGEES~~Qik~--------------RA-~RLg~~~~~l~l~~  150 (454)
T PRK11823         86 GLVPGSVVLIGGDPGIGKSTLLLQVAAALAAGGKVLYVSGEESLQQIKL--------------RA-ERLGLPSDNLYLLA  150 (454)
T ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHH--------------HH-HHHCCCCCCCEEEE
T ss_conf             7206648995079988899999999999855995799815015789999--------------99-97588888737885


Q ss_pred             CHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCCCCHHHCCCEEEEEECCCCHHHHHHHHH
Q ss_conf             31554231177115566554060016813320103523644279999348655441311724799825878689998999
Q gi|254780270|r  441 EIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLNIPLPLMDRMEIIRIAGYTEEEKLQIAK  520 (820)
Q Consensus       441 eidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~i~~~l~drme~i~~~~y~~~ek~~i~~  520 (820)
                      |-|=-       -.-+.++-++|.    |      +=+|==+.+|--..++  .|.              +..--.+.| 
T Consensus       151 et~l~-------~Il~~i~~~~P~----~------lIIDSIQT~~~~~~~s--~pG--------------svsQVre~a-  196 (454)
T PRK11823        151 ETNLE-------DILATIEEEKPD----L------VVIDSIQTMYSPELES--APG--------------SVSQVRECA-  196 (454)
T ss_pred             CCCHH-------HHHHHHHHHCCC----E------EEEECHHEEEECCCCC--CCC--------------CHHHHHHHH-
T ss_conf             36899-------999999860998----8------9994311154156677--899--------------789999999-


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCC---CHHHHHHHHHHHHH-----HHHHHHHHCC---------CCCE
Q ss_conf             86089899862578131322899999997317741---02347888799998-----9876542117---------8520
Q gi|254780270|r  521 NHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHE---AGVRSFERALMKIA-----RKAVTKIVKN---------SDTT  583 (820)
Q Consensus       521 ~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~E---aGvR~l~r~i~~i~-----r~~~~~~~~~---------~~~~  583 (820)
                       +.+-+..|++++.-           .+|-+-|.|   ||-|-||-....++     |.....++..         +-.-
T Consensus       197 -~~L~~~AK~~~i~~-----------~lVGHVTKdG~iAGPkvLEHmVDtVl~fEGd~~~~~RiLR~~KNRFG~t~EiGv  264 (454)
T PRK11823        197 -AELTRLAKQSGIAV-----------FLVGHVTKEGAIAGPRVLEHMVDTVLYFEGDRHSRFRILRAVKNRFGATNEIGV  264 (454)
T ss_pred             -HHHHHHHHHCCCCE-----------EEEEEECCCCCCCCCHHHHHHHCEEEEECCCCCCCCEEEEEECCCCCCCCEEEE
T ss_conf             -99999997449828-----------999977267764661452220104687515766550245631246776660589


Q ss_pred             ECCCHHHHHHHHCCCCC-CCCCHHCCCCCCCCCEEEECCCCCEEEEEE--EEEEC---CCCCEEECCCHHHHHHHHHHHH
Q ss_conf             12796786753052000-332000223365000000000168079999--99974---8997244325689999999999
Q gi|254780270|r  584 VSINENNLQDYLGVPRY-KYGKIEGEDQVGIVTGLAWTEVGGEILTVE--GVIMP---GKGEITITGNLKEIMKESILAA  657 (820)
Q Consensus       584 ~~i~~~~l~~~lg~~~~-~~~~~~~~~~~G~v~GLa~t~~GG~~l~IE--~~~~~---g~g~l~lTG~lg~vmkES~~~A  657 (820)
                      +..+.+-|.+.-.|..+ -.++  ..+.+|.+..-.+  -|-..+.+|  +.+.+   |..+=..+|-      ++-+++
T Consensus       265 FeM~~~GL~~v~nPS~~Fls~~--~~~~~Gs~i~~~~--EGsRpllvEvQALv~~~~~~~PrR~~~G~------d~~Rl~  334 (454)
T PRK11823        265 FEMTEKGLREVSNPSELFLSER--DENVPGSAVTVTM--EGTRPLLVEIQALVSPSSFGNPRRVAVGL------DQNRLA  334 (454)
T ss_pred             EEECCCCCEECCCHHHHHHHCC--CCCCCCEEEEEEE--EECCCHHHHHHHHHCCCCCCCCEEEEECC------CHHHHH
T ss_conf             9861688456688779986268--8787750799888--50642401034461567788871578058------789999


Q ss_pred             HHHHHHHH-HHCCCCHHHHHHCCCEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEEEECCEEEEECCHH
Q ss_conf             99999988-86299855742078147448888478887306899999999983688875610663685030250006568
Q gi|254780270|r  658 SSYVRSKA-TTFGIIPSAFNEINIHVHVPEGATPKDGPSAGIAMATAIVSIMTCIPVYKNVAMTGELTLRGRVLPIGGLK  736 (820)
Q Consensus       658 ~s~~k~~~-~~~~~~~~~~~~~diHih~p~Ga~pKDGPSAGi~i~tal~S~~~~~~v~~~iAmTGEitl~G~VlpiGGi~  736 (820)
                      +-.  +.+ ++.++.   +.++|+++++. |...-+.|+|..|++.||+|++.++|+++++++.|||.|+|+|-||.++.
T Consensus       335 mll--AVlek~~~~~---l~~~DVyvnv~-GG~ki~epa~DLAva~Ai~SS~~~~~i~~~~~~~GEVGL~GEiR~V~~~~  408 (454)
T PRK11823        335 MLL--AVLEKRLGLP---LSDQDVYVNVV-GGLKITEPAADLAVALAIASSLRDRPLPPDTVVFGEVGLSGEIRPVPRGE  408 (454)
T ss_pred             HHH--HHHHHHHCCC---CCCCCEEEECC-CCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCEEEEECCCCCEEECCCCHH
T ss_conf             999--9999984986---22664799914-78415785477999999998704977898828999413670342689889


Q ss_pred             HHHHHHHHCCCCEEECCHHHHHHHHHCCHHHHCCCEEEECCCHHHHHHHHHC
Q ss_conf             9999999709969980367755077614887709799981939998887602
Q gi|254780270|r  737 EKLLAALRAGVTKVLIPEENIKDLMDIPENVKNGLEIIPVSFMGEVLKHALL  788 (820)
Q Consensus       737 eK~laA~raGi~~viiP~~N~~d~~~ip~~~~~~l~~~~v~~~~evl~~al~  788 (820)
                      ..+-.|.|.|.+++|+|+.|.++   .    .+++++++|+++.|+++..+.
T Consensus       409 ~Rl~EA~rlGf~~~ivP~~~~~~---~----~~~i~i~~v~~i~e~i~~l~~  453 (454)
T PRK11823        409 ERLKEAAKLGFKRAIVPKANPKK---A----PEGIEVIGVKTLKEALELLFG  453 (454)
T ss_pred             HHHHHHHHCCCCEEEECCCCCCC---C----CCCCEEEEECCHHHHHHHHHC
T ss_conf             99999998699889957877767---9----999799995979999999758


No 20 
>CHL00195 ycf46 Ycf46; Provisional
Probab=99.72  E-value=1.8e-14  Score=128.34  Aligned_cols=214  Identities=25%  Similarity=0.325  Sum_probs=144.0

Q ss_pred             HHHCHHHHHHHHHHHHHHHHHCCC------CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCC
Q ss_conf             520116899999999999984244------46735998605656502799999977088249986188888888356320
Q gi|254780270|r  340 DHFGLEKVKERIIEYLAVQMRVIK------NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRR  413 (820)
Q Consensus       340 ~hyGl~~vK~rile~lav~~~~~~------~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~  413 (820)
                      |.=||+..|+-+-+.-  ..+...      ....-+.|+||||+|||-+||.||...|.||.+++.|-+.+         
T Consensus       229 ~vGGl~~lK~wl~~r~--~~f~~~a~~~gl~~PkGvLL~GpPG~GKtl~AKAvA~e~~~p~l~l~~~~l~~---------  297 (491)
T CHL00195        229 DIGGLDNLKDWLKKRS--TSFSKQAENYGLPTPRGLLLVGIQGTGKSLTAKAIANEWNLPLLRLDVGKLFG---------  297 (491)
T ss_pred             HCCCHHHHHHHHHHHH--HHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEHHHHHH---------
T ss_conf             1468899999999988--98623366459999987999799998789999999866389469966799756---------


Q ss_pred             CCCCCCCHHHHHHHHHCCCCCE-EEEEECHHHHHHH--CCCC--HH----HHHHHHCCCCCCCCEEEEECCCCCCCCCEE
Q ss_conf             0145671289999983278873-9999331554231--1771--15----566554060016813320103523644279
Q gi|254780270|r  414 TYIGSMPGRIIQSLKRAKRSNP-LLLLDEIDKMGSD--LRGD--PS----AALLEVLDPAQNSSFVDHYLEVEYDLSDVM  484 (820)
Q Consensus       414 ty~ga~pg~ii~~l~~~~~~np-v~~ldeidk~~~~--~~gd--p~----~allevldp~qn~~f~d~y~~~~~dls~v~  484 (820)
                      -|+|.-..++=+++..|..+.| |+++|||||.-+.  ..||  .+    +.||.-++   +            .-|.|+
T Consensus       298 ~~vGesE~~~r~~f~~A~~~aP~ilfiDEidk~~~~~~~~~d~g~s~rv~~~~Lt~m~---e------------~~~~Vf  362 (491)
T CHL00195        298 GIVGESESRMRQMIQLAETISPCILWIDEIDKAFSGLDSKGDSGTSNRVLATFITWLS---E------------KKSPVF  362 (491)
T ss_pred             HHCCHHHHHHHHHHHHHHHHCCEEEEEEHHHHHCCCCCCCCCCCHHHHHHHHHHHHHC---C------------CCCCEE
T ss_conf             0067049999999999986198589974654542588888887232899999999864---6------------899769


Q ss_pred             EEEECCCCC-CCHHHCC--CE-EEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHH
Q ss_conf             999348655-4413117--24-7998258786899989998608989986257813132289999999731774102347
Q gi|254780270|r  485 FIMTANTLN-IPLPLMD--RM-EIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRS  560 (820)
Q Consensus       485 fi~tan~~~-i~~~l~d--rm-e~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~  560 (820)
                      +|+|+|..+ +|+.|+-  |+ +++.++--+.+|..+|.+-||-..  ..+.  .  -.++-+.+-..-+.||   |   
T Consensus       363 ViattN~~~~L~pellR~GRFD~~~~v~lP~~~~R~~I~~ihl~~~--~~~~--~--~~~d~~~la~~t~gfs---G---  430 (491)
T CHL00195        363 VVATANNIDSLPLELLRKGRFDEIFFLDLPNLEERELIFKIHLKRF--RPNS--W--QNYDIEILSQLTNKFS---G---  430 (491)
T ss_pred             EEEECCCCCCCCHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCC--CCCC--C--CCCCHHHHHHHCCCCC---H---
T ss_conf             9995899755898770898777047648959899999999998544--7887--5--5469999997685988---8---


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHC
Q ss_conf             888799998987654211785201279678675305
Q gi|254780270|r  561 FERALMKIARKAVTKIVKNSDTTVSINENNLQDYLG  596 (820)
Q Consensus       561 l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~lg  596 (820)
                        -.|..+|+.++..-....   -.++.++|...+.
T Consensus       431 --AeIe~~v~~A~~~A~~~~---r~~~~~dl~~a~~  461 (491)
T CHL00195        431 --AEIEQSIIEAMHHAFSEK---REFTTEDICLALK  461 (491)
T ss_pred             --HHHHHHHHHHHHHHHHCC---CCCCHHHHHHHHH
T ss_conf             --999999999999998758---8665899999998


No 21 
>PRK03992 proteasome-activating nucleotidase; Provisional
Probab=99.72  E-value=1.3e-15  Score=137.13  Aligned_cols=224  Identities=21%  Similarity=0.345  Sum_probs=151.7

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHHCCC-------CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCC
Q ss_conf             6520116899999999999984244-------467359986056565027999999770882499861888888883563
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQMRVIK-------NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGH  411 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~~~~~~-------~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh  411 (820)
                      +|.=||+++|+.|-|.+-.-..+|+       ....-++|+||||+|||.+||.+|..++-+|.+++.      ++|-. 
T Consensus       132 ~dIGGl~~~k~el~E~velPl~~pe~f~~~Gi~pPkGvLLyGPPGtGKTllAkAvA~e~~~~fi~v~~------s~l~s-  204 (390)
T PRK03992        132 EDIGGLDEQIREVREAVELPLKNPELFEEVGIEPPKGVLLYGPPGTGKTLLAKAVAHETNATFIRVVG------SELVQ-  204 (390)
T ss_pred             HHHCCHHHHHHHHHHHHHHHHHCHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEH------HHHHH-
T ss_conf             66149899999999999998659899997699999727868989997899999999874888799667------99752-


Q ss_pred             CCCCCCCCCHHHHHHHHHCCCCCE-EEEEECHHHHHHHC-----CCCH--HHHHHHHCCCCCCCCEEEEECCCCCCCCCE
Q ss_conf             200145671289999983278873-99993315542311-----7711--556655406001681332010352364427
Q gi|254780270|r  412 RRTYIGSMPGRIIQSLKRAKRSNP-LLLLDEIDKMGSDL-----RGDP--SAALLEVLDPAQNSSFVDHYLEVEYDLSDV  483 (820)
Q Consensus       412 ~~ty~ga~pg~ii~~l~~~~~~np-v~~ldeidk~~~~~-----~gdp--~~allevldp~qn~~f~d~y~~~~~dls~v  483 (820)
                        -|+|.-+-.|=+....|....| |+++||||-++..-     .||-  ...|+++|.  |-..|.        ..++|
T Consensus       205 --k~vGesek~vr~lF~~Ar~~aP~IiFiDEiDai~~~R~~~~~~g~~ev~r~l~qLL~--emDG~~--------~~~~V  272 (390)
T PRK03992        205 --KFIGEGARLVRELFELAREKAPSIIFIDEIDAIAAKRTDSGTSGDREVQRTLMQLLA--EMDGFD--------PRGNV  272 (390)
T ss_pred             --CCCCHHHHHHHHHHHHHHHHCCCEEEHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHH--HCCCCC--------CCCCE
T ss_conf             --454179999999999999709908971432566335677888620889999999999--744877--------77882


Q ss_pred             EEEEECCCCC-CCHHHCC--CE-EEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHH
Q ss_conf             9999348655-4413117--24-799825878689998999860898998625781313228999999973177410234
Q gi|254780270|r  484 MFIMTANTLN-IPLPLMD--RM-EIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVR  559 (820)
Q Consensus       484 ~fi~tan~~~-i~~~l~d--rm-e~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR  559 (820)
                      ++|++.|-.+ ++++|+-  |+ ..|+++--..++..+|.+-|+     +...+. .++.  =+.+-..-+.||   |  
T Consensus       273 ~VIaATNrpd~LDpAllRpGRFDr~I~iplPd~~~R~~Ilki~~-----~~~~l~-~dvd--l~~lA~~T~G~S---G--  339 (390)
T PRK03992        273 KIIAATNRPDILDPALLRPGRFDRIIEVPLPDEEGRLEILKIHT-----RKMNLA-DDVD--LEELAELTEGAS---G--  339 (390)
T ss_pred             EEEEECCCCHHCCHHHHCCCCCCEEEEECCCCHHHHHHHHHHHH-----CCCCCC-CCCC--HHHHHHHCCCCC---H--
T ss_conf             79960698100597775477652388708949999999999984-----799999-8889--999997687998---9--


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHCCCC
Q ss_conf             7888799998987654211785201279678675305200
Q gi|254780270|r  560 SFERALMKIARKAVTKIVKNSDTTVSINENNLQDYLGVPR  599 (820)
Q Consensus       560 ~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~lg~~~  599 (820)
                         ..|..+|+.+++.-+....  ..|+.+++.+.+.+-.
T Consensus       340 ---ADI~~lc~EA~m~Air~~r--~~i~~~Df~~Ai~kv~  374 (390)
T PRK03992        340 ---ADLKAICTEAGMFAIRDDR--TEVTMEDFLKAIEKVM  374 (390)
T ss_pred             ---HHHHHHHHHHHHHHHHCCC--CCCCHHHHHHHHHHHH
T ss_conf             ---9999999999999998589--8608999999999996


No 22 
>COG1750 Archaeal serine proteases [General function prediction only]
Probab=99.68  E-value=5.7e-16  Score=139.75  Aligned_cols=166  Identities=28%  Similarity=0.367  Sum_probs=139.5

Q ss_pred             CCEEEEEEEEEECCCCCEEE-CCCHHHH-HHHHHHHHHHHHHHHHHHCCCCHHHHHHCCCEEECCCCCCCCCCCCHHHHH
Q ss_conf             68079999999748997244-3256899-999999999999998886299855742078147448888478887306899
Q gi|254780270|r  623 GGEILTVEGVIMPGKGEITI-TGNLKEI-MKESILAASSYVRSKATTFGIIPSAFNEINIHVHVPEGATPKDGPSAGIAM  700 (820)
Q Consensus       623 GG~~l~IE~~~~~g~g~l~l-TG~lg~v-mkES~~~A~s~~k~~~~~~~~~~~~~~~~diHih~p~Ga~pKDGPSAGi~i  700 (820)
                      .|....|-+++.||.|.+.+ |+-+-.+ |+-||++|.-..-   .-.|   ..+.++|.-+.+-.++.---|||||-+|
T Consensus        48 ~gv~~~~~vtv~pG~G~v~v~t~P~t~~d~~~SArvAa~~A~---~~~G---vd~ssyd~~i~v~a~~pVVGgPSagg~m  121 (579)
T COG1750          48 VGVPINISVTVTPGDGRVYVATFPYTQIDMQGSARVAAGVAL---RLAG---VDMSSYDVYIAVEADSPVVGGPSAGGYM  121 (579)
T ss_pred             CEEEEEEEEEECCCCCEEEEECCCCCHHCCCHHHHHHHHHHH---HHHC---CCCCCEEEEEEEECCCCEECCCCCCHHH
T ss_conf             302310266652898638863677740022134578888778---8627---8753225899994379743586510075


Q ss_pred             HHHHHHHHHCCCCCCCCEEEEEEEECCEEEEECCHHHHHHHHHHCCCCEEECCHHHHHHHHHCCHHH-HCCCEEEECCCH
Q ss_conf             9999999836888756106636850302500065689999999709969980367755077614887-709799981939
Q gi|254780270|r  701 ATAIVSIMTCIPVYKNVAMTGELTLRGRVLPIGGLKEKLLAALRAGVTKVLIPEENIKDLMDIPENV-KNGLEIIPVSFM  779 (820)
Q Consensus       701 ~tal~S~~~~~~v~~~iAmTGEitl~G~VlpiGGi~eK~laA~raGi~~viiP~~N~~d~~~ip~~~-~~~l~~~~v~~~  779 (820)
                      |.|+++++++--.|.|++|||-|+=-|-+-||||++||+-||+++|+|.++||..++. ..|+-++- +.+++++-|.++
T Consensus       122 tva~~~~~~~~~~~~~v~mTG~I~PDgsigpVGGi~~K~~AA~~~g~kifLIP~Gq~~-~~d~~~Y~k~~gl~vieV~~~  200 (579)
T COG1750         122 TVAIYAALMGWSIRKDVMMTGMINPDGSIGPVGGILEKLEAAAKAGAKIFLIPVGQRI-VVDLVEYGKSLGLKVIEVGTL  200 (579)
T ss_pred             HHHHHHHHHCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCC-CCCHHHHHHHCCEEEEEEECH
T ss_conf             9999999957885467056523558874334544588899998579859996055444-530787776426479997002


Q ss_pred             HHHHHHHHCCCCCCCC
Q ss_conf             9988876027887655
Q gi|254780270|r  780 GEVLKHALLRMPDPLE  795 (820)
Q Consensus       780 ~evl~~al~~~~~~~~  795 (820)
                      .+....--.+++++.+
T Consensus       201 ~~aiyy~tg~~~e~p~  216 (579)
T COG1750         201 EDAAYYLTGPQIEPPE  216 (579)
T ss_pred             HHHHHHHCCCCCCCCC
T ss_conf             2103454166678997


No 23 
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit ClpA; InterPro: IPR013461    Proteins in this entry are related to ClpA () from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins..
Probab=99.68  E-value=6.4e-15  Score=131.81  Aligned_cols=294  Identities=24%  Similarity=0.364  Sum_probs=204.5

Q ss_pred             HHHHH-HCCCCCCHHHHHHHHHHHHHHHHHHHCCHHHHH-------------------HHHHHHHHHCCCCCCCCC-C-C
Q ss_conf             99985-222478857888889999999875311025789-------------------999987654041587663-2-2
Q gi|254780270|r  270 DFEAR-ISKIRLSKEAREKALSELQKLRQMNPLSAESSV-------------------VRNYLDWLLGVPWDKKSK-T-K  327 (820)
Q Consensus       270 el~~K-i~~~~lp~e~~~~~~kEl~rL~~m~~~s~E~~v-------------------~r~Yld~~~~lPW~~~t~-~-~  327 (820)
                      +|-.| |...-||+.|-.++.. .-=.-+|.+.+.+-.+                   +-+=+--|+.+|--..+. | +
T Consensus       407 ~LS~ryI~DRfLPDKAIDviDE-aGA~~~l~~~~~~~~~eadekGleetalPev~~~diE~vvak~a~iP~~~~s~ddD~  485 (774)
T TIGR02639       407 ELSARYINDRFLPDKAIDVIDE-AGAAFRLRAKAKKKANEADEKGLEETALPEVNVKDIEEVVAKMAKIPVKTVSSDDDR  485 (774)
T ss_pred             HHHHHHCCCCCCCCHHHHHHHH-HHHHHHHHHHCCCCCCCHHHCCCCCCCCCCCCHHHHHHHHHHHHCCCCEEECCCHHH
T ss_conf             9988860257898543228899-999999712027764320112530004787854449999988718994154264479


Q ss_pred             CHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCC---CCCCC--EEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             10688998776652011689999999999998424---44673--59986056565027999999770882499861888
Q gi|254780270|r  328 KNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRVI---KNKGL--ILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGV  402 (820)
Q Consensus       328 ~dl~~a~~iLd~~hyGl~~vK~rile~lav~~~~~---~~~g~--il~l~gppgvGKts~~~sia~al~r~f~~islgg~  402 (820)
                      --|+.-++.|-+-.||-+.+=++|.+  ||+..+.   +..-|  -..|+||-|||||-+||..|++||-+|.|+.|.==
T Consensus       486 ~~L~~L~~~L~~kIfGQD~AI~~lv~--aiK~SrAGl~~~nkP~GSFLF~GPTGVGKTElak~LA~~LGv~l~RFDMSEY  563 (774)
T TIGR02639       486 EKLKNLEKELKAKIFGQDEAIEQLVS--AIKRSRAGLGEPNKPVGSFLFVGPTGVGKTELAKQLAEELGVHLLRFDMSEY  563 (774)
T ss_pred             HHHHHHHHHHHCCCCCHHHHHHHHHH--HHHHHHHHCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCHHCCCCCHHH
T ss_conf             88720447630131515899999999--9999874247788816888864798962578899999970820010465044


Q ss_pred             C---CHHHHCCCCCCCCCCCCH-HHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCC
Q ss_conf             8---888835632001456712-899999832788739999331554231177115566554060016813320103523
Q gi|254780270|r  403 Y---DEADIRGHRRTYIGSMPG-RIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEY  478 (820)
Q Consensus       403 ~---d~~~i~gh~~ty~ga~pg-~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~  478 (820)
                      -   -.|=+-|-===|||=--| ..-.|.+  +..|+|.|||||-|-    |-|.++.||-|.|   +.+-|||= +=-.
T Consensus       564 mEKHTVsRLIGsPPGYVGfEqGGLLT~Avr--K~P~cVLLLDEIEKA----HpDI~NILLQVMD---~AtLTDN~-GrKa  633 (774)
T TIGR02639       564 MEKHTVSRLIGSPPGYVGFEQGGLLTDAVR--KHPHCVLLLDEIEKA----HPDIYNILLQVMD---YATLTDNN-GRKA  633 (774)
T ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCHHHHC--CCCCEEEHHHHHHHH----HHHHHHHHHHHHC---CCEEECCC-CCEE
T ss_conf             689999874168888513167772122331--288535423466663----1336667876633---54340588-8576


Q ss_pred             CCCCEEEEEECCC-C-CCCHHH------------------------CCCE-EEEEECCCCHHHHHHHHHHHHHH--HHHH
Q ss_conf             6442799993486-5-544131------------------------1724-79982587868999899986089--8998
Q gi|254780270|r  479 DLSDVMFIMTANT-L-NIPLPL------------------------MDRM-EIIRIAGYTEEEKLQIAKNHLVK--KVLT  529 (820)
Q Consensus       479 dls~v~fi~tan~-~-~i~~~l------------------------~drm-e~i~~~~y~~~ek~~i~~~~l~p--~~~~  529 (820)
                      |+-+|+-|-|.|- . ++..|.                        +.|+ .||...+-+.+==..|+++.|=-  .+|.
T Consensus       634 DFRNVILIMTSNaGa~E~~~~~iGF~~~~~~~~~~~Aikk~F~PEFRNRLDaii~F~~L~~~~~~~i~~K~l~el~~~L~  713 (774)
T TIGR02639       634 DFRNVILIMTSNAGAREMSKNPIGFGGERVEDKSEKAIKKLFSPEFRNRLDAIIAFNDLSEEVAEKIVKKFLDELQKQLN  713 (774)
T ss_pred             EECCEEEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             31136888403700102367764425554123348889731587420133464416998899999999999999997553


Q ss_pred             HHCCCCCCCCCCHHHHHHHHHC-CCCCCHHHHHHHHHHHHH-HHHHHHHHCC
Q ss_conf             6257813132289999999731-774102347888799998-9876542117
Q gi|254780270|r  530 EHALKQEECCISDGVLLDIIRL-FTHEAGVRSFERALMKIA-RKAVTKIVKN  579 (820)
Q Consensus       530 ~~~~~~~~~~~~~~~i~~ii~~-Yt~EaGvR~l~r~i~~i~-r~~~~~~~~~  579 (820)
                      +   +.-.+.++++|+.+|.++ |+.|=|.|.|.|.|..=+ -..+.+++=|
T Consensus       714 e---K~v~l~l~~~a~~~LA~KGY~~efGARpl~R~I~~~i~~~L~dEILFG  762 (774)
T TIGR02639       714 E---KNVELELTDDAIKYLAEKGYDEEFGARPLARVIQEEIKKPLSDEILFG  762 (774)
T ss_pred             H---CCEEEEECHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHCCC
T ss_conf             0---653787647899999863678110554489998874125765442057


No 24 
>pfam00004 AAA ATPase family associated with various cellular activities (AAA). AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes.
Probab=99.67  E-value=2.8e-16  Score=142.05  Aligned_cols=119  Identities=31%  Similarity=0.550  Sum_probs=94.4

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCE-EEEEECHHHHHH
Q ss_conf             9986056565027999999770882499861888888883563200145671289999983278873-999933155423
Q gi|254780270|r  369 LCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNP-LLLLDEIDKMGS  447 (820)
Q Consensus       369 l~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~np-v~~ldeidk~~~  447 (820)
                      ++|+||||+|||++|++||+.++++|++++...+.+         .|+|.++.+|-+.+..++..+| |+++||+|.+..
T Consensus         1 iLl~GppGtGKT~~a~~la~~~~~~~~~v~~~~~~~---------~~~g~~~~~i~~~f~~a~~~~p~Il~iDe~d~l~~   71 (131)
T pfam00004         1 LLLYGPPGTGKTTLAKAVAKELGAPFIEISGSELVS---------KYVGESEKRLRELFEAAKKLAPCVIFIDEIDALAG   71 (131)
T ss_pred             CEEECCCCCCHHHHHHHHHHHHCCCCEECCCCCCCC---------CCCCHHHHHHHHHHHHHHHCCCCEEEECHHHHHHC
T ss_conf             987899999999999999999789853324201222---------33450688899999999974991898311677751


Q ss_pred             HC-CC------CHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHHHC-CCEEE-EEEC
Q ss_conf             11-77------115566554060016813320103523644279999348655-441311-72479-9825
Q gi|254780270|r  448 DL-RG------DPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLPLM-DRMEI-IRIA  508 (820)
Q Consensus       448 ~~-~g------dp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~-drme~-i~~~  508 (820)
                      .- .+      ...++||..+|--++            +-++|+||+|.|+.+ |+++++ .|++. |+++
T Consensus        72 ~~~~~~~~~~~~~~~~ll~~ld~~~~------------~~~~v~~I~tTN~~~~ld~al~r~Rfd~~i~~p  130 (131)
T pfam00004        72 SRGSGGDSESRRVVNQLLTELDGFTS------------SLSKVIVIAATNRPDKLDPALLRGRFDRIIEFP  130 (131)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHCCC------------CCCCEEEEEECCCHHHCCHHHHCCCCEEEEEEC
T ss_conf             67888887513268789999850224------------688769999759904499779628332899806


No 25 
>PRK13342 recombination factor protein RarA; Reviewed
Probab=99.67  E-value=4.7e-15  Score=132.79  Aligned_cols=193  Identities=25%  Similarity=0.324  Sum_probs=132.7

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHH-CCCCCEEEEEEC
Q ss_conf             4467359986056565027999999770882499861888888883563200145671289999983-278873999933
Q gi|254780270|r  363 KNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKR-AKRSNPLLLLDE  441 (820)
Q Consensus       363 ~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~-~~~~npv~~lde  441 (820)
                      +.+-+-+.|.|||||||||+|+.||+.++.+|+.+|-.- .-..+||-            |++.-+. ..-..+|+++||
T Consensus        34 ~~~~~s~Il~GPPG~GKTTlA~iiA~~~~~~f~~lnA~~-~gv~dir~------------ii~~a~~~~~~~~tilfiDE  100 (417)
T PRK13342         34 AGRLSSMILWGPPGTGKTTLARIIAGATDAEFEALSAVT-SGVKDLRE------------VIEEAKQSRLGRRTILFIDE  100 (417)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCC-CCHHHHHH------------HHHHHHHHHCCCCEEEEEEC
T ss_conf             699975998896999899999999998689889961410-38899999------------99998863148965999978


Q ss_pred             HHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEE--ECCCC-CCCHHHCCCEEEEEECCCCHHHHHHH
Q ss_conf             1554231177115566554060016813320103523644279999--34865-54413117247998258786899989
Q gi|254780270|r  442 IDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIM--TANTL-NIPLPLMDRMEIIRIAGYTEEEKLQI  518 (820)
Q Consensus       442 idk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~--tan~~-~i~~~l~drme~i~~~~y~~~ek~~i  518 (820)
                      |+-++.+-+    .+||..+..                 ..+.||+  |-|.. .|.+||+.|+.++++...+.++=..|
T Consensus       101 IHRfnK~QQ----D~LLp~vE~-----------------g~iiLIgATTENP~f~in~aLlSRc~vf~l~~L~~~di~~i  159 (417)
T PRK13342        101 IHRFNKAQQ----DALLPHVED-----------------GTITLIGATTENPSFEVNPALLSRAQVFELKPLSEEDLEQL  159 (417)
T ss_pred             HHHCCHHHH----HHHHHHHHC-----------------CCEEEEEECCCCCHHHCCHHHHHHHHHEECCCCCHHHHHHH
T ss_conf             200588999----999875112-----------------65699974157922534898985657002058999999999


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHCCC
Q ss_conf             99860898998625781313228999999973177410234788879999898765421178520127967867530520
Q gi|254780270|r  519 AKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDTTVSINENNLQDYLGVP  598 (820)
Q Consensus       519 ~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~lg~~  598 (820)
                      .++-+-    .+.|+ ...+.++++++..|++.-.=  -.|.+=-.|+.+        .........||.+.+.+.++..
T Consensus       160 L~ral~----~e~~~-~~~i~i~~~al~~i~~~s~G--DaR~aLN~LE~a--------~~~~~~~~~i~~~~~~~~~~~~  224 (417)
T PRK13342        160 LKRALE----DERGL-GRKLELDDEALDALARLADG--DARRALNLLELA--------AAAAAGGEVITLELLEEALQRR  224 (417)
T ss_pred             HHHHHH----HHHCC-CCCCCCCHHHHHHHHHHCCC--CHHHHHHHHHHH--------HHCCCCCCCCCHHHHHHHHHHC
T ss_conf             999998----77433-78877699999999981498--599999999999--------8525899734899999998441


Q ss_pred             CCCCCC
Q ss_conf             003320
Q gi|254780270|r  599 RYKYGK  604 (820)
Q Consensus       599 ~~~~~~  604 (820)
                      .+.+++
T Consensus       225 ~~~yDk  230 (417)
T PRK13342        225 AARYDK  230 (417)
T ss_pred             CCCCCC
T ss_conf             035777


No 26 
>pfam07724 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.
Probab=99.66  E-value=6.9e-16  Score=139.13  Aligned_cols=115  Identities=29%  Similarity=0.543  Sum_probs=100.6

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCC---CEEEEECCCCCCH---HHHCCCCCCCCCCC-CHHHHHHHHHCCCCCEEEEEE
Q ss_conf             5998605656502799999977088---2499861888888---88356320014567-128999998327887399993
Q gi|254780270|r  368 ILCFVGPPGVGKTSLAQSIAKATGR---QYVRMSLGGVYDE---ADIRGHRRTYIGSM-PGRIIQSLKRAKRSNPLLLLD  440 (820)
Q Consensus       368 il~l~gppgvGKts~~~sia~al~r---~f~~islgg~~d~---~~i~gh~~ty~ga~-pg~ii~~l~~~~~~npv~~ld  440 (820)
                      .+.|+||+|||||.+||.+|+.|+.   +|+++.++-..++   +.+-|+...|+|+- .|.+.+++++  ..+.|+|||
T Consensus         5 ~~l~~GPsGvGKT~lAk~la~~l~~~~~~~i~~dm~e~~~~~~v~~l~g~~~gyvg~~~~G~l~~~v~~--~p~~VillD   82 (168)
T pfam07724         5 SFLFLGPTGVGKTELAKALAELLFGDERALIRIDMSEYMEEHSVSRLIGAPPGYVGYEEGGQLTEAVRR--KPYSIVLID   82 (168)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCCCCEEEECCCCCCCHHHHHHHCCCCCCCCCCCCCCCHHHHHHH--CCCCEEEEH
T ss_conf             999889899899999999999967985344885575654256999870589987262426507899983--898489865


Q ss_pred             CHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCC
Q ss_conf             3155423117711556655406001681332010352364427999934865
Q gi|254780270|r  441 EIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTL  492 (820)
Q Consensus       441 eidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~  492 (820)
                      ||||...    +...+||.+||   +..++|++ +..+|+++++||||.|--
T Consensus        83 EIeKa~~----~V~~~LL~ild---~g~~~d~~-g~~v~~~n~i~i~Tsn~g  126 (168)
T pfam07724        83 EIEKAHP----GVQNDLLQILE---GGTLTDKQ-GRKVDFRNTLFIMTGNFG  126 (168)
T ss_pred             HHHHHCH----HHHHHHHHHCC---CCCEECCC-CCEEECCCEEEEECCCCC
T ss_conf             7766589----99999998705---87063699-967844647999768737


No 27 
>PRK04195 replication factor C large subunit; Provisional
Probab=99.64  E-value=4.1e-14  Score=125.69  Aligned_cols=189  Identities=25%  Similarity=0.382  Sum_probs=129.8

Q ss_pred             CCCC-CCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHC-CCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEE
Q ss_conf             4158-7663221068899877665201168999999999999842-4446735998605656502799999977088249
Q gi|254780270|r  318 VPWD-KKSKTKKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRV-IKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYV  395 (820)
Q Consensus       318 lPW~-~~t~~~~dl~~a~~iLd~~hyGl~~vK~rile~lav~~~~-~~~~g~il~l~gppgvGKts~~~sia~al~r~f~  395 (820)
                      +||- ||.+.++          .|.-|-+++++.+.+++  ..|. +..+.+.+.|+|||||||||+|+.||+.+|-..+
T Consensus         2 ~~WveKYRPk~~----------~divg~~~~v~~l~~Wl--~~w~~g~~~~k~lLL~GPpGvGKTT~a~~lAk~~g~~vi   69 (403)
T PRK04195          2 MPWVEKYRPKSL----------SDVVGNEKAKKQLREWI--ESWLKGKPPKKALLLYGPPGVGKTSLAHALANDYGWEVI   69 (403)
T ss_pred             CCCCCCCCCCCH----------HHHHCCHHHHHHHHHHH--HHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEE
T ss_conf             986402189989----------99858899999999999--998739965746998893998799999999998499859


Q ss_pred             EEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHC----CCCCEEEEEECHHHHHHHCCCCH--HHHHHHHCCCCCCCCE
Q ss_conf             98618888888835632001456712899999832----78873999933155423117711--5566554060016813
Q gi|254780270|r  396 RMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRA----KRSNPLLLLDEIDKMGSDLRGDP--SAALLEVLDPAQNSSF  469 (820)
Q Consensus       396 ~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~----~~~npv~~ldeidk~~~~~~gdp--~~allevldp~qn~~f  469 (820)
                      .+.-...|.-..|+.            ++......    +...-+++|||+|-|+..  +|.  ..||++++..      
T Consensus        70 ElNASD~R~~~~I~~------------~i~~~~~~~sl~~~~~KlIIlDEvD~l~~~--~d~gg~~al~~~ik~------  129 (403)
T PRK04195         70 ELNASDQRTKDVIER------------VAGEASTSGSLFGAKRKLILLDEVDGIHGN--ADRGGVRAILEIIKK------  129 (403)
T ss_pred             EECCCCCCCHHHHHH------------HHHHHHHCCCCCCCCCEEEEEECCCCCCCH--HHHHHHHHHHHHHHC------
T ss_conf             977101147899999------------999876068877887349996343445724--447999999999854------


Q ss_pred             EEEECCCCCCCCCEEEEEECCCC-C-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHH
Q ss_conf             32010352364427999934865-5-441311724799825878689998999860898998625781313228999999
Q gi|254780270|r  470 VDHYLEVEYDLSDVMFIMTANTL-N-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLD  547 (820)
Q Consensus       470 ~d~y~~~~~dls~v~fi~tan~~-~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~  547 (820)
                                 ++.-|||++|+. + ++.+|++|-.+|++...+..+-....     -++++     .+.+.+++++|..
T Consensus       130 -----------s~~PiIli~Nd~~~~~~~~lrs~c~~i~F~~~~~~~I~~~L-----~~I~~-----~Egi~i~~~aL~~  188 (403)
T PRK04195        130 -----------AKNPIILTANDPYDPSLRPLRNACLMIEFKRLSKRSIVPVL-----KRICR-----KEGIECEEEALRE  188 (403)
T ss_pred             -----------CCCEEEEEECCCCCCCHHHHHHHHHHCCCCCCCHHHHHHHH-----HHHHH-----HCCCCCCHHHHHH
T ss_conf             -----------88708998268455671779976612217994999999999-----99999-----7699999999999


Q ss_pred             HHHCCCCCCHHHHH
Q ss_conf             97317741023478
Q gi|254780270|r  548 IIRLFTHEAGVRSF  561 (820)
Q Consensus       548 ii~~Yt~EaGvR~l  561 (820)
                      |++.  -..-+|..
T Consensus       189 Ia~~--s~GDlR~a  200 (403)
T PRK04195        189 IAER--SGGDLRSA  200 (403)
T ss_pred             HHHH--CCCHHHHH
T ss_conf             9998--79739999


No 28 
>TIGR02653 Lon_rel_chp conserved hypothetical protein; InterPro: IPR013473    This entry describes a protein family of unknown function, about 690 residues in length, in which some members show C-terminal sequence similarity to IPR008269 from INTERPRO, which is the Lon protease C-terminal proteolytic domain, from MEROPS family S16. However, the annotated catalytic sites of Escherichia coli Lon protease are not conserved in members of this family. Members have a motif GP[RK][GS]TGKS, similar to the ATP-binding P-loop motif GxxGxGK[ST]..
Probab=99.64  E-value=3.5e-15  Score=133.75  Aligned_cols=180  Identities=24%  Similarity=0.370  Sum_probs=158.6

Q ss_pred             CCCCCCCCCEEEECCCC-CEEEEEEEEEECCCCCEEECC-CHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHCCCEEEC
Q ss_conf             22336500000000016-807999999974899724432-5689999999999999999888629985574207814744
Q gi|254780270|r  607 GEDQVGIVTGLAWTEVG-GEILTVEGVIMPGKGEITITG-NLKEIMKESILAASSYVRSKATTFGIIPSAFNEINIHVHV  684 (820)
Q Consensus       607 ~~~~~G~v~GLa~t~~G-G~~l~IE~~~~~g~g~l~lTG-~lg~vmkES~~~A~s~~k~~~~~~~~~~~~~~~~diHih~  684 (820)
                      .-++||+|.--..|+.| =++--+|+-++.|+|++.+.| =--.-||||+..|..|.|+|........ .|++.|-|+|+
T Consensus       493 g~~~pG~vy~v~~~~~G~~GlYrfEvqv~AG~GK~~~sG~Gs~t~~KEsi~~aF~yfkgn~~~~s~~~-~f~~~dyhlhv  571 (677)
T TIGR02653       493 GLLKPGVVYAVTQNESGKVGLYRFEVQVVAGSGKHKVSGLGSNTTAKESIRVAFDYFKGNLKRISASA-KFSEKDYHLHV  571 (677)
T ss_pred             CCCCCCEEEEEEECCCCCEEEEEEEEEEEECCCCEEEEECCCCCCCHHHHHHHHHHHHCCCCCCCEEE-EEECCCEEEEE
T ss_conf             78888728998655888563689888887347612232125663101678876677531342231467-87064007998


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEEEECCEEEEECCHHHHHHHHHHCCCCEEECCHHHHHHHHHCC
Q ss_conf             88884788873068999999999836888756106636850302500065689999999709969980367755077614
Q gi|254780270|r  685 PEGATPKDGPSAGIAMATAIVSIMTCIPVYKNVAMTGELTLRGRVLPIGGLKEKLLAALRAGVTKVLIPEENIKDLMDIP  764 (820)
Q Consensus       685 p~Ga~pKDGPSAGi~i~tal~S~~~~~~v~~~iAmTGEitl~G~VlpiGGi~eK~laA~raGi~~viiP~~N~~d~~~ip  764 (820)
                      -+=-+--=|-.+|+|...||+|++.+++|-...++=|++||.|.|-||--|-+-+=-|-.+|-|+|+||=+|+.|+.++|
T Consensus       572 ~dL~~~g~s~~~~laa~Ial~S~~~~~~vqeqmviLG~mtigG~i~~v~~La~~LQ~a~d~GAKr~liP~~sa~~i~~Vp  651 (677)
T TIGR02653       572 VDLHNTGVSTEASLAALIALCSALLKRPVQEQMVILGSMTIGGVIKPVQDLAGSLQLAMDSGAKRVLIPLSSARDILTVP  651 (677)
T ss_pred             EEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCEEEEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEECCCCCCCCCCCCC
T ss_conf             71317885556789999999999861688875189863132540043555468899998618754740300244546378


Q ss_pred             HHHHCCCEEEECCCHHHHHHHHH
Q ss_conf             88770979998193999888760
Q gi|254780270|r  765 ENVKNGLEIIPVSFMGEVLKHAL  787 (820)
Q Consensus       765 ~~~~~~l~~~~v~~~~evl~~al  787 (820)
                      .++-.+..+.|=+.=-++.--||
T Consensus       652 ~elf~Kfq~sFy~dP~dAv~Kal  674 (677)
T TIGR02653       652 AELFSKFQISFYSDPVDAVYKAL  674 (677)
T ss_pred             HHHEECCCEEECCCHHHHHHHHH
T ss_conf             52602243034378389999972


No 29 
>PRK05201 hslU ATP-dependent protease ATP-binding subunit; Provisional
Probab=99.63  E-value=1.5e-13  Score=121.36  Aligned_cols=262  Identities=23%  Similarity=0.350  Sum_probs=175.5

Q ss_pred             HHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHC------C----CCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             068899877665201168999999999999842------4----446735998605656502799999977088249986
Q gi|254780270|r  329 NLDFAIRILDQDHFGLEKVKERIIEYLAVQMRV------I----KNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMS  398 (820)
Q Consensus       329 dl~~a~~iLd~~hyGl~~vK~rile~lav~~~~------~----~~~g~il~l~gppgvGKts~~~sia~al~r~f~~is  398 (820)
                      --+...+-||+..-|-+++|.-+-  +|++..-      .    .....=|+++||-|||||-||+-+|+.++-||+.+-
T Consensus         5 tP~eIv~~LD~yIIGQ~~AKkavA--VAlrNr~RR~~l~~~lr~Ei~pkNILmIGPTGvGKTeIARrLAkl~~aPFvkve   82 (442)
T PRK05201          5 TPREIVSELDKYIIGQDDAKRAVA--IALRNRWRRMQLPEELRDEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVE   82 (442)
T ss_pred             CHHHHHHHHCCCCCCCHHHHHHHH--HHHHHHHHHHCCCCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCEEEEE
T ss_conf             989999985360108277667877--788777875316622123346431688788886678999999998489858752


Q ss_pred             ------CCCCCCH--HHHC-------------------------------------------------CCCCC-------
Q ss_conf             ------1888888--8835-------------------------------------------------63200-------
Q gi|254780270|r  399 ------LGGVYDE--ADIR-------------------------------------------------GHRRT-------  414 (820)
Q Consensus       399 ------lgg~~d~--~~i~-------------------------------------------------gh~~t-------  414 (820)
                            .|=|.+.  +-||                                                 +...|       
T Consensus        83 ATk~TEvGYvGrDVEsiIrdLv~~a~~~~k~~~~~~v~~~A~~~a~~ril~~L~~~~~~~~~~~~~~~~~~~tre~~r~~  162 (442)
T PRK05201         83 ATKFTEVGYVGRDVESIIRDLVEIAVKMVREEKREKVREKAEEAAEERILDALLPPAKNNWGEEEEEEESSATRQKFRKK  162 (442)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             13100034356437889999999999999999999999999999999999985586555555545420236789999999


Q ss_pred             ---------------------------------------CCCCCCHH----------------------------HH-HH
Q ss_conf             ---------------------------------------14567128----------------------------99-99
Q gi|254780270|r  415 ---------------------------------------YIGSMPGR----------------------------II-QS  426 (820)
Q Consensus       415 ---------------------------------------y~ga~pg~----------------------------ii-~~  426 (820)
                                                             +-|++|++                            +. .|
T Consensus       163 Lr~G~Ldd~~IeIev~~~~~~~~~~~~g~~~~~~~l~~~~~~~~~~~~kkr~~tVkeA~~iL~~eEa~klid~d~v~~eA  242 (442)
T PRK05201        163 LREGELDDKEIEIEVADAPGVEIMGPPGMEEMGNQLQDMFGNLGPKKKKKRKLKVKEARKLLIEEEAAKLVDQEEIKQEA  242 (442)
T ss_pred             HHCCCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHHHHCCCHHHHHHHH
T ss_conf             86588665557886157777777788751556667998764027888740464699999999999998624889999999


Q ss_pred             HHHCCCCCEEEEEECHHHHHHH---CCCCHHH-----HHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECC--C---CC
Q ss_conf             9832788739999331554231---1771155-----66554060016813320103523644279999348--6---55
Q gi|254780270|r  427 LKRAKRSNPLLLLDEIDKMGSD---LRGDPSA-----ALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTAN--T---LN  493 (820)
Q Consensus       427 l~~~~~~npv~~ldeidk~~~~---~~gdp~~-----allevldp~qn~~f~d~y~~~~~dls~v~fi~tan--~---~~  493 (820)
                      +.+|. .+.++++|||||+.+.   ..+|++.     +||-++.-+.=+   -.|=  ++|-.++||||+--  .   .+
T Consensus       243 i~~aE-q~GIVFIDEIDKIa~~~~~~g~DVS~EGVQrdLLpivEGt~V~---tK~G--~V~TdhILFIasGAFh~sKPSD  316 (442)
T PRK05201        243 IERVE-QNGIVFIDEIDKIAKRGEGSGPDVSREGVQRDLLPLVEGSTVS---TKYG--MVKTDHILFIASGAFHVAKPSD  316 (442)
T ss_pred             HHHHH-HCCCEEECHHHHHHCCCCCCCCCCCCHHHHHHHHHHHCCCCCC---CCCC--CCCCCEEEEECCCCCCCCCCCH
T ss_conf             99887-6170451146565303578898977330788878875388555---6777--6025503455045001478202


Q ss_pred             -CCHHHCCCEEE-EEECCCCHHHHHHHH---HHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCC------CCCCHHHHHH
Q ss_conf             -44131172479-982587868999899---986089899862578131322899999997317------7410234788
Q gi|254780270|r  494 -IPLPLMDRMEI-IRIAGYTEEEKLQIA---KNHLVKKVLTEHALKQEECCISDGVLLDIIRLF------THEAGVRSFE  562 (820)
Q Consensus       494 -i~~~l~drme~-i~~~~y~~~ek~~i~---~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Y------t~EaGvR~l~  562 (820)
                       ||. |.-|+-| .++.+.+.++=+.|-   ++-|+.+..+-.....-++.|+++|++.|.+.-      |.--|-|.|.
T Consensus       317 LIPE-l~GRlPv~v~L~~L~~~dl~~ILtepknsL~kQy~~Lf~~egv~L~Ft~~Al~~IA~~A~~~n~~~~~iGAR~L~  395 (442)
T PRK05201        317 LIPE-LQGRFPIRVELDALTEEDFVRILTEPKASLIKQYQALLATEGVTLEFTDDAIRRIAEIAYQVNEKTENIGARRLH  395 (442)
T ss_pred             HHHH-HCCCCEEEEECCCCCHHHHHHHHCCCCHHHHHHHHHHHHHCCCEEEECHHHHHHHHHHHHHHCCCCCCCCHHHHH
T ss_conf             2498-717550588824499999999967861578999999986249679984799999999999851447667737889


Q ss_pred             HHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHCCCC
Q ss_conf             8799998987654211785201279678675305200
Q gi|254780270|r  563 RALMKIARKAVTKIVKNSDTTVSINENNLQDYLGVPR  599 (820)
Q Consensus       563 r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~lg~~~  599 (820)
                      -.+++++..+..+.-....+.++||.+.+.+-|+.-.
T Consensus       396 tI~E~vl~d~~Fe~p~~~~~~v~I~~~~V~~~l~~i~  432 (442)
T PRK05201        396 TVMEKLLEDISFEAPDRSGEKITIDAAYVDEKLGDLV  432 (442)
T ss_pred             HHHHHHHHHHCCCCCCCCCCEEEECHHHHHHHHHHHH
T ss_conf             9999998986146889999779988999999998876


No 30 
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional
Probab=99.62  E-value=3.7e-13  Score=118.48  Aligned_cols=254  Identities=24%  Similarity=0.325  Sum_probs=180.0

Q ss_pred             HHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHC------C----C---CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEE
Q ss_conf             68899877665201168999999999999842------4----4---467359986056565027999999770882499
Q gi|254780270|r  330 LDFAIRILDQDHFGLEKVKERIIEYLAVQMRV------I----K---NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVR  396 (820)
Q Consensus       330 l~~a~~iLd~~hyGl~~vK~rile~lav~~~~------~----~---~~g~il~l~gppgvGKts~~~sia~al~r~f~~  396 (820)
                      -+....-||+-.-|-+++|.-+-  .||+..-      .    +   .|.. ++|+||-|+|||-||+.+|+.|+-||+.
T Consensus        63 P~eI~~~LD~yVIGQ~~AKk~ls--VAvyNHykRi~~~~~~~~~vei~KsN-ILliGPTG~GKTlla~tLAk~l~vPF~i  139 (411)
T PRK05342         63 PKEIKAHLDQYVIGQERAKKVLS--VAVYNHYKRLRQNGSKSDDVELQKSN-ILLIGPTGSGKTLLAQTLARILNVPFAI  139 (411)
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHH--HHHHHHHHHHHCCCCCCCCCCCCCCC-EEEECCCCCCHHHHHHHHHHHHCCCEEE
T ss_conf             79999986214028488889999--99999999986021335665213453-8998999977889999999986999899


Q ss_pred             EECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCC------CEEEEEECHHHHHHH--C---CCCHH-----HHHHHH
Q ss_conf             8618888888835632001456712899999832788------739999331554231--1---77115-----566554
Q gi|254780270|r  397 MSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRS------NPLLLLDEIDKMGSD--L---RGDPS-----AALLEV  460 (820)
Q Consensus       397 islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~------npv~~ldeidk~~~~--~---~gdp~-----~allev  460 (820)
                      ..---.+. |       -|||.----|+.-|..+--.      ..++++|||||++..  .   .-|.+     .|||-+
T Consensus       140 aDAT~lTE-a-------GYVGeDVE~ii~~Llq~Ad~dve~Ae~GIV~IDEIDKIarks~~~s~trDVSgEGVQqaLLki  211 (411)
T PRK05342        140 ADATTLTE-A-------GYVGEDVENILLKLLQAADYDVEKAQRGIVYIDEIDKIARKSENPSITRDVSGEGVQQALLKI  211 (411)
T ss_pred             EEECEECC-C-------CCCCCCHHHHHHHHHHHCCCCHHHHHCCEEEEEEHHHHHHCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             86120012-6-------745607999999999982888998836828885023454247888887776512489999998


Q ss_pred             CCCCCCC----CEEEEE--CCCCCCCCCEEEEEECCC-----------------------------------------C-
Q ss_conf             0600168----133201--035236442799993486-----------------------------------------5-
Q gi|254780270|r  461 LDPAQNS----SFVDHY--LEVEYDLSDVMFIMTANT-----------------------------------------L-  492 (820)
Q Consensus       461 ldp~qn~----~f~d~y--~~~~~dls~v~fi~tan~-----------------------------------------~-  492 (820)
                      +.-+.-+    .-+-|=  =-+++|-+++||||.---                                         + 
T Consensus       212 iEGt~v~vp~~ggrkhp~~~~~~idT~nILFI~gGAF~GL~~II~~R~~~~~iGF~~~~~~~~~~~~~~~l~~v~p~DLi  291 (411)
T PRK05342        212 LEGTVASVPPQGGRKHPQQEFIQVDTTNILFICGGAFDGLEKIIKQRLGKSGIGFGAEVKSKDEKDLGELLAQVEPEDLV  291 (411)
T ss_pred             HCCCEECCCCCCCCCCCCCCEEEEECCCEEEEECCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHCCHHHHH
T ss_conf             75871411888777787765167614717999115533589999863578876778876641100056787627987888


Q ss_pred             C--CCHHHCCCEEEE-EECCCCHHHHHHHH---HHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHC-CCCCCHHHHHHHHH
Q ss_conf             5--441311724799-82587868999899---98608989986257813132289999999731-77410234788879
Q gi|254780270|r  493 N--IPLPLMDRMEII-RIAGYTEEEKLQIA---KNHLVKKVLTEHALKQEECCISDGVLLDIIRL-FTHEAGVRSFERAL  565 (820)
Q Consensus       493 ~--i~~~l~drme~i-~~~~y~~~ek~~i~---~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~-Yt~EaGvR~l~r~i  565 (820)
                      .  +-|-|.-|+-|| .+...+.++=+.|-   ++-|+.+..+-..+..-++.|+++|++.|.+. ..+..|-|.|.-.+
T Consensus       292 ~fGlIPEfiGRlPViv~L~~L~~~~L~~ILtePkNaLikQY~~LF~~dgV~L~Ft~~AL~~IA~~A~~~~tGARgLRsIl  371 (411)
T PRK05342        292 KFGLIPEFIGRLPVVATLEELDEEALVRILTEPKNALVKQYQKLFEMDGVELEFTDDALEAIAKKAIERKTGARGLRSIL  371 (411)
T ss_pred             HCCCCHHHHCCCCEEEECCCCCHHHHHHHHCCCCCHHHHHHHHHHHHCCCEEEECHHHHHHHHHHHHHHCCCHHHHHHHH
T ss_conf             73883776146640546244799999999658741599999999975496799868999999999998475745779999


Q ss_pred             HHHHHHHHHHHHCCCC-CEECCCHHHHHHH
Q ss_conf             9998987654211785-2012796786753
Q gi|254780270|r  566 MKIARKAVTKIVKNSD-TTVSINENNLQDY  594 (820)
Q Consensus       566 ~~i~r~~~~~~~~~~~-~~~~i~~~~l~~~  594 (820)
                      +.+...+-.++-..+. ..++||.+.+..-
T Consensus       372 E~iLld~MFelPs~~~v~~v~It~~~V~~~  401 (411)
T PRK05342        372 EEVLLDVMFELPSREDVEKVVITEEVVEGK  401 (411)
T ss_pred             HHHHHHHHCCCCCCCCCCEEEECHHHHCCC
T ss_conf             999788754488989970999887997799


No 31 
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed
Probab=99.60  E-value=1.3e-13  Score=121.89  Aligned_cols=190  Identities=24%  Similarity=0.368  Sum_probs=130.4

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHCCCEEEEE--CCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHC---CCCCEEEEEEC
Q ss_conf             35998605656502799999977088249986--18888888835632001456712899999832---78873999933
Q gi|254780270|r  367 LILCFVGPPGVGKTSLAQSIAKATGRQYVRMS--LGGVYDEADIRGHRRTYIGSMPGRIIQSLKRA---KRSNPLLLLDE  441 (820)
Q Consensus       367 ~il~l~gppgvGKts~~~sia~al~r~f~~is--lgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~---~~~npv~~lde  441 (820)
                      +=+-|.|||||||||||+-||+..+.+|+.+|  ..|+.|   ||-            ||...++.   --...|+++||
T Consensus        53 ~S~Il~GPPGtGKTTLA~iIA~~t~~~F~~lsAv~sgvkd---lr~------------ii~~A~~~~~~~g~~tILFIDE  117 (726)
T PRK13341         53 GSLILYGPPGVGKTTLARIIANHTRAHFSSLNAVLAGVKD---LRA------------EVDAAKERLERHGKRTILFIDE  117 (726)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCHHH---HHH------------HHHHHHHHHHHCCCCEEEEEEC
T ss_conf             8278889799999999999988748867998562037799---999------------9999999987459965999862


Q ss_pred             HHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEE--EECCCC-CCCHHHCCCEEEEEECCCCHHHHHHH
Q ss_conf             155423117711556655406001681332010352364427999--934865-54413117247998258786899989
Q gi|254780270|r  442 IDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFI--MTANTL-NIPLPLMDRMEIIRIAGYTEEEKLQI  518 (820)
Q Consensus       442 idk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi--~tan~~-~i~~~l~drme~i~~~~y~~~ek~~i  518 (820)
                      |--.+++-+    .+||..+.-                 ..+.+|  +|-|-. .+.+||+.|+-|+++...+.++-..|
T Consensus       118 IHRfNK~QQ----D~LLp~vE~-----------------G~i~LIGATTENP~F~vn~ALlSR~~vf~L~~L~~~dl~~i  176 (726)
T PRK13341        118 VHRFNKAQQ----DALLPWVEN-----------------GTVTLIGATTENPYFEVNKALVSRSRLFRLKSLEDEDLHQL  176 (726)
T ss_pred             HHHCCHHHH----HHHHHHHCC-----------------CEEEEEEECCCCCCEEECHHHHHHCEEEEECCCCHHHHHHH
T ss_conf             542588789----987888606-----------------83899970478974364298883234667438999999999


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHH-HCCCCCEECCCHHHHHHHHCC
Q ss_conf             9986089899862578131322899999997317741023478887999989876542-117852012796786753052
Q gi|254780270|r  519 AKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKI-VKNSDTTVSINENNLQDYLGV  597 (820)
Q Consensus       519 ~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~-~~~~~~~~~i~~~~l~~~lg~  597 (820)
                      .++-|-   -++.|+....+.++++++.+|++.-.=.  .|.+=-.++     .+... -.+.+..+.|+...+++.++.
T Consensus       177 l~rAl~---d~~~g~~~~~i~i~~~al~~l~~~s~GD--aR~aLN~LE-----lav~~~~~~~~~~~~i~~~~~~~~~~~  246 (726)
T PRK13341        177 LKRALQ---DKERGYGDRNIDLEPEAEKHLVDVANGD--ARSLLNALE-----LAVESTPPDEDGVIHINLAIAEESIQQ  246 (726)
T ss_pred             HHHHHH---HHHCCCCCCCCCCCHHHHHHHHHHCCCC--HHHHHHHHH-----HHHHHCCCCCCCCEEECHHHHHHHHHH
T ss_conf             999987---6743256678775989999999975973--999999999-----999707457688344359999999856


Q ss_pred             CCCCC
Q ss_conf             00033
Q gi|254780270|r  598 PRYKY  602 (820)
Q Consensus       598 ~~~~~  602 (820)
                      ....+
T Consensus       247 ~~~~Y  251 (726)
T PRK13341        247 RAVLY  251 (726)
T ss_pred             HHHCC
T ss_conf             66056


No 32 
>CHL00176 ftsH cell division protein; Validated
Probab=99.59  E-value=4.6e-13  Score=117.72  Aligned_cols=218  Identities=27%  Similarity=0.396  Sum_probs=145.9

Q ss_pred             HHHHHHHHCHHHHHHHHHHHHHHHHHCCC-----C-CCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHH
Q ss_conf             87766520116899999999999984244-----4-67359986056565027999999770882499861888888883
Q gi|254780270|r  335 RILDQDHFGLEKVKERIIEYLAVQMRVIK-----N-KGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADI  408 (820)
Q Consensus       335 ~iLd~~hyGl~~vK~rile~lav~~~~~~-----~-~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i  408 (820)
                      ++-=+|.-|++++|+-+.|.+...+--.+     . -+.-++|+||||||||-|||.+|.--|-||..+|      .|+.
T Consensus       173 ~vtF~DVaG~~eaK~el~EivdfLk~P~k~~~~Gak~PkGvLL~GpPGTGKTlLAkAvAgEa~vpF~~~s------gs~F  246 (631)
T CHL00176        173 GITFNDVAGVEEAKEELEEVVTFLKKPERFTAVGAKIPKGVLLVGPPGTGKTLLAKAIAGEAEVPFFSIS------GSEF  246 (631)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHCCHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHCCCCCCEEEEE------HHHH
T ss_conf             9775322885899999999999835958876449968965898898998788999998565588469988------3785


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHCCCCCE-EEEEECHHHHHHH----CCC--CH----HHHHHHHCCCCCCCCEEEEECCCC
Q ss_conf             563200145671289999983278873-9999331554231----177--11----556655406001681332010352
Q gi|254780270|r  409 RGHRRTYIGSMPGRIIQSLKRAKRSNP-LLLLDEIDKMGSD----LRG--DP----SAALLEVLDPAQNSSFVDHYLEVE  477 (820)
Q Consensus       409 ~gh~~ty~ga~pg~ii~~l~~~~~~np-v~~ldeidk~~~~----~~g--dp----~~allevldp~qn~~f~d~y~~~~  477 (820)
                      .   --|||--..|+=+-..+|+..-| +|++||||-+|..    ..|  |.    -+.||.=+|-     |..      
T Consensus       247 ~---e~~vGvga~rVR~LF~~Ar~~aP~IiFIDEiDaig~~Rg~~~~gg~~e~e~tlnqLL~emDG-----f~~------  312 (631)
T CHL00176        247 V---EMFVGVGAARVRDLFKKAKENSPCIVFIDEIDAVGRQRGAGVGGGNDEREQTLNQLLTEMDG-----FEG------  312 (631)
T ss_pred             H---HHHCCHHHHHHHHHHHHHHHCCCEEEEEEEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHCC-----CCC------
T ss_conf             5---64215558999999999986399699987101201147898889850899999999998428-----887------


Q ss_pred             CCCCCEEEEEECCCCC-CCHHHC-----CCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHC
Q ss_conf             3644279999348655-441311-----7247998258786899989998608989986257813132289999999731
Q gi|254780270|r  478 YDLSDVMFIMTANTLN-IPLPLM-----DRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRL  551 (820)
Q Consensus       478 ~dls~v~fi~tan~~~-i~~~l~-----drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~  551 (820)
                        -+.|+.|+.-|-.+ ++++|+     ||-  |.++--..++..+|.+-|+-.+-     +. .++.     +..|.+.
T Consensus       313 --~~gViViaATNrpd~LDpALlRPGRFDR~--I~V~lPD~~gR~~IL~vh~k~~~-----l~-~dvd-----l~~iA~~  377 (631)
T CHL00176        313 --NKGVIVIAATNRIDILDAALLRPGRFDRQ--VTVSLPDFEGRLDILKVHARNKK-----LA-EDVS-----LELIARR  377 (631)
T ss_pred             --CCCEEEEEECCCCCCCCHHHCCCCCCCEE--EEECCCCHHHHHHHHHHHHHCCC-----CC-CCHH-----HHHHHHH
T ss_conf             --88869998258855456866268877549--98269898999999999970786-----66-5300-----9999862


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHHH
Q ss_conf             7741023478887999989876542117852012796786753
Q gi|254780270|r  552 FTHEAGVRSFERALMKIARKAVTKIVKNSDTTVSINENNLQDY  594 (820)
Q Consensus       552 Yt~EaGvR~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~  594 (820)
                      -.-=+|-     .|+.+|+.+|+.-+.....  .|+.+++.+.
T Consensus       378 T~GfSGA-----dLanlvNEAal~AaR~~~~--~it~~d~~~A  413 (631)
T CHL00176        378 TPGFSGA-----DLANLLNEAAILAARRRKN--QITMSEIDEA  413 (631)
T ss_pred             CCCCCHH-----HHHHHHHHHHHHHHHHCCC--CCCHHHHHHH
T ss_conf             6998678-----8876999999999984777--6478899999


No 33 
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]
Probab=99.59  E-value=1.3e-13  Score=121.90  Aligned_cols=221  Identities=23%  Similarity=0.345  Sum_probs=151.3

Q ss_pred             HHHCHHHHHHHHHHHHHHHHHCCC-------CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCC
Q ss_conf             520116899999999999984244-------4673599860565650279999997708824998618888888835632
Q gi|254780270|r  340 DHFGLEKVKERIIEYLAVQMRVIK-------NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHR  412 (820)
Q Consensus       340 ~hyGl~~vK~rile~lav~~~~~~-------~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~  412 (820)
                      |+-||+.+|+.+.|.+......+.       .....++|+||||+|||.+||.+|.-++.+|..+..+.+-+        
T Consensus       243 diggl~~~k~~l~e~v~~~~~~~e~~~~~~~~~~~giLl~GpPGtGKT~lAkava~~~~~~fi~v~~~~l~s--------  314 (494)
T COG0464         243 DIGGLEEAKEELKEAIETPLKRPELFRKLGLRPPKGVLLYGPPGTGKTLLAKAVALESRSRFISVKGSELLS--------  314 (494)
T ss_pred             EECCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHCCCCEEEECCHHHHH--------
T ss_conf             323637799999999999997088763258988836999889997589999998754498248843355540--------


Q ss_pred             CCCCCCCCHHHHHHHHHCCCCC-EEEEEECHHHHHHHCCCC-------HHHHHHHHCCCCCCCCEEEEECCCCCCCCCEE
Q ss_conf             0014567128999998327887-399993315542311771-------15566554060016813320103523644279
Q gi|254780270|r  413 RTYIGSMPGRIIQSLKRAKRSN-PLLLLDEIDKMGSDLRGD-------PSAALLEVLDPAQNSSFVDHYLEVEYDLSDVM  484 (820)
Q Consensus       413 ~ty~ga~pg~ii~~l~~~~~~n-pv~~ldeidk~~~~~~gd-------p~~allevldp~qn~~f~d~y~~~~~dls~v~  484 (820)
                       .|+|.---.|-+...+|.... +|+++||||++.+....+       ..+-||-.+|--             =+.+.|+
T Consensus       315 -k~vGesek~ir~~F~~A~~~~p~iifiDEiDs~~~~r~~~~~~~~~rv~~~ll~~~d~~-------------e~~~~v~  380 (494)
T COG0464         315 -KWVGESEKNIRELFEKARKLAPSIIFIDEIDSLASGRGPSEDGSGRRVVGQLLTELDGI-------------EKAEGVL  380 (494)
T ss_pred             -HHHHHHHHHHHHHHHHHHHCCCCEEEHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHCC-------------CCCCCEE
T ss_conf             -77659999999999999966998897488666741289987637999999999997475-------------4437648


Q ss_pred             EEEECCCCC-CCHHHCC--CE-EEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHH
Q ss_conf             999348655-4413117--24-7998258786899989998608989986257813132289999999731774102347
Q gi|254780270|r  485 FIMTANTLN-IPLPLMD--RM-EIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRS  560 (820)
Q Consensus       485 fi~tan~~~-i~~~l~d--rm-e~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~  560 (820)
                      -|++.|..+ ++++++-  |+ .+|.++.++.++...|.+.|+--+...   +   .-.+.-..+..+-+.|+   |   
T Consensus       381 vi~aTN~p~~ld~a~lR~gRfd~~i~v~~pd~~~r~~i~~~~~~~~~~~---~---~~~~~~~~l~~~t~~~s---g---  448 (494)
T COG0464         381 VIAATNRPDDLDPALLRPGRFDRLIYVPLPDLEERLEIFKIHLRDKKPP---L---AEDVDLEELAEITEGYS---G---  448 (494)
T ss_pred             EEECCCCCCCCCHHHHCCCCCEEEEEECCCCHHHHHHHHHHHHCCCCCC---H---HHHHHHHHHHHHHCCCC---H---
T ss_conf             9964798332687562436630378717989899999999985415651---1---55641999998752778---9---


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHCC
Q ss_conf             8887999989876542117852012796786753052
Q gi|254780270|r  561 FERALMKIARKAVTKIVKNSDTTVSINENNLQDYLGV  597 (820)
Q Consensus       561 l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~lg~  597 (820)
                        ..|..+||.++........ ...++.+++.+.+..
T Consensus       449 --adi~~i~~ea~~~~~~~~~-~~~~~~~~~~~a~~~  482 (494)
T COG0464         449 --ADIAALVREAALEALREAR-RREVTLDDFLDALKK  482 (494)
T ss_pred             --HHHHHHHHHHHHHHHHHCC-CCCCCHHHHHHHHHH
T ss_conf             --9999999999998998545-776349999999862


No 34 
>pfam05496 RuvB_N Holliday junction DNA helicase ruvB N-terminus. The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair. Branch migration is catalysed by the RuvB protein that is targeted to the Holliday junction by the structure specific RuvA protein. This family contains the N-terminal region of the protein.
Probab=99.58  E-value=4.4e-13  Score=117.90  Aligned_cols=198  Identities=25%  Similarity=0.319  Sum_probs=116.1

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCC
Q ss_conf             65201168999999999999842444673599860565650279999997708824998618888888835632001456
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGS  418 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga  418 (820)
                      +|..|-+.++...--++--.+.....-+ -+.|.|||||||||+|+-||++++.+|...|-..+.               
T Consensus        24 ~e~vGQehl~~~l~~~i~a~~~~~~~l~-h~lf~GPPG~GKTTlAriiAk~~~~~~~~~s~~~i~---------------   87 (234)
T pfam05496        24 DEYIGQEKVKENLKIFIEAAKKRGEALD-HVLLYGPPGLGKTTLANIIANEMGVNIRITSGPALE---------------   87 (234)
T ss_pred             HHCCCHHHHHHHHHHHHHHHHHCCCCCC-EEEEECCCCCCHHHHHHHHHHHHCCCEEEECCHHHH---------------
T ss_conf             6606949999999999998874277766-278878999988899999998408753761426664---------------


Q ss_pred             CCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECC-------CCCCCCCEEEE-EECC
Q ss_conf             712899999832788739999331554231177115566554060016813320103-------52364427999-9348
Q gi|254780270|r  419 MPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLE-------VEYDLSDVMFI-MTAN  490 (820)
Q Consensus       419 ~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~-------~~~dls~v~fi-~tan  490 (820)
                      .++-+...+...+ .+.|+++|||.-++...+    .+||-.    .-....|--++       ..+++-...|| ||--
T Consensus        88 ~~~di~~~l~~~~-~~~ILFIDEIHr~nK~qq----d~Llp~----vE~g~i~i~ig~~~~A~~~~~e~P~FtLIgATTe  158 (234)
T pfam05496        88 KPGDLAAILTNLE-PGDVLFIDEIHRLNRAVE----EILYPA----MEDFRLDIVIGKGPSARSIRLDLPPFTLVGATTR  158 (234)
T ss_pred             HHHHHHHHHHHCC-CCCEEEEECHHHCCHHHH----HHCCCC----CCCCEEEEEECCCCCCEEEECCCCCEEEEEECCC
T ss_conf             3899999998458-998899966543587688----744553----3461699996367663246526897599852156


Q ss_pred             CCCCCHHHCCCEEE-EEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHH
Q ss_conf             65544131172479-98258786899989998608989986257813132289999999731774102347888799998
Q gi|254780270|r  491 TLNIPLPLMDRMEI-IRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIA  569 (820)
Q Consensus       491 ~~~i~~~l~drme~-i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~  569 (820)
                      .-.+|.||++|+-+ .++..|+.+|=..|.++     .++.     .++.+++++++.|.+.-  ....|..-+.|..++
T Consensus       159 ~~~l~~pl~sR~~i~~~l~~l~~edl~~il~r-----~~~~-----l~i~i~~eal~~IA~~s--~Gd~R~ALnlLe~v~  226 (234)
T pfam05496       159 AGLLTSPLRDRFGIVLRLEFYSVEELEEIVKR-----SARI-----LGVEIDEEGAAEIARRS--RGTPRIANRLLRRVR  226 (234)
T ss_pred             CCCCCHHHHHHHHHEEECCCCCHHHHHHHHHH-----HHHH-----CCCCCCHHHHHHHHHHC--CCCHHHHHHHHHHHH
T ss_conf             66477779976211244246899999999999-----9998-----39995999999999977--998999989999999


Q ss_pred             HHHH
Q ss_conf             9876
Q gi|254780270|r  570 RKAV  573 (820)
Q Consensus       570 r~~~  573 (820)
                      ..+.
T Consensus       227 d~a~  230 (234)
T pfam05496       227 DFAQ  230 (234)
T ss_pred             HHHH
T ss_conf             9998


No 35 
>COG0714 MoxR-like ATPases [General function prediction only]
Probab=99.57  E-value=8e-14  Score=123.49  Aligned_cols=173  Identities=29%  Similarity=0.364  Sum_probs=116.7

Q ss_pred             HHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHH
Q ss_conf             06889987766520116899999999999984244467359986056565027999999770882499861888888883
Q gi|254780270|r  329 NLDFAIRILDQDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADI  408 (820)
Q Consensus       329 dl~~a~~iLd~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i  408 (820)
                      .+...+..+...-+|-+.+..+++--+        ..|-.+.|.||||||||.+++++|++++++|+||.+----+.+++
T Consensus        14 ~~~~~~~~~~~~~~g~~~~~~~~l~a~--------~~~~~vll~G~PG~gKT~la~~lA~~l~~~~~~i~~t~~l~p~d~   85 (329)
T COG0714          14 ILGKIRSELEKVVVGDEEVIELALLAL--------LAGGHVLLEGPPGVGKTLLARALARALGLPFVRIQCTPDLLPSDL   85 (329)
T ss_pred             HHHHHHHHCCCCCCCCHHHHHHHHHHH--------HCCCCEEEECCCCCCHHHHHHHHHHHHCCCCEEEECCCCCCHHHH
T ss_conf             666666522565526699999999999--------859977877989877799999999983898189956899888882


Q ss_pred             CCC-----C---CCCCCCCCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCC
Q ss_conf             563-----2---00145671289999983278873999933155423117711556655406001681332010352364
Q gi|254780270|r  409 RGH-----R---RTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDL  480 (820)
Q Consensus       409 ~gh-----~---~ty~ga~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dl  480 (820)
                      .|-     .   ..+.--++|-+..+..      ++.|+|||++....+    .+|||++++=.   .++..... ++++
T Consensus        86 ~G~~~~~~~~~~~~~~~~~~gpl~~~~~------~ill~DEInra~p~~----q~aLl~~l~e~---~vt~~~~~-~~~~  151 (329)
T COG0714          86 LGTYAYAALLLEPGEFRFVPGPLFAAVR------VILLLDEINRAPPEV----QNALLEALEER---QVTVPGLT-TIRL  151 (329)
T ss_pred             CCHHHHHHHHCCCCEEEEECCCCCCCCC------EEEEEECCCCCCHHH----HHHHHHHHHHC---EEEECCCC-CCCC
T ss_conf             0568887664257718984687334513------389987034589889----99999999726---89707966-5337


Q ss_pred             CC-EEEEEECC-----CC-CCCHHHCCCEEEEEECCCC-H-HHHHHHHHHHH
Q ss_conf             42-79999348-----65-5441311724799825878-6-89998999860
Q gi|254780270|r  481 SD-VMFIMTAN-----TL-NIPLPLMDRMEIIRIAGYT-E-EEKLQIAKNHL  523 (820)
Q Consensus       481 s~-v~fi~tan-----~~-~i~~~l~drme~i~~~~y~-~-~ek~~i~~~~l  523 (820)
                      .. .++|+|.|     .. .+|.+++||+-+...-+|. . .|...+..++.
T Consensus       152 ~~~f~viaT~Np~e~~g~~~l~eA~ldRf~~~~~v~yp~~~~e~~~i~~~~~  203 (329)
T COG0714         152 PPPFIVIATQNPGEYEGTYPLPEALLDRFLLRIYVDYPDSEEEERIILARVG  203 (329)
T ss_pred             CCCCEEEEECCCCCCCCCCCCCHHHHCCCEEEEECCCCCCHHHHHHHHHHCC
T ss_conf             9987899826867657887899888810388776489973889999987365


No 36 
>PRK00440 rfc replication factor C small subunit; Reviewed
Probab=99.56  E-value=9.8e-13  Score=115.24  Aligned_cols=215  Identities=23%  Similarity=0.386  Sum_probs=135.3

Q ss_pred             HHCCCCC-CCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCC
Q ss_conf             5404158-766322106889987766520116899999999999984244467359986056565027999999770882
Q gi|254780270|r  315 LLGVPWD-KKSKTKKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQ  393 (820)
Q Consensus       315 ~~~lPW~-~~t~~~~dl~~a~~iLd~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~  393 (820)
                      |++-||- ||-+.++|          |.-|.+++++++-.++.      +.+-|-+.|.||||+||||+|+.+|+.+.-+
T Consensus         1 m~~~lW~eKYRP~~l~----------di~g~~~~~~~L~~~i~------~~~~phlLf~GppG~GKTt~a~~la~~l~~~   64 (318)
T PRK00440          1 MMEEIWVEKYRPRSLD----------EVVGQEEIVERLKSFVK------EKNMPHLLFAGPPGTGKTTAALALARELYGE   64 (318)
T ss_pred             CCHHHHHHCCCCCCHH----------HHCCCHHHHHHHHHHHH------CCCCCEEEEECCCCCCHHHHHHHHHHHHCCC
T ss_conf             9423564601989899----------94196999999999998------7998669888959988999999999997698


Q ss_pred             -----EEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCC----EEEEEECHHHHHHHCCCCHHHHHHHHCCCC
Q ss_conf             -----49986188888888356320014567128999998327887----399993315542311771155665540600
Q gi|254780270|r  394 -----YVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSN----PLLLLDEIDKMGSDLRGDPSAALLEVLDPA  464 (820)
Q Consensus       394 -----f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~n----pv~~ldeidk~~~~~~gdp~~allevldp~  464 (820)
                           +..+.-      |+-||-.     ..-- .|....+....+    -|++|||+|.|+.+.    .+||+..++- 
T Consensus        65 ~~~~~~lelna------sd~r~id-----~vr~-~i~~~~~~~~~~~~~~kiiiiDE~d~l~~~a----q~aL~~~mE~-  127 (318)
T PRK00440         65 YWRENFLELNA------SDERGID-----VIRN-KIKEFARTAPVGGAPFKIIFLDEADNLTSDA----QQALRRTMEM-  127 (318)
T ss_pred             CCCCCEEEECC------CCCCCHH-----HHHH-HHHHHHHHCCCCCCCEEEEEEECCCCCCHHH----HHHHHHHHHC-
T ss_conf             64347689516------4566717-----8999-9999997267789973899986855322556----7888764310-


Q ss_pred             CCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHH
Q ss_conf             16813320103523644279999348655-44131172479982587868999899986089899862578131322899
Q gi|254780270|r  465 QNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDG  543 (820)
Q Consensus       465 qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~  543 (820)
                              |      -+.+.||+++|+.+ |.+|++.|-..|++..-+.++-...-+     ++++.     +.+.++++
T Consensus       128 --------~------~~~~~fil~~n~~~kii~~i~SRc~~i~f~~~~~~~i~~~L~-----~I~~~-----E~i~~~~~  183 (318)
T PRK00440        128 --------Y------SQTTRFILSCNYSSKIIDPIQSRCAVFRFSPLPKEAVIERLR-----YIAKN-----EGLEITDD  183 (318)
T ss_pred             --------C------CCCCEEEEECCCCCCCCCCHHHHHEEEECCCCCHHHHHHHHH-----HHHHH-----CCCCCCHH
T ss_conf             --------5------666258863488333761556551011157899999999999-----99998-----59998999


Q ss_pred             HHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHCCCC
Q ss_conf             99999731774102347888799998987654211785201279678675305200
Q gi|254780270|r  544 VLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDTTVSINENNLQDYLGVPR  599 (820)
Q Consensus       544 ~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~lg~~~  599 (820)
                      ++..|+...-     -++.+.|..+-....        ....||.+.+.+.+|.+.
T Consensus       184 ~l~~i~~~s~-----gdlR~ain~Lq~~~~--------~~~~it~~~v~~~~~~~~  226 (318)
T PRK00440        184 ALEAIYYVSE-----GDMRKAINALQAAAA--------TGKEVTEEAVYKITGTAR  226 (318)
T ss_pred             HHHHHHHHCC-----CCHHHHHHHHHHHHH--------CCCCCCHHHHHHHHCCCC
T ss_conf             9999998649-----989999999999997--------489878999999976999


No 37 
>CHL00181 cbbX CbbX; Provisional
Probab=99.54  E-value=3.7e-12  Score=110.93  Aligned_cols=227  Identities=25%  Similarity=0.368  Sum_probs=146.8

Q ss_pred             CCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHC---------CCCCCCEEEEECCCCCCHHHHHHHHHHHHCC-----
Q ss_conf             21068899877665201168999999999999842---------4446735998605656502799999977088-----
Q gi|254780270|r  327 KKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRV---------IKNKGLILCFVGPPGVGKTSLAQSIAKATGR-----  392 (820)
Q Consensus       327 ~~dl~~a~~iLd~~hyGl~~vK~rile~lav~~~~---------~~~~g~il~l~gppgvGKts~~~sia~al~r-----  392 (820)
                      +..+..+=+.||++--||+.||++|-+..+..+.+         ....+..+.|.||||||||++|+.+|+.|..     
T Consensus        11 ~~~lee~L~eLd~eliGL~~VK~~v~~l~~~~~~~~~R~~~Gl~~~~~s~h~vF~GnPGTGKTTVARl~a~il~~lG~L~   90 (287)
T CHL00181         11 KTQIQEVLDELDEELIGLVPVKTRIREIAALLLVDRLRKNLGLVSSSPGLHMSFTGSPGTGKTTVALKMADILYRLGYIK   90 (287)
T ss_pred             HCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             53499999999886469699999999999999999999987999888765388878998679999999999999869955


Q ss_pred             --CEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECHHHHHH-HCCC----CHHHHHHHHCCCCC
Q ss_conf             --2499861888888883563200145671289999983278873999933155423-1177----11556655406001
Q gi|254780270|r  393 --QYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGS-DLRG----DPSAALLEVLDPAQ  465 (820)
Q Consensus       393 --~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~ldeidk~~~-~~~g----dp~~allevldp~q  465 (820)
                        .|+..      +.+++-|   .|+|..--+.-+.+.+  .+..|+++||-=-+.+ +..+    ..-..|+..++...
T Consensus        91 ~g~vve~------~r~dLvg---~yvG~Ta~kt~~~i~~--a~GGVLfIDEAY~L~~~~~~~dfg~eaidtLl~~me~~~  159 (287)
T CHL00181         91 KGHLITV------TRDDLVG---QYIGHTAPKTKEVLKK--AMGGVLFIDEAYYLYKPDNERDYGAEAIEILLQVMENQR  159 (287)
T ss_pred             CCEEEEE------CHHHHCC---CCCCCCHHHHHHHHHH--CCCCEEEEECHHHHCCCCCCCCCHHHHHHHHHHHHHHCC
T ss_conf             8958995------3588416---3535216999999996--459879982446535788999837999999999987079


Q ss_pred             CCCEEEEECCCCCCCCCEEEEE-ECCC-----CCCCHHHCCCEE-EEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             6813320103523644279999-3486-----554413117247-99825878689998999860898998625781313
Q gi|254780270|r  466 NSSFVDHYLEVEYDLSDVMFIM-TANT-----LNIPLPLMDRME-IIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEEC  538 (820)
Q Consensus       466 n~~f~d~y~~~~~dls~v~fi~-tan~-----~~i~~~l~drme-~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~  538 (820)
                                     .++.+|+ -+-+     +.-.+-|..|+. .|+++.||.+|-.+|++.++-.+          ..
T Consensus       160 ---------------~~lvvI~AGY~~eM~~fl~~NpGL~sRf~~~i~F~dYt~~EL~~I~~~~~~~~----------~~  214 (287)
T CHL00181        160 ---------------DDLVVIFAGYKDRMDKFYESNPGLSSRVANHVDFPDYTPEELLQIAKMMLEEQ----------QY  214 (287)
T ss_pred             ---------------CCEEEEEECCHHHHHHHHHHCCCHHHHCCCEEECCCCCHHHHHHHHHHHHHHC----------CC
T ss_conf             ---------------98899984678999999985904787688723779859999999999999986----------98


Q ss_pred             CCCHHHHHHHHH---CCCCC---CHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHH
Q ss_conf             228999999973---17741---023478887999989876542117852012796786
Q gi|254780270|r  539 CISDGVLLDIIR---LFTHE---AGVRSFERALMKIARKAVTKIVKNSDTTVSINENNL  591 (820)
Q Consensus       539 ~~~~~~i~~ii~---~Yt~E---aGvR~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l  591 (820)
                      .+++++...+.+   ...+.   +.-|..+..+.++.++.|..++.....  .++.++|
T Consensus       215 ~l~~~a~~~l~~~~~~~~~~~~FGNaR~vrnl~e~a~~~qa~Rl~~~~~~--~~~~~dL  271 (287)
T CHL00181        215 QLTPEAEKVLLDYIKRRMEQPLFANARSVRNAIDRARMRQANRIFASGGK--VLTKADL  271 (287)
T ss_pred             CCCHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCC--CCCHHHH
T ss_conf             25879999999999985089998748999999999999999886567999--9999997


No 38 
>pfam07728 AAA_5 AAA domain (dynein-related subfamily). This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.
Probab=99.52  E-value=2.7e-14  Score=127.02  Aligned_cols=126  Identities=28%  Similarity=0.421  Sum_probs=93.3

Q ss_pred             EEEECCCCCCHHHHHHHHHHHH-CCCEEEEECCCCCCHHHHCCCCCC---CCCCCCHHHHHHHHHCCCCCEEEEEECHHH
Q ss_conf             9986056565027999999770-882499861888888883563200---145671289999983278873999933155
Q gi|254780270|r  369 LCFVGPPGVGKTSLAQSIAKAT-GRQYVRMSLGGVYDEADIRGHRRT---YIGSMPGRIIQSLKRAKRSNPLLLLDEIDK  444 (820)
Q Consensus       369 l~l~gppgvGKts~~~sia~al-~r~f~~islgg~~d~~~i~gh~~t---y~ga~pg~ii~~l~~~~~~npv~~ldeidk  444 (820)
                      +.|+||||+|||++|+.+|+++ +++++++.+..-.+++++.|+..-   .....||-+++++++.    .+++|||||+
T Consensus         2 vll~Gp~G~GKT~la~~la~~l~~~~~~~i~~~~~~~~~dl~G~~~~~~~~~~~~~g~l~~a~~~g----~vl~lDEin~   77 (139)
T pfam07728         2 VLLVGPPGTGKSELAERLAAALSNRPVFYVQLTRDTTEEDLKGRRNIANGTTSWVDGPLVRAAREG----EIAVLDEINR   77 (139)
T ss_pred             EEEECCCCCHHHHHHHHHHHHCCCCCCHHHCCCCCCCHHHCCCCEECCCCCEEEECCHHHCCCCCC----CEEEECCHHH
T ss_conf             899989975699999999998079831112146556522205734237993578155141010128----6899634344


Q ss_pred             HHHHCCCCHHHHHHHHCCCCCCCCEE-EEECCC-CC-CCCCEEEEEECCC----CC-CCHHHCCCE
Q ss_conf             42311771155665540600168133-201035-23-6442799993486----55-441311724
Q gi|254780270|r  445 MGSDLRGDPSAALLEVLDPAQNSSFV-DHYLEV-EY-DLSDVMFIMTANT----LN-IPLPLMDRM  502 (820)
Q Consensus       445 ~~~~~~gdp~~allevldp~qn~~f~-d~y~~~-~~-dls~v~fi~tan~----~~-i~~~l~drm  502 (820)
                      .+.+.    .++|+.+||--+-.--. .+.+.. ++ .-.++.||||+|.    .+ ++++|+||+
T Consensus        78 a~~~v----~~~L~~~le~~~~~~~~~~~~~~~~~~~~~~~f~viaT~N~~~~g~~~l~~Al~~RF  139 (139)
T pfam07728        78 ANPDV----LNSLLSLLDERRLLLPEGGELVKVAPDDFAKRFRLIATMNPLDRGLNELSPALRSRF  139 (139)
T ss_pred             CCHHH----HHHHHHHHCCCEEEECCCCEEECCCCCCCCCCEEEEEEECCCCCCCCCCCHHHHCCC
T ss_conf             89999----999999974896983689727336666789996999975896547800998997509


No 39 
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed
Probab=99.50  E-value=2.3e-12  Score=112.40  Aligned_cols=178  Identities=27%  Similarity=0.358  Sum_probs=126.6

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCC
Q ss_conf             65201168999999999999842444673599860565650279999997708824998618888888835632001456
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGS  418 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga  418 (820)
                      ++--|-+++|+++--|+.--+..+..- ..++|+||||.|||++|..||+-||.+|.-.|=--+.               
T Consensus        25 ~efiGQ~~i~~~L~v~i~Aak~r~e~l-dH~Ll~GPPGlGKTTLA~iiA~E~~~~~~~tsGP~le---------------   88 (328)
T PRK00080         25 DEFIGQEKVKENLKIFIEAAKKRGEAL-DHVLLYGPPGLGKTTLANIIANEMGVNIRITSGPALE---------------   88 (328)
T ss_pred             HHCCCHHHHHHHHHHHHHHHHHCCCCC-CCEEEECCCCCCHHHHHHHHHHHHCCCCEECCCCCCC---------------
T ss_conf             663595999999999999999649998-8057658899889999999999868881562450016---------------


Q ss_pred             CCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECC-------CCCCCCCEEEEEECCC
Q ss_conf             712899999832788739999331554231177115566554060016813320103-------5236442799993486
Q gi|254780270|r  419 MPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLE-------VEYDLSDVMFIMTANT  491 (820)
Q Consensus       419 ~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~-------~~~dls~v~fi~tan~  491 (820)
                      -||-++..|...+. +-|+++|||--++...        =|+|=|.--+-..|--++       +.+||....+|.----
T Consensus        89 k~~DL~~iLt~l~~-~dvLFIDEIHRl~~~v--------EE~LY~AMEDf~iDi~iG~g~~Ar~~~i~L~pFTLIGATTr  159 (328)
T PRK00080         89 KAGDLAALLTNLEE-GDVLFIDEIHRLSPVV--------EEILYPAMEDFRLDIMIGKGPAARSIRLDLPPFTLIGATTR  159 (328)
T ss_pred             CHHHHHHHHHHCCC-CCEEEEHHHHHCCHHH--------HHHHHHHHHHCEEEEEECCCCCCEEEECCCCCEEEEECCCC
T ss_conf             74789999960887-8767650653248889--------98857987752345786478653245558998347401367


Q ss_pred             CC-CCHHHCCCEEEEE-ECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHC
Q ss_conf             55-4413117247998-258786899989998608989986257813132289999999731
Q gi|254780270|r  492 LN-IPLPLMDRMEIIR-IAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRL  551 (820)
Q Consensus       492 ~~-i~~~l~drme~i~-~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~  551 (820)
                      .. ++.||+||+-++. +.-|+.+|=.+|.++.     ..     .-.+.+++++...|...
T Consensus       160 ~g~Ls~PLrdRFGi~~~l~~Y~~eeL~~Ii~rs-----a~-----~l~i~i~~~~~~eIA~r  211 (328)
T PRK00080        160 AGLLTSPLRDRFGIVQRLEFYTVEELEKIVKRS-----AR-----ILGIEIDEEGALEIARR  211 (328)
T ss_pred             CCCCCHHHHHHCCCEEEECCCCHHHHHHHHHHH-----HH-----HHCCCCCHHHHHHHHHH
T ss_conf             665776789757933663458999999999999-----99-----83988789999999986


No 40 
>TIGR00382 clpX ATP-dependent Clp protease, ATP-binding subunit ClpX; InterPro: IPR004487   ClpX is a member of the HSP (heat-shock protein) 100 family. Gel filtration and electron microscopy showed that ClpX subunits associate to form a six-membered ring that is stabilized by binding of ATP or nonhydrolyzable analogs of ATP . It functions as an ATP-depedent  molecular chaperone and is the regulatory subunit of the ClpXP protease .   ClpXP is involved in DNA damage repair, stationary-phase gene expression, and ssrA-mediated protein quality control. To date more than 50 proteins include transcription factors, metabolic enzymes, and proteins involved in the starvation and oxidative stress responses have been identified as substrates .    The N-terminal domain of ClpX is a C4-type zinc binding domain (ZBD) involved in substrate recognition. ZBD forms a very stable dimer that is essential for promoting the degradation of some typical ClpXP substrates such as lO and MuA .  ; GO: 0005515 protein binding, 0005524 ATP binding, 0016887 ATPase activity, 0015031 protein transport.
Probab=99.49  E-value=3.1e-13  Score=119.05  Aligned_cols=274  Identities=22%  Similarity=0.314  Sum_probs=184.3

Q ss_pred             HHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHH-------
Q ss_conf             8999999987531102578999998765404158766322106889987766520116899999999999984-------
Q gi|254780270|r  288 ALSELQKLRQMNPLSAESSVVRNYLDWLLGVPWDKKSKTKKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMR-------  360 (820)
Q Consensus       288 ~~kEl~rL~~m~~~s~E~~v~r~Yld~~~~lPW~~~t~~~~dl~~a~~iLd~~hyGl~~vK~rile~lav~~~-------  360 (820)
                      -++.=.|++.|....++-....+      .||-         -+.-|..||+-.=|-|.+|+-.=  .||+..       
T Consensus        65 gerd~~~~~~~~~~~~~~~~~~~------~lP~---------P~eik~~LD~YVIGQe~AKKVLs--VAVYNHYKRl~~~  127 (452)
T TIGR00382        65 GERDGTRLRRKESKEVEEELELS------ELPT---------PKEIKAHLDEYVIGQEQAKKVLS--VAVYNHYKRLNLK  127 (452)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHH------CCCC---------CHHHHHHHCCCCCCCCCCCEEEE--EEEHHHHHHHHHH
T ss_conf             54310235654202456666652------4788---------27999972136123101052543--2411246665324


Q ss_pred             --CCC------------------CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCC
Q ss_conf             --244------------------467359986056565027999999770882499861888888883563200145671
Q gi|254780270|r  361 --VIK------------------NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMP  420 (820)
Q Consensus       361 --~~~------------------~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~p  420 (820)
                        +.+                  .|+. |+|+||-|=|||-||+..|+.|+-||.      +.|..-+.==  =|||--=
T Consensus       128 ~~n~~~d~~D~nvelehleeVEL~KSN-ILLiGPTGSGKTLLAqTLA~~L~VPfA------iADATtLTEA--GYVGEDV  198 (452)
T TIGR00382       128 EKNKKSDNGDSNVELEHLEEVELSKSN-ILLIGPTGSGKTLLAQTLARILNVPFA------IADATTLTEA--GYVGEDV  198 (452)
T ss_pred             HHCCCCCCCCCHHHHHHHHHHHHHCCC-EEEECCCCCCHHHHHHHHHHHCCCCEE------ECCHHHHHCC--CCCCCCH
T ss_conf             304555884000235444443330066-245468885268999999987388742------1111102006--6424228


Q ss_pred             HHHHHHHHHC------CCCCEEEEEECHHHHHHHC-C----CCHH-----HHHHHHC--------------CCCCCCCEE
Q ss_conf             2899999832------7887399993315542311-7----7115-----5665540--------------600168133
Q gi|254780270|r  421 GRIIQSLKRA------KRSNPLLLLDEIDKMGSDL-R----GDPS-----AALLEVL--------------DPAQNSSFV  470 (820)
Q Consensus       421 g~ii~~l~~~------~~~npv~~ldeidk~~~~~-~----gdp~-----~allevl--------------dp~qn~~f~  470 (820)
                      ==|++-|.++      +.--.+||+|||||+|.-. +    =|.+     =|||-++              -|.||  | 
T Consensus       199 ENIL~~Llq~ad~DV~kA~kGIiYIDEIDKIaRkSEN~SITRDVSGEGVQQALLKi~EGTvA~vPPqGGRKHP~~~--~-  275 (452)
T TIGR00382       199 ENILLKLLQAADYDVEKAQKGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKIIEGTVANVPPQGGRKHPQQE--F-  275 (452)
T ss_pred             HHHHHHHHHHCCCCHHHHCCCEEEEECCCCHHHHCCCCEEEEEECCCHHHHHHHHHHHCCEEEECCCCCCCCCCCC--E-
T ss_conf             8999999874145524527850898422310121577801122175549999998760323431754488688657--6-


Q ss_pred             EEECCCCCCCCCEEEEEECCCCCCCHHHCCCEEEEEECCCCHHHHHHHHHH-------HHHHHHHHHHCC----------
Q ss_conf             201035236442799993486554413117247998258786899989998-------608989986257----------
Q gi|254780270|r  471 DHYLEVEYDLSDVMFIMTANTLNIPLPLMDRMEIIRIAGYTEEEKLQIAKN-------HLVKKVLTEHAL----------  533 (820)
Q Consensus       471 d~y~~~~~dls~v~fi~tan~~~i~~~l~drme~i~~~~y~~~ek~~i~~~-------~l~p~~~~~~~~----------  533 (820)
                           |.+|=|++||||----..+......|+.-=--=|++..+|-..-++       ++-|.-|=++||          
T Consensus       276 -----iqiDTs~ILFICGGAF~GL~~iI~~R~~~~~~iGF~~~~~~~~~~~~~~~~L~~v~~~DL~kFGLIPEfIGRLPV  350 (452)
T TIGR00382       276 -----IQIDTSNILFICGGAFVGLEKIIKKRTEKKSSIGFGAEVKKKSKEKSEEELLRQVEPEDLVKFGLIPEFIGRLPV  350 (452)
T ss_pred             -----EEECCCCEEEEECCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHCHHHHHHHCCCCCCCCCCCC
T ss_conf             -----886476400110543444899998874555333545521004578789999975171112210555101105340


Q ss_pred             ---------------------------------CCCCCCCCHHHHHHHHHCC-CCCCHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             ---------------------------------8131322899999997317-741023478887999989876542117
Q gi|254780270|r  534 ---------------------------------KQEECCISDGVLLDIIRLF-THEAGVRSFERALMKIARKAVTKIVKN  579 (820)
Q Consensus       534 ---------------------------------~~~~~~~~~~~i~~ii~~Y-t~EaGvR~l~r~i~~i~r~~~~~~~~~  579 (820)
                                                       ..-++.|.+|||+.|.+.- .|-.|-|.|.-.++.+|.-+-.++=.-
T Consensus       351 ~a~L~~L~~eAL~~IL~~PkNAlvKQY~~lf~ld~VeL~F~~eAl~~IA~~A~~RkTGARGLRsI~E~~lLDvMfeLPs~  430 (452)
T TIGR00382       351 IATLEKLDEEALIAILTKPKNALVKQYQALFKLDNVELEFEEEALKAIAKKALERKTGARGLRSIVEGLLLDVMFELPSL  430 (452)
T ss_pred             EECCCCCCHHHHHHHHHCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCH
T ss_conf             20278788789999852544448899999716456113455888999999998507675157899999987531478861


Q ss_pred             -CCCEECCCHHHHHHHH
Q ss_conf             -8520127967867530
Q gi|254780270|r  580 -SDTTVSINENNLQDYL  595 (820)
Q Consensus       580 -~~~~~~i~~~~l~~~l  595 (820)
                       +-..+.||.+.+.+-.
T Consensus       431 ~~~~kv~it~~~v~~~~  447 (452)
T TIGR00382       431 EDLEKVVITKETVLKQS  447 (452)
T ss_pred             HCCCEEEEEHHHHCCCC
T ss_conf             15756787077642664


No 41 
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed
Probab=99.49  E-value=5e-12  Score=109.88  Aligned_cols=217  Identities=23%  Similarity=0.326  Sum_probs=143.7

Q ss_pred             HHHHHHCHHHHHHHHHHHHHHHHHCC---CC---CCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCC
Q ss_conf             76652011689999999999998424---44---6735998605656502799999977088249986188888888356
Q gi|254780270|r  337 LDQDHFGLEKVKERIIEYLAVQMRVI---KN---KGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRG  410 (820)
Q Consensus       337 Ld~~hyGl~~vK~rile~lav~~~~~---~~---~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~g  410 (820)
                      -=+|.-|++++|+-+.|.+...+--.   ..   -..-++|+||||||||.|||.+|.--|-||..+|      .|++- 
T Consensus       150 tF~DVaG~~eaK~el~EiVdfLk~P~k~~~~Gak~PkGvLL~GPPGtGKTlLAkAvAgEa~vpF~~~s------gsef~-  222 (644)
T PRK10733        150 TFADVAGCDEAKEEVAELVEYLREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTIS------GSDFV-  222 (644)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHCHHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHCCCCCEEEEEE------HHHHH-
T ss_conf             71040897899999999999812979999749979985177798998778999998645598089978------47730-


Q ss_pred             CCCCCCCCCCHHHHHHHHHCCCCCE-EEEEECHHHHHHHC----CC--C----HHHHHHHHCCCCCCCCEEEEECCCCCC
Q ss_conf             3200145671289999983278873-99993315542311----77--1----155665540600168133201035236
Q gi|254780270|r  411 HRRTYIGSMPGRIIQSLKRAKRSNP-LLLLDEIDKMGSDL----RG--D----PSAALLEVLDPAQNSSFVDHYLEVEYD  479 (820)
Q Consensus       411 h~~ty~ga~pg~ii~~l~~~~~~np-v~~ldeidk~~~~~----~g--d----p~~allevldp~qn~~f~d~y~~~~~d  479 (820)
                        --|||.-..|+=+-..+|+..-| +|++||||-++..-    .|  |    .-+.||.=+|-     |..        
T Consensus       223 --e~~vGvga~rVR~lF~~Ar~~aP~IIFIDEiDaig~~R~~~~~gg~~e~~~tlNqlL~EmDG-----f~~--------  287 (644)
T PRK10733        223 --EMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDG-----FEG--------  287 (644)
T ss_pred             --HEEEECCHHHHHHHHHHHHHCCCEEEEEECHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHC-----CCC--------
T ss_conf             --22253068999999999996699799995322036667898889832888789999999548-----888--------


Q ss_pred             CCCEEEEEECCCCC-CCHHHCC--CEE-EEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCC-
Q ss_conf             44279999348655-4413117--247-998258786899989998608989986257813132289999999731774-
Q gi|254780270|r  480 LSDVMFIMTANTLN-IPLPLMD--RME-IIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTH-  554 (820)
Q Consensus       480 ls~v~fi~tan~~~-i~~~l~d--rme-~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~-  554 (820)
                      -..|+.|+.-|-.+ ++++|+-  |+. .|.++--..++..+|.+-|+-.+-     +. .++.      ...|...|- 
T Consensus       288 ~~~ViviaATNrpd~LD~ALlRPGRFDr~I~V~lPd~~~R~~ILkvh~~~~~-----l~-~dvd------l~~lA~~T~G  355 (644)
T PRK10733        288 NEGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVP-----LA-PDID------AAIIARGTPG  355 (644)
T ss_pred             CCCEEEEEECCCCCCCCHHHHCCCCCCEEEEECCCCHHHHHHHHHHHHCCCC-----CC-CCCC------HHHHHCCCCC
T ss_conf             7876999626997554777716888655999779898899999999964887-----77-3115------8988445998


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHHH
Q ss_conf             1023478887999989876542117852012796786753
Q gi|254780270|r  555 EAGVRSFERALMKIARKAVTKIVKNSDTTVSINENNLQDY  594 (820)
Q Consensus       555 EaGvR~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~  594 (820)
                      =+|-     .|..+|+.+|+.-+.....  .|+.+++++.
T Consensus       356 fSGA-----DLaNlvNEAAl~AaR~~k~--~It~~d~e~A  388 (644)
T PRK10733        356 FSGA-----DLANLVNEAALFAARGNKR--VVSMVEFEKA  388 (644)
T ss_pred             CCHH-----HHCCHHHHHHHHHHHHCCC--CCCHHHHHHH
T ss_conf             6703-----3325999999999870875--4307668998


No 42 
>KOG0731 consensus
Probab=99.47  E-value=9.7e-12  Score=107.72  Aligned_cols=167  Identities=29%  Similarity=0.464  Sum_probs=118.7

Q ss_pred             HHHHHHHCHHHHHHHHHHHHHHHHHCCC------CCC-CEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHH-
Q ss_conf             7766520116899999999999984244------467-35998605656502799999977088249986188888888-
Q gi|254780270|r  336 ILDQDHFGLEKVKERIIEYLAVQMRVIK------NKG-LILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEAD-  407 (820)
Q Consensus       336 iLd~~hyGl~~vK~rile~lav~~~~~~------~~g-~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~-  407 (820)
                      |-=+|.-|.+++|+-|.|+....+- |+      +|- .-..|+||||||||.|||.||.--|-||+.+|      .|| 
T Consensus       308 V~FkDVAG~deAK~El~E~V~fLKN-P~~Y~~lGAKiPkGvLL~GPPGTGKTLLAKAiAGEAgVPF~svS------GSEF  380 (774)
T KOG0731         308 VKFKDVAGVDEAKEELMEFVKFLKN-PEQYQELGAKIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSVS------GSEF  380 (774)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHCC-HHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHCCCCCCEEEEC------HHHH
T ss_conf             7601026708999999999998439-89998747767675178789998678999988530589646413------3788


Q ss_pred             HCCCCCCCCCCCCHHHHHHHHHCCCCCE-EEEEECHHHHHHHC------CCCH-H----HHHHHHCCCCCCCCEEEEECC
Q ss_conf             3563200145671289999983278873-99993315542311------7711-5----566554060016813320103
Q gi|254780270|r  408 IRGHRRTYIGSMPGRIIQSLKRAKRSNP-LLLLDEIDKMGSDL------RGDP-S----AALLEVLDPAQNSSFVDHYLE  475 (820)
Q Consensus       408 i~gh~~ty~ga~pg~ii~~l~~~~~~np-v~~ldeidk~~~~~------~gdp-~----~allevldp~qn~~f~d~y~~  475 (820)
                      +-    -|+|-.+.|+=.-...++..-| +|++||||-++.--      .|+. .    +.||-=+|            +
T Consensus       381 vE----~~~g~~asrvr~lf~~ar~~aP~iifideida~~~~r~G~~~~~~~~e~e~tlnQll~emD------------g  444 (774)
T KOG0731         381 VE----MFVGVGASRVRDLFPLARKNAPSIIFIDEIDAVGRKRGGKGTGGGQDEREQTLNQLLVEMD------------G  444 (774)
T ss_pred             HH----HHCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHC------------C
T ss_conf             88----7603434888999987432698079714542003125566667888078889998878752------------7


Q ss_pred             CCCCCCCEEEEEECCCCC-CCHHHC-----CCEEEEEECCCCHHHHHHHHHHHHHHHHH
Q ss_conf             523644279999348655-441311-----72479982587868999899986089899
Q gi|254780270|r  476 VEYDLSDVMFIMTANTLN-IPLPLM-----DRMEIIRIAGYTEEEKLQIAKNHLVKKVL  528 (820)
Q Consensus       476 ~~~dls~v~fi~tan~~~-i~~~l~-----drme~i~~~~y~~~ek~~i~~~~l~p~~~  528 (820)
                      +... +.|+|+|+.|-.+ +.++|+     ||-  |.++.-+..+...|.+.|+=++-+
T Consensus       445 f~~~-~~vi~~a~tnr~d~ld~allrpGRfdr~--i~i~~p~~~~r~~i~~~h~~~~~~  500 (774)
T KOG0731         445 FETS-KGVIVLAATNRPDILDPALLRPGRFDRQ--IQIDLPDVKGRASILKVHLRKKKL  500 (774)
T ss_pred             CCCC-CCEEEEECCCCCCCCCHHHCCCCCCCCC--EECCCCCHHHHHHHHHHHHHCCCC
T ss_conf             7677-8479981168866428876498755552--324698514168999998621577


No 43 
>PRK00411 cdc6 cell division control protein 6; Reviewed
Probab=99.45  E-value=8.7e-11  Score=100.50  Aligned_cols=222  Identities=20%  Similarity=0.244  Sum_probs=143.9

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC-----CEEEEECCCCCCHH--------HHCC
Q ss_conf             1689999999999998424446735998605656502799999977088-----24998618888888--------8356
Q gi|254780270|r  344 LEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGR-----QYVRMSLGGVYDEA--------DIRG  410 (820)
Q Consensus       344 l~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r-----~f~~islgg~~d~~--------~i~g  410 (820)
                      =++=-++|..+|. -.+.+...+ -+.+.||||||||..++.+.+.|..     .|+.|.+-..+...        .+.|
T Consensus        35 Re~Ei~~l~~~l~-~~l~g~~~~-n~~I~G~pGTGKT~~vk~v~~~l~~~~~~~~~vyINc~~~~t~~~i~~~i~~~L~~  112 (394)
T PRK00411         35 REEQIEELAFALR-PALRGSRPS-NVLILGPPGTGKTTTVKKVFEELEEAALKVVYVYINCQIDRTRYAILSEIARSLFG  112 (394)
T ss_pred             HHHHHHHHHHHHH-HHHCCCCCC-CEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHCC
T ss_conf             5999999999999-997599998-47998899998999999999999974689659999696689899999999999569


Q ss_pred             CCCCCCCCCCHHHHHHHHHC---CCCCEEEEEECHHHHHHHCCCCHHHHHHHHCC-CCCCCCEEEEECCCCCCCCCEEEE
Q ss_conf             32001456712899999832---78873999933155423117711556655406-001681332010352364427999
Q gi|254780270|r  411 HRRTYIGSMPGRIIQSLKRA---KRSNPLLLLDEIDKMGSDLRGDPSAALLEVLD-PAQNSSFVDHYLEVEYDLSDVMFI  486 (820)
Q Consensus       411 h~~ty~ga~pg~ii~~l~~~---~~~npv~~ldeidk~~~~~~gdp~~allevld-p~qn~~f~d~y~~~~~dls~v~fi  486 (820)
                      +.-..-|--...+.+.+.+.   .-...|++|||||.+.+..   ....|..++. |++            +.-|++..|
T Consensus       113 ~~~p~~G~s~~~~~~~l~~~l~~~~~~~ivvLDEiD~L~~~~---~~~vLY~L~r~~~~------------~~~~~~~vI  177 (394)
T PRK00411        113 HPPPSSGLSFDELFDKIAEYLDERDRVLIVALDDINYLVEKE---GNDVLYSLLRAHEE------------YPGARIGVI  177 (394)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCC---CCHHHHHHHHCCCC------------CCCCCEEEE
T ss_conf             989877878999999999986166975899996554020366---50899999854022------------688738999


Q ss_pred             EECCCCC----CCHHHCCCE--EEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHH
Q ss_conf             9348655----441311724--7998258786899989998608989986257813132289999999731774102347
Q gi|254780270|r  487 MTANTLN----IPLPLMDRM--EIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRS  560 (820)
Q Consensus       487 ~tan~~~----i~~~l~drm--e~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~  560 (820)
                      +-+|+++    +.+-+.+|+  +.|.+++|+.+|=..|.+.-+      +.++.++  .+++++|..+.....++.|  +
T Consensus       178 ~IsN~~~~~~~Ldprv~S~l~~~~i~F~PY~~~qL~~IL~~R~------~~af~~g--v~~~~~i~~~A~~~a~~~G--D  247 (394)
T PRK00411        178 GISSDLTFLYILDPRVKSVFGPEEIVFPPYTADEIFDILKDRV------EEGFYPG--VVSDEVLELIADLTGREHG--D  247 (394)
T ss_pred             EEECCCCHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHH------HHCCCCC--CCCHHHHHHHHHHHHHCCC--C
T ss_conf             9976871776640777502786289858999899999999999------8414556--7897899999999855047--5


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHH
Q ss_conf             88879999898765421178520127967867530
Q gi|254780270|r  561 FERALMKIARKAVTKIVKNSDTTVSINENNLQDYL  595 (820)
Q Consensus       561 l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~l  595 (820)
                      ..+-|. +||.++ ++++.+.. -.|+.+++....
T Consensus       248 aR~Ald-llr~A~-e~Ae~~g~-~~Vt~~hV~~A~  279 (394)
T PRK00411        248 ARVAID-LLRRAG-EIAEREGS-RKVTEEDVRKAY  279 (394)
T ss_pred             HHHHHH-HHHHHH-HHHHHHCC-CCCCHHHHHHHH
T ss_conf             899999-999999-99997189-965899999999


No 44 
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=99.45  E-value=7.3e-12  Score=108.65  Aligned_cols=184  Identities=21%  Similarity=0.346  Sum_probs=136.3

Q ss_pred             CEECCCHHHHHHHHCCC-CCCCCCHHCCCCCCCCCEEEECCCCCEEEEEEEEEEC---CCCCEEECCCHHHHHHHHHHHH
Q ss_conf             20127967867530520-0033200022336500000000016807999999974---8997244325689999999999
Q gi|254780270|r  582 TTVSINENNLQDYLGVP-RYKYGKIEGEDQVGIVTGLAWTEVGGEILTVEGVIMP---GKGEITITGNLKEIMKESILAA  657 (820)
Q Consensus       582 ~~~~i~~~~l~~~lg~~-~~~~~~~~~~~~~G~v~GLa~t~~GG~~l~IE~~~~~---g~g~l~lTG~lg~vmkES~~~A  657 (820)
                      ..+..+.+-|.+..-+. .|..++...  .+|-+.--.|-..---++.|++.+.|   ++.+-..+|-      ++..++
T Consensus       266 GvFeM~~~GL~eV~npS~lFL~er~~~--~~GS~v~~~~EGtRpllvEvQALv~~s~~~nPrR~~~G~------D~nRl~  337 (456)
T COG1066         266 GVFEMTENGLREVSNPSALFLSERGEQ--TPGSAVVVVMEGTRPLLVEIQALVSPSSFGNPRRVAVGL------DQNRLA  337 (456)
T ss_pred             EEEEEECCCEEEECCCHHHHHHCCCCC--CCCCEEEEEEECCCCEEEEEEECCCCCCCCCCEEEEECC------CHHHHH
T ss_conf             688984388468038278674226778--998679999962663598861203666688870276053------755899


Q ss_pred             HHHHHHHHH-HCCCCHHHHHHCCCEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEEEECCEEEEECCHH
Q ss_conf             999999888-6299855742078147448888478887306899999999983688875610663685030250006568
Q gi|254780270|r  658 SSYVRSKAT-TFGIIPSAFNEINIHVHVPEGATPKDGPSAGIAMATAIVSIMTCIPVYKNVAMTGELTLRGRVLPIGGLK  736 (820)
Q Consensus       658 ~s~~k~~~~-~~~~~~~~~~~~diHih~p~Ga~pKDGPSAGi~i~tal~S~~~~~~v~~~iAmTGEitl~G~VlpiGGi~  736 (820)
                      +-.  +.+. +.++.   +.++|+.+++. |++.-+-|+|-.|++.|++|++.++|++++.++.|||.|.|.|-||-.+.
T Consensus       338 mll--AVLek~~gl~---l~~~Dvyvnva-GG~ki~EPAaDLAva~Al~SS~~~~~lp~~~v~~GEvgL~GeIR~V~~~~  411 (456)
T COG1066         338 MLL--AVLEKRLGLP---LGDQDVYVNVA-GGVKVTEPAADLAVALALVSSFRNRPLPQDTVVFGEVGLSGEIRPVPRGE  411 (456)
T ss_pred             HHH--HHHHHHCCCC---CCCCCEEEECC-CCEECCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCEEEECCCHH
T ss_conf             999--9999861986---66863799804-87765772688999999999863888998718999503574254267588


Q ss_pred             HHHHHHHHCCCCEEECCHHHHHHHHHCCHHHHCCCEEEECCCHHHHHHHHH
Q ss_conf             999999970996998036775507761488770979998193999888760
Q gi|254780270|r  737 EKLLAALRAGVTKVLIPEENIKDLMDIPENVKNGLEIIPVSFMGEVLKHAL  787 (820)
Q Consensus       737 eK~laA~raGi~~viiP~~N~~d~~~ip~~~~~~l~~~~v~~~~evl~~al  787 (820)
                      +.+--|.+.|.+++|+|+.|..        ...+++++.|+++.|+++.++
T Consensus       412 ~RlkEA~klGFk~aivP~~~~~--------~~~~~~~~~v~~l~~a~~~~~  454 (456)
T COG1066         412 RRLKEAAKLGFKRAIVPKGNIP--------LPEGIKVIGVSTLAEALEVVF  454 (456)
T ss_pred             HHHHHHHHCCCCEEECCCCCCC--------CCCCCEEEEEECHHHHHHHHH
T ss_conf             9999999758977974687677--------888815998500999999874


No 45 
>PRK12402 replication factor C small subunit 2; Reviewed
Probab=99.45  E-value=1.5e-12  Score=113.80  Aligned_cols=191  Identities=19%  Similarity=0.250  Sum_probs=118.5

Q ss_pred             HCCCCC-CCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCE
Q ss_conf             404158-7663221068899877665201168999999999999842444673599860565650279999997708824
Q gi|254780270|r  316 LGVPWD-KKSKTKKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQY  394 (820)
Q Consensus       316 ~~lPW~-~~t~~~~dl~~a~~iLd~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f  394 (820)
                      |+++|- ||-+..+|          |..|.+.+++.+..++      .+..-|-+.|.||||+||||+|+.+|++|+-..
T Consensus         1 ~~~lWveKYRP~~~~----------dvvGq~~i~~~L~~~~------~~~~~phlLf~GPpG~GKTt~A~~lA~~l~~~~   64 (337)
T PRK12402          1 MAMLWTEKYRPSLFE----------DILGQESVVDHLSALA------ASGNLPHLVVYGPSGSGKTAAVRALARELYGDP   64 (337)
T ss_pred             CCCCCCCCCCCCCHH----------HHCCCHHHHHHHHHHH------HCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCC
T ss_conf             988532141889799----------8039799999999999------779987698889298489999999999967997


Q ss_pred             EE-----EECCCCCC--HHHHCCCCCCC-CCCCCHH-------HHH-HHHHCCCCC------EEEEEECHHHHHHHCCCC
Q ss_conf             99-----86188888--88835632001-4567128-------999-998327887------399993315542311771
Q gi|254780270|r  395 VR-----MSLGGVYD--EADIRGHRRTY-IGSMPGR-------IIQ-SLKRAKRSN------PLLLLDEIDKMGSDLRGD  452 (820)
Q Consensus       395 ~~-----islgg~~d--~~~i~gh~~ty-~ga~pg~-------ii~-~l~~~~~~n------pv~~ldeidk~~~~~~gd  452 (820)
                      ..     +.-..+.+  ...+..+.|.. +-..+++       +++ .++..-...      -|++|||.|.|+.+.   
T Consensus        65 ~~~~~~~~nasd~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~d~i~~ii~~~a~~~p~~~~~KiiIlDEad~lt~~A---  141 (337)
T PRK12402         65 WENNFTYFNVSDFFDQGKKYLVEDPRFAHFYDDPKRKYKSVIDNFKHILKEYASMRPLSADYKLILFDNAEALREDA---  141 (337)
T ss_pred             CCCCCCEECCCCCCCCCCCEEECCCCHHHHHCCHHHCCCCHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCCHHH---
T ss_conf             56783331165311356400101664234420153327737899999999986148877880499970713179999---


Q ss_pred             HHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             15566554060016813320103523644279999348655-44131172479982587868999899986089899862
Q gi|254780270|r  453 PSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEH  531 (820)
Q Consensus       453 p~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~  531 (820)
                       .+||+.++.--               -+.+.||+++|+.+ |++|++.|-..++++..+.++-...-+     +++++ 
T Consensus       142 -q~aLlk~lEe~---------------~~~~~fIl~t~~~~~ii~tI~SRC~~i~F~~~s~~~i~~~L~-----~I~~~-  199 (337)
T PRK12402        142 -QQALRRIMERY---------------SETCRFIFSTTQPSKLIPPIRSRCLPLFFRPVPDDEIRSVLE-----SIAAA-  199 (337)
T ss_pred             -HHHHHHHHHCC---------------CCCEEEEEECCCCCCCCHHHHHHCEEEECCCCCHHHHHHHHH-----HHHHH-
T ss_conf             -99999887408---------------876699872386444752477624454358989999999999-----99998-


Q ss_pred             CCCCCCCCCCHHHHHHHHHC
Q ss_conf             57813132289999999731
Q gi|254780270|r  532 ALKQEECCISDGVLLDIIRL  551 (820)
Q Consensus       532 ~~~~~~~~~~~~~i~~ii~~  551 (820)
                          +.+.++++++..|++.
T Consensus       200 ----E~i~~~~~~l~~ia~~  215 (337)
T PRK12402        200 ----EGVEISDDGLDLIAYY  215 (337)
T ss_pred             ----CCCCCCHHHHHHHHHH
T ss_conf             ----4999899999999998


No 46 
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]
Probab=99.44  E-value=7.3e-12  Score=108.67  Aligned_cols=184  Identities=24%  Similarity=0.355  Sum_probs=124.6

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEEC--CCCCCHHHHCCCCCCCCCCCCHHHHHHHHHC-C-CCCEEEEEECHH
Q ss_conf             59986056565027999999770882499861--8888888835632001456712899999832-7-887399993315
Q gi|254780270|r  368 ILCFVGPPGVGKTSLAQSIAKATGRQYVRMSL--GGVYDEADIRGHRRTYIGSMPGRIIQSLKRA-K-RSNPLLLLDEID  443 (820)
Q Consensus       368 il~l~gppgvGKts~~~sia~al~r~f~~isl--gg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~-~-~~npv~~ldeid  443 (820)
                      -+-|.|||||||||||+-||..++..|.++|-  .|+.   +||.            |+..-++. + -.-+|+++|||-
T Consensus        50 SmIl~GPPG~GKTTlA~liA~~~~~~f~~~sAv~~gvk---dlr~------------i~e~a~~~~~~gr~tiLflDEIH  114 (436)
T COG2256          50 SMILWGPPGTGKTTLARLIAGTTNAAFEALSAVTSGVK---DLRE------------IIEEARKNRLLGRRTILFLDEIH  114 (436)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEECCCCCCHH---HHHH------------HHHHHHHHHHCCCCEEEEEEHHH
T ss_conf             05777899988889999998761776699515234679---9999------------99999998725883499872253


Q ss_pred             HHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEE--EECCCC-CCCHHHCCCEEEEEECCCCHHHHHHHHH
Q ss_conf             5423117711556655406001681332010352364427999--934865-5441311724799825878689998999
Q gi|254780270|r  444 KMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFI--MTANTL-NIPLPLMDRMEIIRIAGYTEEEKLQIAK  520 (820)
Q Consensus       444 k~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi--~tan~~-~i~~~l~drme~i~~~~y~~~ek~~i~~  520 (820)
                      ..+.+-+    .+||-.+.                 =..++||  +|-|-. .+.++|+.|--|.++.+.|.+|-....+
T Consensus       115 RfnK~QQ----D~lLp~vE-----------------~G~iilIGATTENPsF~ln~ALlSR~~vf~lk~L~~~di~~~l~  173 (436)
T COG2256         115 RFNKAQQ----DALLPHVE-----------------NGTIILIGATTENPSFELNPALLSRARVFELKPLSSEDIKKLLK  173 (436)
T ss_pred             HCCHHHH----HHHHHHHC-----------------CCEEEEEECCCCCCCEEECHHHHHHHHEEEEECCCHHHHHHHHH
T ss_conf             3374456----55103324-----------------88689996267898714038886110415651699899999999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHCCCCC
Q ss_conf             86089899862578131322899999997317741023478887999989876542117852012796786753052000
Q gi|254780270|r  521 NHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDTTVSINENNLQDYLGVPRY  600 (820)
Q Consensus       521 ~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~lg~~~~  600 (820)
                      +-+   ..++-||....+.++++++.+++..-.  .-+|.+=-.++     .+....+..+   .++.+.+++.++....
T Consensus       174 ra~---~~~~rgl~~~~~~i~~~a~~~l~~~s~--GD~R~aLN~LE-----~~~~~~~~~~---~~~~~~l~~~l~~~~~  240 (436)
T COG2256         174 RAL---LDEERGLGGQIIVLDEEALDYLVRLSN--GDARRALNLLE-----LAALSAEPDE---VLILELLEEILQRRSA  240 (436)
T ss_pred             HHH---HHHHCCCCCCCCCCCHHHHHHHHHHCC--CHHHHHHHHHH-----HHHHHCCCCC---CCCHHHHHHHHHHHHH
T ss_conf             998---654137776556688899999998628--61999988999-----9998627775---2479999999865520


No 47 
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]
Probab=99.43  E-value=1.1e-11  Score=107.36  Aligned_cols=250  Identities=24%  Similarity=0.351  Sum_probs=167.2

Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHCHHHHHHH---HHHHHHHHHHCCCCCCCEEEEECCCCCCHH
Q ss_conf             57899999876540415876632210688998776652011689999---999999998424446735998605656502
Q gi|254780270|r  304 ESSVVRNYLDWLLGVPWDKKSKTKKNLDFAIRILDQDHFGLEKVKER---IIEYLAVQMRVIKNKGLILCFVGPPGVGKT  380 (820)
Q Consensus       304 E~~v~r~Yld~~~~lPW~~~t~~~~dl~~a~~iLd~~hyGl~~vK~r---ile~lav~~~~~~~~g~il~l~gppgvGKt  380 (820)
                      +...+++-.=.+++-|....++...|+      -=.|.-|.|.+|..   |++||---...++--..-.+|+||||+|||
T Consensus        92 ~~~i~~st~i~vl~~~~~~~~e~~~~i------t~ddViGqEeAK~kcrli~~yLenPe~Fg~WAPknVLFyGppGTGKT  165 (368)
T COG1223          92 GGGIITSTTIFVLETPREEDREIISDI------TLDDVIGQEEAKRKCRLIMEYLENPERFGDWAPKNVLFYGPPGTGKT  165 (368)
T ss_pred             CCCEECCEEEEEECCCCHHHHHHHCCC------CHHHHHCHHHHHHHHHHHHHHHHCHHHHCCCCCCEEEEECCCCCCHH
T ss_conf             883102237999617514555661366------17664163988888799999964968763457541687789996487


Q ss_pred             HHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHC-CCCCEEEEEECHHHHHH-----HCCCCHH
Q ss_conf             79999997708824998618888888835632001456712899999832-78873999933155423-----1177115
Q gi|254780270|r  381 SLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRA-KRSNPLLLLDEIDKMGS-----DLRGDPS  454 (820)
Q Consensus       381 s~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~-~~~npv~~ldeidk~~~-----~~~gdp~  454 (820)
                      -+||++|.-.+-||.-+-      .+++-|   -|||----+|-+..-+| +..-||++|||+|-++-     +.|||.+
T Consensus       166 m~Akalane~kvp~l~vk------at~liG---ehVGdgar~Ihely~rA~~~aPcivFiDE~DAiaLdRryQelRGDVs  236 (368)
T COG1223         166 MMAKALANEAKVPLLLVK------ATELIG---EHVGDGARRIHELYERARKAAPCIVFIDELDAIALDRRYQELRGDVS  236 (368)
T ss_pred             HHHHHHHCCCCCCEEEEC------HHHHHH---HHHHHHHHHHHHHHHHHHHCCCEEEEEHHHHHHHHHHHHHHHCCCHH
T ss_conf             999987254578548711------688888---77435989999999988751984998400245553045788645499


Q ss_pred             ---HHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHHHCCCEE-EEEECCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             ---566554060016813320103523644279999348655-4413117247-99825878689998999860898998
Q gi|254780270|r  455 ---AALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLPLMDRME-IIRIAGYTEEEKLQIAKNHLVKKVLT  529 (820)
Q Consensus       455 ---~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~drme-~i~~~~y~~~ek~~i~~~~l~p~~~~  529 (820)
                         +|||.-||--- .+            -.|.|||.-|..+ .+++.+.|.| -|+..=-..+|.++|...|+-     
T Consensus       237 EiVNALLTelDgi~-en------------eGVvtIaaTN~p~~LD~aiRsRFEeEIEF~LP~~eEr~~ile~y~k-----  298 (368)
T COG1223         237 EIVNALLTELDGIK-EN------------EGVVTIAATNRPELLDPAIRSRFEEEIEFKLPNDEERLEILEYYAK-----  298 (368)
T ss_pred             HHHHHHHHHCCCCC-CC------------CCEEEEEECCCHHHCCHHHHHHHHHEEEEECCCHHHHHHHHHHHHH-----
T ss_conf             99999998501744-57------------7569995059846507888865565065648885899999999898-----


Q ss_pred             HHCCCCCCCCCCHHHHHHHHHCCCCC-CHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHCCCC
Q ss_conf             62578131322899999997317741-02347888799998987654211785201279678675305200
Q gi|254780270|r  530 EHALKQEECCISDGVLLDIIRLFTHE-AGVRSFERALMKIARKAVTKIVKNSDTTVSINENNLQDYLGVPR  599 (820)
Q Consensus       530 ~~~~~~~~~~~~~~~i~~ii~~Yt~E-aGvR~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~lg~~~  599 (820)
                      +.-   -.+...   ++++... |+. || |+++..+-    |.|+..+-.++ .-.|+.++++..|.+.+
T Consensus       299 ~~P---lpv~~~---~~~~~~~-t~g~Sg-Rdikekvl----K~aLh~Ai~ed-~e~v~~edie~al~k~r  356 (368)
T COG1223         299 KFP---LPVDAD---LRYLAAK-TKGMSG-RDIKEKVL----KTALHRAIAED-REKVEREDIEKALKKER  356 (368)
T ss_pred             HCC---CCCCCC---HHHHHHH-HCCCCC-HHHHHHHH----HHHHHHHHHHC-HHHHHHHHHHHHHHHHC
T ss_conf             589---765568---9999998-478772-06899999----99999998713-44433889999998633


No 48 
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.
Probab=99.43  E-value=1.2e-12  Score=114.72  Aligned_cols=132  Identities=25%  Similarity=0.335  Sum_probs=90.6

Q ss_pred             HHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH---CCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCC
Q ss_conf             984244467359986056565027999999770---88249986188888888356320014567128999998327887
Q gi|254780270|r  358 QMRVIKNKGLILCFVGPPGVGKTSLAQSIAKAT---GRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSN  434 (820)
Q Consensus       358 ~~~~~~~~g~il~l~gppgvGKts~~~sia~al---~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~n  434 (820)
                      ..+.....+..++|+||||||||++|+.||+.+   +.+|..++.+.+.......++.+.+     .............+
T Consensus        11 ~~~~~~~~~~~ill~GppGtGKT~la~~ia~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~   85 (151)
T cd00009          11 REALELPPPKNLLLYGPPGTGKTTLARAIANELFRPGAPFLYLNASDLLEGLVVAELFGHF-----LVRLLFELAEKAKP   85 (151)
T ss_pred             HHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCEEEEEHHHCCHHHHHHHHHHHH-----HHHHHHHHHHHCCC
T ss_conf             9998187998089989999886599999999712137982785477704677775760577-----88989999997699


Q ss_pred             EEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCC---CCCHHHCCCEE-EEEE
Q ss_conf             3999933155423117711556655406001681332010352364427999934865---54413117247-9982
Q gi|254780270|r  435 PLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTL---NIPLPLMDRME-IIRI  507 (820)
Q Consensus       435 pv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~---~i~~~l~drme-~i~~  507 (820)
                      +|+++||||+++...+    .+++.+|+.--+.         .....++.+|++.|..   .+..++.+|+. .|.+
T Consensus        86 ~vl~iDEi~~l~~~~~----~~~~~~l~~~~~~---------~~~~~~~~vI~~tn~~~~~~~~~~~~~R~~~~i~~  149 (151)
T cd00009          86 GVLFIDEIDSLSRGAQ----NALLRVLETLNDL---------RIDRENVRVIGATNRPLLGDLDRALYDRLDIRIVI  149 (151)
T ss_pred             CEEEEECHHHCCHHHH----HHHHHHHHHHCCC---------CCCCCCEEEEEEECCCCCCCHHHHHHCCCCEEEEC
T ss_conf             8698201665599999----9999999871575---------40678889999528998868377642559869863


No 49 
>PRK05563 DNA polymerase III subunits gamma and tau; Validated
Probab=99.41  E-value=1.1e-11  Score=107.39  Aligned_cols=213  Identities=19%  Similarity=0.323  Sum_probs=143.7

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC-------C------EEEEECCCCCCH
Q ss_conf             652011689999999999998424446735998605656502799999977088-------2------499861888888
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGR-------Q------YVRMSLGGVYDE  405 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r-------~------f~~islgg~~d~  405 (820)
                      +|.-|-+.|...+-..     +..+.-+..++|+||+||||||.|+.+|+||+-       |      +..|.-|..-|.
T Consensus        16 ~dvvgQ~~v~~~L~n~-----i~~~~i~hayLf~GprG~GKTs~Ari~akalnc~~~~~~~pC~~C~~C~~i~~g~~~Dv   90 (541)
T PRK05563         16 EDVVGQEHITTTLKNQ-----IINNRIAHAYLFCGTRGTGKTSTAKIFAKAVNCLNPQDGEPCNECEICKKINEGLLMDV   90 (541)
T ss_pred             HHHCCCHHHHHHHHHH-----HHCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCCE
T ss_conf             6624849999999999-----98499320453038799589999999999957999888985751488999856898873


Q ss_pred             HHHCCCCCCCCCCCCHHHHHHHHH--CCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCE
Q ss_conf             883563200145671289999983--278873999933155423117711556655406001681332010352364427
Q gi|254780270|r  406 ADIRGHRRTYIGSMPGRIIQSLKR--AKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDV  483 (820)
Q Consensus       406 ~~i~gh~~ty~ga~pg~ii~~l~~--~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v  483 (820)
                      -||.+-+.+=|.-.- .|++..+-  +...--|+++||++-|+.+    ..+|||-.|.             -|  -++|
T Consensus        91 ~Eidaas~~gvd~iR-~~~~~~~~~p~~~~~Kv~IiDEvhmls~~----a~nallKtlE-------------eP--p~~~  150 (541)
T PRK05563         91 IEIDAASNNGVDDIR-EIIENVKYPPQEGKYKVYIMDEVHMLSQG----AVNAFLKTLE-------------EP--PSNV  150 (541)
T ss_pred             EEECCCCCCCHHHHH-HHHHHCEECCCCCCEEEEEEECCCCCCHH----HHHHHHHHHH-------------CC--CCCC
T ss_conf             662444447889999-99976104876787059999772338999----9999999985-------------48--7775


Q ss_pred             EEEEECCCCC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHH
Q ss_conf             9999348655-441311724799825878689998999860898998625781313228999999973177410234788
Q gi|254780270|r  484 MFIMTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFE  562 (820)
Q Consensus       484 ~fi~tan~~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~  562 (820)
                      .||+-.++.+ ||++++.|-..+.+..-+..+-..-     +.+++     ..+.+.++++|+..|.+.  -+.|+|+--
T Consensus       151 ~Filatte~~ki~~tI~SRcq~f~f~~i~~~~i~~~-----L~~I~-----~~E~i~~~~~al~lIa~~--s~GsmRDAl  218 (541)
T PRK05563        151 IFILATTDPQKLPITILSRCQRFDFKRIKVKDIFKR-----LRKIV-----EEQGIFADDKSLNLIARM--SDGAMRDAL  218 (541)
T ss_pred             EEEEECCCCCCCCHHHHHHEEEEEEEECCHHHHHHH-----HHHHH-----HHCCCCCCHHHHHHHHHH--CCCCHHHHH
T ss_conf             699976984427455674213577543899999999-----99999-----984999878999999974--599778899


Q ss_pred             HHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHCCC
Q ss_conf             879999898765421178520127967867530520
Q gi|254780270|r  563 RALMKIARKAVTKIVKNSDTTVSINENNLQDYLGVP  598 (820)
Q Consensus       563 r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~lg~~  598 (820)
                      -.+..+.-     +  +.   -.|+.+++.+.||.-
T Consensus       219 slLdQ~is-----~--~~---~~it~~~v~~~lG~~  244 (541)
T PRK05563        219 SILDQAIS-----M--GD---GKVDYDDVVSMLGLV  244 (541)
T ss_pred             HHHHHHHH-----H--CC---CCCCHHHHHHHHCCC
T ss_conf             99999998-----3--59---986699999996899


No 50 
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]
Probab=99.41  E-value=4.3e-11  Score=102.81  Aligned_cols=179  Identities=30%  Similarity=0.425  Sum_probs=130.9

Q ss_pred             HHHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCC
Q ss_conf             66520116899999999999984244467359986056565027999999770882499861888888883563200145
Q gi|254780270|r  338 DQDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIG  417 (820)
Q Consensus       338 d~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~g  417 (820)
                      =+|-.|-+++|+++-=|+.--+.++..-. .++|+||||+||||||.-||+-||-.+...| |.+-+             
T Consensus        25 l~efiGQ~~vk~~L~ifI~AAk~r~e~lD-HvLl~GPPGlGKTTLA~IIA~Emgvn~k~ts-Gp~le-------------   89 (332)
T COG2255          25 LDEFIGQEKVKEQLQIFIKAAKKRGEALD-HVLLFGPPGLGKTTLAHIIANELGVNLKITS-GPALE-------------   89 (332)
T ss_pred             HHHHCCHHHHHHHHHHHHHHHHHCCCCCC-EEEEECCCCCCHHHHHHHHHHHHCCCEEECC-CCCCC-------------
T ss_conf             88851839999999999999984498767-4786479987688899999998567737636-62015-------------


Q ss_pred             CCCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECC-------CCCCCCCEEEEEECC
Q ss_conf             6712899999832788739999331554231177115566554060016813320103-------523644279999348
Q gi|254780270|r  418 SMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLE-------VEYDLSDVMFIMTAN  490 (820)
Q Consensus       418 a~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~-------~~~dls~v~fi~tan  490 (820)
                       .||-+...|-... .|-|+++|||-.++..        --|+|=|.--+-..|--++       +..||....+|----
T Consensus        90 -K~gDlaaiLt~Le-~~DVLFIDEIHrl~~~--------vEE~LYpaMEDf~lDI~IG~gp~Arsv~ldLppFTLIGATT  159 (332)
T COG2255          90 -KPGDLAAILTNLE-EGDVLFIDEIHRLSPA--------VEEVLYPAMEDFRLDIIIGKGPAARSIRLDLPPFTLIGATT  159 (332)
T ss_pred             -CHHHHHHHHHCCC-CCCEEEEEHHHHCCHH--------HHHHHHHHHHHEEEEEEECCCCCCCEEECCCCCEEEEEECC
T ss_conf             -7265999986398-6776777255314742--------89896467531057789724875534763799813751013


Q ss_pred             CCC-CCHHHCCCEEEE-EECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHC
Q ss_conf             655-441311724799-8258786899989998608989986257813132289999999731
Q gi|254780270|r  491 TLN-IPLPLMDRMEII-RIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRL  551 (820)
Q Consensus       491 ~~~-i~~~l~drme~i-~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~  551 (820)
                      -.. ++.||+||.-++ ++.-|+.+|=..|.+++-          ..-++.+++++...|...
T Consensus       160 r~G~lt~PLrdRFGi~~rlefY~~~eL~~Iv~r~a----------~~l~i~i~~~~a~eIA~r  212 (332)
T COG2255         160 RAGMLTNPLRDRFGIIQRLEFYTVEELEEIVKRSA----------KILGIEIDEEAALEIARR  212 (332)
T ss_pred             CCCCCCCHHHHHCCCEEEEECCCHHHHHHHHHHHH----------HHHCCCCCHHHHHHHHHH
T ss_conf             46645633688628604540588899999999888----------873877685799999986


No 51 
>PRK07270 DNA polymerase III subunits gamma and tau; Validated
Probab=99.38  E-value=1.6e-11  Score=106.11  Aligned_cols=189  Identities=22%  Similarity=0.312  Sum_probs=127.5

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCE-------------EEEECCCCCCH
Q ss_conf             65201168999999999999842444673599860565650279999997708824-------------99861888888
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQY-------------VRMSLGGVYDE  405 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f-------------~~islgg~~d~  405 (820)
                      +|.-|.+.++..+...+     ....-+..+.|.||+||||||.|+..|++|+-+-             ..|.-|...|.
T Consensus        15 ~dvvGQe~i~~~L~nal-----~~~ri~HAyLF~GP~GtGKts~ArifAkaLnC~~~~~~~pC~~C~~C~~i~~g~~~Dv   89 (557)
T PRK07270         15 DEMVGQEVVATTLKQAV-----ESGKISHAYLFSGPRGTGKTSAAKIFAKAMNCPNQVDGEPCNNCDICRDITNGSLEDV   89 (557)
T ss_pred             HHHCCHHHHHHHHHHHH-----HCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCCE
T ss_conf             67148199999999999-----8599540442108998689999999999957999899998887779999875899974


Q ss_pred             HHHCCCCCCCCCCCCHHHHHHHHHC------CCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCC
Q ss_conf             8835632001456712899999832------7887399993315542311771155665540600168133201035236
Q gi|254780270|r  406 ADIRGHRRTYIGSMPGRIIQSLKRA------KRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYD  479 (820)
Q Consensus       406 ~~i~gh~~ty~ga~pg~ii~~l~~~------~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~d  479 (820)
                      -||.+-...=|.     -|..++..      ...--|+++||.|.|+.+    -++|||..|.             -|- 
T Consensus        90 iEidaas~~gVd-----~IRei~~~~~~~P~~~~yKV~IIDEah~Ls~~----A~NALLKtLE-------------EPP-  146 (557)
T PRK07270         90 IEIDAASNNGVD-----EIRDIRDKSTYAPSRATYKVYIIDEVHMLSTG----AFNALLKTLE-------------EPT-  146 (557)
T ss_pred             EEECCCCCCCHH-----HHHHHHHHHCCCCCCCCEEEEEECCHHHCCHH----HHHHHHHHHH-------------CCC-
T ss_conf             873477767889-----99999998423877788389997144534999----9998999852-------------899-


Q ss_pred             CCCEEEEEECCCCC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHH
Q ss_conf             44279999348655-44131172479982587868999899986089899862578131322899999997317741023
Q gi|254780270|r  480 LSDVMFIMTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGV  558 (820)
Q Consensus       480 ls~v~fi~tan~~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGv  558 (820)
                       .+++||...|+.+ ||++++.|--.+++..-+.++-+.-     +..++     +.+.+.++++++..|.+.  -+.|+
T Consensus       147 -~~~vFIL~Ttep~kIl~TI~SRCQrf~F~~i~~~~i~~~-----L~~I~-----~~E~i~~~~~aL~~Ia~~--a~G~m  213 (557)
T PRK07270        147 -ENVVFILATTELHKIPATILSRVQRFEFKSIKTKAIREH-----LAWIL-----DKEGISFEVEALNLIARR--AEGGM  213 (557)
T ss_pred             -CCEEEEEEECCHHHCCHHHHHHHHHCCCCCCCHHHHHHH-----HHHHH-----HHCCCCCCHHHHHHHHHH--CCCCH
T ss_conf             -876999984994759288874300010888999999999-----99999-----983998699999999997--79968


Q ss_pred             HHHHHHHHHH
Q ss_conf             4788879999
Q gi|254780270|r  559 RSFERALMKI  568 (820)
Q Consensus       559 R~l~r~i~~i  568 (820)
                      |+-.-.+...
T Consensus       214 RdAlsiLdQ~  223 (557)
T PRK07270        214 RDALSILDQA  223 (557)
T ss_pred             HHHHHHHHHH
T ss_conf             7899999999


No 52 
>pfam07726 AAA_3 ATPase family associated with various cellular activities (AAA). This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.
Probab=99.38  E-value=1e-12  Score=115.14  Aligned_cols=117  Identities=26%  Similarity=0.404  Sum_probs=82.7

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCC--CCCC---CCCHHHHHHHHHCCCCCEEEEEECHH
Q ss_conf             998605656502799999977088249986188888888356320--0145---67128999998327887399993315
Q gi|254780270|r  369 LCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRR--TYIG---SMPGRIIQSLKRAKRSNPLLLLDEID  443 (820)
Q Consensus       369 l~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~--ty~g---a~pg~ii~~l~~~~~~npv~~ldeid  443 (820)
                      +.|.||||||||++++.+|+++|++|+||++.--.+.+++.|.-.  .--|   -.||.+.         .-++++|||+
T Consensus         2 VLL~GppG~GKT~l~~~lA~~~~~~~~~i~~~~~~~~~Dl~G~~~~~~~~~~~~~~~G~l~---------~~vl~lDEin   72 (131)
T pfam07726         2 VLLEGVPGLAKTLLARTLARSLGLDFRRIQFTPDLLPSDITGTEVYDQKTREFEFRPGPIF---------ANVLLADEIN   72 (131)
T ss_pred             EEEECCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCEEECCCCCEEEEECCCCC---------CCCEEEEHHH
T ss_conf             8789899876999999999995998168883377670003684542378740898457310---------3705640120


Q ss_pred             HHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCC------CCCHHHCCCE
Q ss_conf             5423117711556655406001681332010352364427999934865------5441311724
Q gi|254780270|r  444 KMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTL------NIPLPLMDRM  502 (820)
Q Consensus       444 k~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~------~i~~~l~drm  502 (820)
                      ..+.+-    -++||++++--| -...+.-+.+|-   .+.+|||.|..      ..|++|+||.
T Consensus        73 ~a~~~v----~~~Ll~~l~er~-v~~~g~~~~~p~---~f~viAt~NP~e~~G~~~L~~al~dRF  129 (131)
T pfam07726        73 RAPPKT----QSALLEAMQERQ-VTIGGETHPLPE---PFFVLATQNPIEQEGTYPLPEAQLDRF  129 (131)
T ss_pred             CCCHHH----HHHHHHHHHCEE-EEECCEEEECCC---CEEEEECCCCCCCCCCEECCHHHHCCC
T ss_conf             399899----999997632649-977998852799---849997169875557644998896561


No 53 
>KOG0738 consensus
Probab=99.38  E-value=1.9e-11  Score=105.47  Aligned_cols=228  Identities=24%  Similarity=0.388  Sum_probs=144.0

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHHCCC----CCC--CEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCC
Q ss_conf             6520116899999999999984244----467--3599860565650279999997708824998618888888835632
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQMRVIK----NKG--LILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHR  412 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~~~~~~----~~g--~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~  412 (820)
                      .|.-||+++|+-+-|-.-.-.+-|.    ..-  .-++++||||+|||-|||.+|.--|--|+-||-.-+  .|--||-+
T Consensus       212 ~DIagl~~AK~lL~EAVvlPi~mPe~F~GirrPWkgvLm~GPPGTGKTlLAKAvATEc~tTFFNVSsstl--tSKwRGeS  289 (491)
T KOG0738         212 DDIAGLHEAKKLLKEAVVLPIWMPEFFKGIRRPWKGVLMVGPPGTGKTLLAKAVATECGTTFFNVSSSTL--TSKWRGES  289 (491)
T ss_pred             HHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCEEEEECHHHH--HHHHCCCH
T ss_conf             7631649999999988754442488874244653000556799974789999998861672787402456--55532526


Q ss_pred             CCCCCCCCHHHHHHHHH-C-CCCCEEEEEECHHHHHHHCCCC---H-H-----HHHHHHCCCCCCCCEEEEECCCCCCCC
Q ss_conf             00145671289999983-2-7887399993315542311771---1-5-----566554060016813320103523644
Q gi|254780270|r  413 RTYIGSMPGRIIQSLKR-A-KRSNPLLLLDEIDKMGSDLRGD---P-S-----AALLEVLDPAQNSSFVDHYLEVEYDLS  481 (820)
Q Consensus       413 ~ty~ga~pg~ii~~l~~-~-~~~npv~~ldeidk~~~~~~gd---p-~-----~allevldp~qn~~f~d~y~~~~~dls  481 (820)
                      -        +||.-|-. | ...--+|++||||-+.+. ||.   - |     |-||--+|--||..          +.|
T Consensus       290 E--------KlvRlLFemARfyAPStIFiDEIDslcs~-RG~s~EHEaSRRvKsELLvQmDG~~~t~----------e~~  350 (491)
T KOG0738         290 E--------KLVRLLFEMARFYAPSTIFIDEIDSLCSQ-RGGSSEHEASRRVKSELLVQMDGVQGTL----------ENS  350 (491)
T ss_pred             H--------HHHHHHHHHHHHHCCCEEEHHHHHHHHHC-CCCCCCHHHHHHHHHHHHHHHHCCCCCC----------CCC
T ss_conf             9--------99999999998748853533567788725-7986503678888889999863344444----------565


Q ss_pred             CEEEEEECCCC--CCCHHHCCCEEE-EEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCC-----
Q ss_conf             27999934865--544131172479-9825878689998999860898998625781313228999999973177-----
Q gi|254780270|r  482 DVMFIMTANTL--NIPLPLMDRMEI-IRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFT-----  553 (820)
Q Consensus       482 ~v~fi~tan~~--~i~~~l~drme~-i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt-----  553 (820)
                      |+.|+.-|-.+  +|+++|+-|+|- |.+|=-..+     ++.-||...+....+.+   .+.-+.|-...+.|+     
T Consensus       351 k~VmVLAATN~PWdiDEAlrRRlEKRIyIPLP~~~-----~R~~Li~~~l~~~~~~~---~~~~~~lae~~eGySGaDI~  422 (491)
T KOG0738         351 KVVMVLAATNFPWDIDEALRRRLEKRIYIPLPDAE-----ARSALIKILLRSVELDD---PVNLEDLAERSEGYSGADIT  422 (491)
T ss_pred             EEEEEEECCCCCCCHHHHHHHHHHHHEEEECCCHH-----HHHHHHHHHHCCCCCCC---CCCHHHHHHHHCCCCHHHHH
T ss_conf             16999843689820579999987630331287878-----99999997623566888---75699999985688737799


Q ss_pred             ---CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHC
Q ss_conf             ---4102347888799998987654211785201279678675305
Q gi|254780270|r  554 ---HEAGVRSFERALMKIARKAVTKIVKNSDTTVSINENNLQDYLG  596 (820)
Q Consensus       554 ---~EaGvR~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~lg  596 (820)
                         |||-+--+.|.|..+-+.-.+.+..+.-. .-++..+.++.|.
T Consensus       423 nvCreAsm~~mRR~i~g~~~~ei~~lakE~~~-~pv~~~Dfe~Al~  467 (491)
T KOG0738         423 NVCREASMMAMRRKIAGLTPREIRQLAKEEPK-MPVTNEDFEEALR  467 (491)
T ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHHHCCC-CCCCHHHHHHHHH
T ss_conf             99999999999999724791776443231434-5651565999999


No 54 
>PRK06647 DNA polymerase III subunits gamma and tau; Validated
Probab=99.37  E-value=1.9e-11  Score=105.56  Aligned_cols=213  Identities=19%  Similarity=0.248  Sum_probs=140.6

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCE-------------EEEECCCCCCH
Q ss_conf             65201168999999999999842444673599860565650279999997708824-------------99861888888
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQY-------------VRMSLGGVYDE  405 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f-------------~~islgg~~d~  405 (820)
                      +|..|.+.|.+.+-..     +..+.-+..+.|.||+||||||+|+.+|++|+-..             ..|.-|.-.|.
T Consensus        16 ~dvvGQe~vv~~L~na-----i~~~rl~HAyLFsGprG~GKTt~ArilAk~LnC~~~~~~~PCg~C~sC~~i~~g~~~Dv   90 (560)
T PRK06647         16 NSLEGQDFVVETLKHS-----IEKNKIANAYIFSGPRGVGKTSSARAFARCLNCVNGPTIMPCGECFSCKSIDNDSSLDV   90 (560)
T ss_pred             HHHCCCHHHHHHHHHH-----HHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCCE
T ss_conf             4403949999999999-----97499774366328998789999999999965999999888878878888745999875


Q ss_pred             HHHCCCCCCCCCCCCHHHHHHHHHC--CCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCE
Q ss_conf             8835632001456712899999832--78873999933155423117711556655406001681332010352364427
Q gi|254780270|r  406 ADIRGHRRTYIGSMPGRIIQSLKRA--KRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDV  483 (820)
Q Consensus       406 ~~i~gh~~ty~ga~pg~ii~~l~~~--~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v  483 (820)
                      -||.|-+.+-|.-.- .|++....+  ...--|+++||.|.|+.+    .++|||-.|.             -|=  +++
T Consensus        91 iEidaasn~~VddIR-~l~e~v~~~P~~~~yKV~IIDEahmLt~~----A~NALLKtLE-------------EPP--~~~  150 (560)
T PRK06647         91 IEIDGASNTSVQDVR-QIKEEIMFPPASSRYRVYIIDEVHMLSNS----AFNALLKTIE-------------EPP--PYI  150 (560)
T ss_pred             EEECCCCCCCHHHHH-HHHHHHCCCCCCCCEEEEEECCHHHCCHH----HHHHHHHHHH-------------CCC--CCE
T ss_conf             764364548889999-99998632876687069996465655999----9999999863-------------488--755


Q ss_pred             EEEEECCCCC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHH
Q ss_conf             9999348655-441311724799825878689998999860898998625781313228999999973177410234788
Q gi|254780270|r  484 MFIMTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFE  562 (820)
Q Consensus       484 ~fi~tan~~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~  562 (820)
                      +||+..|+.+ ||++.+.|--.+.+..-+.++-..-     +.+++     +.+.+.++++|+..|...  -+.++|+--
T Consensus       151 ~FILaTte~~KI~~TI~SRCQ~f~Fk~i~~~~I~~~-----L~~I~-----~~E~i~~e~~AL~lIa~~--a~Gs~RDal  218 (560)
T PRK06647        151 VFIFATTEVHKLPATIKSRCQHFNFRLLSLEKIYEM-----LKKVC-----LEDDIKYEDEALKWIAYK--SGGSVRDAY  218 (560)
T ss_pred             EEEEECCCHHHCHHHHHHHHEEEECCCCCHHHHHHH-----HHHHH-----HHCCCCCCHHHHHHHHHH--CCCCHHHHH
T ss_conf             999977994768489996510410555999999999-----99999-----867988799999999997--789588899


Q ss_pred             HHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHCCC
Q ss_conf             879999898765421178520127967867530520
Q gi|254780270|r  563 RALMKIARKAVTKIVKNSDTTVSINENNLQDYLGVP  598 (820)
Q Consensus       563 r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~lg~~  598 (820)
                      -.+..+....          .-.|+.+++.+.||.-
T Consensus       219 slldq~i~~~----------~~~i~~~~v~~~lG~~  244 (560)
T PRK06647        219 TLFDQIVSFS----------NSDITLEQIRSKMGLT  244 (560)
T ss_pred             HHHHHHHHCC----------CCCCCHHHHHHHHCCC
T ss_conf             9999999607----------9977899999986898


No 55 
>PRK06305 DNA polymerase III subunits gamma and tau; Validated
Probab=99.36  E-value=1.9e-11  Score=105.55  Aligned_cols=211  Identities=23%  Similarity=0.333  Sum_probs=141.8

Q ss_pred             HHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCE--------------EEEECCCCCCH
Q ss_conf             5201168999999999999842444673599860565650279999997708824--------------99861888888
Q gi|254780270|r  340 DHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQY--------------VRMSLGGVYDE  405 (820)
Q Consensus       340 ~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f--------------~~islgg~~d~  405 (820)
                      |.-|.+.|...+...+     ..+.-+..+.|.||+||||||+|+.+|++|+-..              ..|.-|.-.|.
T Consensus        18 dvVGQ~~vv~~L~nai-----~~~ri~HAyLF~GprGtGKTT~ArilAkaLnC~~~~~~~~pCg~C~~C~~I~~g~~~DV   92 (462)
T PRK06305         18 EILGQDAVVTVLKNAL-----RFNRAAHAYLFSGIRGTGKTTLARIFAKALNCQNPTEDQEPCNQCAICKEISSGTSLDV   92 (462)
T ss_pred             HHCCCHHHHHHHHHHH-----HCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCE
T ss_conf             6049099999999999-----84997623430389985999999999999679999888898876688899863899986


Q ss_pred             HHHCCCCCCCCCCCCHHHHHHHHH--CCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCC-CCCCCCEEEEECCCCCCCCC
Q ss_conf             883563200145671289999983--278873999933155423117711556655406-00168133201035236442
Q gi|254780270|r  406 ADIRGHRRTYIGSMPGRIIQSLKR--AKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLD-PAQNSSFVDHYLEVEYDLSD  482 (820)
Q Consensus       406 ~~i~gh~~ty~ga~pg~ii~~l~~--~~~~npv~~ldeidk~~~~~~gdp~~allevld-p~qn~~f~d~y~~~~~dls~  482 (820)
                      -||.+-..+=|.-+- .|++...-  +...--|+++||.|.|+.+    -.+|||..|. |-                ++
T Consensus        93 iEiDaAs~~gVddIR-el~e~v~~~P~~~~yKVyIIDEvhmLs~~----AfNALLKtLEEPP----------------~~  151 (462)
T PRK06305         93 IEIDGASHRGIEDIR-QINETVLFTPSKSQYKIYIIDEVHMLTKE----AFNSLLKTLEEPP----------------QH  151 (462)
T ss_pred             EEECCCCCCCHHHHH-HHHHHHCCCCCCCCEEEEEEECHHHCCHH----HHHHHHHHHHCCC----------------CC
T ss_conf             864355344668999-99977100886775059998152117999----9999999861898----------------77


Q ss_pred             EEEEEECCCCC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHH
Q ss_conf             79999348655-44131172479982587868999899986089899862578131322899999997317741023478
Q gi|254780270|r  483 VMFIMTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSF  561 (820)
Q Consensus       483 v~fi~tan~~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l  561 (820)
                      |.||+..++.+ ||++.+.|--.+.+..-+.++-..         .++.. .+.+.+.++++|+..|.+.  -+.++|+-
T Consensus       152 v~FILaTTe~~KIp~TIlSRCQrf~F~~i~~~~I~~---------~L~~I-~~~E~i~~e~~AL~lIA~~--a~GsmRDA  219 (462)
T PRK06305        152 VKFFLATTEIHKIPGTILSRCQKMHLKRIPEETIID---------KLALI-AQQDGIETSREALLPIARA--AQGSLRDA  219 (462)
T ss_pred             EEEEEEECCHHHCCHHHHHHHHEEECCCCCHHHHHH---------HHHHH-HHHCCCCCCHHHHHHHHHH--CCCCHHHH
T ss_conf             499998188142854787654023325799999999---------99999-9983998599999999998--58958789


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHCCC
Q ss_conf             8879999898765421178520127967867530520
Q gi|254780270|r  562 ERALMKIARKAVTKIVKNSDTTVSINENNLQDYLGVP  598 (820)
Q Consensus       562 ~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~lg~~  598 (820)
                      .-.+..+..     +.     .-.|+.+++.+.||.-
T Consensus       220 lslLDQ~i~-----~~-----~~~it~~~V~~~lG~v  246 (462)
T PRK06305        220 ESLYDYVVG-----LF-----PKSLSPDTVAKALGLL  246 (462)
T ss_pred             HHHHHHHHH-----HC-----CCCCCHHHHHHHHCCC
T ss_conf             999999998-----47-----9986899999986899


No 56 
>PRK06674 DNA polymerase III subunits gamma and tau; Validated
Probab=99.36  E-value=2e-10  Score=97.70  Aligned_cols=209  Identities=20%  Similarity=0.316  Sum_probs=137.5

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCE-------------EEEECCCCCCH
Q ss_conf             65201168999999999999842444673599860565650279999997708824-------------99861888888
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQY-------------VRMSLGGVYDE  405 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f-------------~~islgg~~d~  405 (820)
                      +|..|.+.|+..+...     +..+.-+...+|.||+||||||+|+..|+||+-..             ..|.-|...|.
T Consensus        16 ~dvvGQ~~v~~~L~na-----i~~~ri~HAyLF~GprGtGKts~Ari~AkaLnC~~~~~~~pC~~C~~C~~i~~g~~~Dv   90 (563)
T PRK06674         16 EDVVGQEHVTKTLQNA-----LLQEKVSHAYLFSGPRGTGKTSIAKVFAKAVNCEHAPVAEPCNECPSCLGITNGSISDV   90 (563)
T ss_pred             HHHCCHHHHHHHHHHH-----HHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCCE
T ss_conf             5524809999999999-----98499650343128998689999999999857999999887766878999855899877


Q ss_pred             HHHCCCCCCCCCCCCHHHHHHHHH------CCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCC
Q ss_conf             883563200145671289999983------27887399993315542311771155665540600168133201035236
Q gi|254780270|r  406 ADIRGHRRTYIGSMPGRIIQSLKR------AKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYD  479 (820)
Q Consensus       406 ~~i~gh~~ty~ga~pg~ii~~l~~------~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~d  479 (820)
                      -||.+-..+=|.    . |+.+++      ....--|+++||.+.|+.+    -++|||..|.             -|  
T Consensus        91 iEiDaasn~gVd----~-IR~i~~~v~~~P~~~~yKV~IIDeah~Lt~~----A~NALLKtLE-------------EP--  146 (563)
T PRK06674         91 LEIDAASNNGVD----E-IRDIRDKVKFAPSAVEYKVYIIDEVHMLSIG----AFNALLKTLE-------------EP--  146 (563)
T ss_pred             EEECCCCCCCHH----H-HHHHHHHHCCCCCCCCEEEEEEECHHHCCHH----HHHHHHHHHH-------------CC--
T ss_conf             985255557879----9-9999998264886787379998545637999----9999999863-------------88--


Q ss_pred             CCCEEEEEECCCCC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHH
Q ss_conf             44279999348655-44131172479982587868999899986089899862578131322899999997317741023
Q gi|254780270|r  480 LSDVMFIMTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGV  558 (820)
Q Consensus       480 ls~v~fi~tan~~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGv  558 (820)
                      =++|+||+..++.+ ||+..+.|--...+..-+.++-+.-     +..++     ..+.+.++++++..|.+.  -+.|+
T Consensus       147 P~~viFILaTtep~ki~~TI~SRCQrf~F~ri~~~~i~~r-----L~~I~-----~~E~i~~~~~aL~~Ia~~--a~Gsm  214 (563)
T PRK06674        147 PGHVIFILATTEPHKIPPTIISRCQRFDFRRISVNDIVER-----LSTVV-----TNEGTQVEDEALQIIARA--ADGGM  214 (563)
T ss_pred             CCCEEEEEECCCHHHCCHHHHHHHEEEECCCCCHHHHHHH-----HHHHH-----HHCCCCCCHHHHHHHHHH--CCCCH
T ss_conf             7564999965994758478873310312788999999999-----99999-----984999878899999997--69978


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHCCC
Q ss_conf             4788879999898765421178520127967867530520
Q gi|254780270|r  559 RSFERALMKIARKAVTKIVKNSDTTVSINENNLQDYLGVP  598 (820)
Q Consensus       559 R~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~lg~~  598 (820)
                      |+---.+..+....       .   -.||.+++.+.||.-
T Consensus       215 RDAlsiLdQ~~s~~-------~---~~i~~~~v~~~lG~~  244 (563)
T PRK06674        215 RDALSLLDQAISFS-------D---ERVTTEDVLAVTGAV  244 (563)
T ss_pred             HHHHHHHHHHHHHC-------C---CCCCHHHHHHHHCCC
T ss_conf             89999999999715-------9---976899999986899


No 57 
>PRK05896 DNA polymerase III subunits gamma and tau; Validated
Probab=99.35  E-value=1.8e-10  Score=98.06  Aligned_cols=212  Identities=20%  Similarity=0.309  Sum_probs=135.1

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCC-------------EEEEECCCCCCH
Q ss_conf             6520116899999999999984244467359986056565027999999770882-------------499861888888
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQ-------------YVRMSLGGVYDE  405 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~-------------f~~islgg~~d~  405 (820)
                      .+..|.+.+++.+...     +..+.-+....|+||+||||||+|+.+|++|+-.             +..+.-|.-.|-
T Consensus        16 ~eIIGQe~iv~~L~nA-----I~~~RiaHAYLFsGPrGvGKTTlArifAkaLnC~~~~~~dpCg~C~sC~~I~~g~h~Dv   90 (613)
T PRK05896         16 KQIIGQELIKKILVNA-----ILNNKLTHAYIFSGPRGIGKTSIAKIFAKAINCLNPKDGDCCNSCSVCESINTNQSVDI   90 (613)
T ss_pred             HHHCCCHHHHHHHHHH-----HHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCCE
T ss_conf             5523829999999999-----98499762277558998488999999999966999999998888878999856999986


Q ss_pred             HHHCCCCCCCCCCCCHHHHHHHHH--CCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCE
Q ss_conf             883563200145671289999983--278873999933155423117711556655406001681332010352364427
Q gi|254780270|r  406 ADIRGHRRTYIGSMPGRIIQSLKR--AKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDV  483 (820)
Q Consensus       406 ~~i~gh~~ty~ga~pg~ii~~l~~--~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v  483 (820)
                      -||.+...+-|..+- .+++.+..  ....--|+++||.|.|+..    .++|||-.|.             -|-  .+|
T Consensus        91 iEIdaasn~gIDeIR-eLie~~~~~P~~gkyKV~IIDEah~Ln~~----AaNALLKtLE-------------EPP--~~v  150 (613)
T PRK05896         91 VELDAASNNGVDEIR-NIIDNINYLPTTFKYKVYIIDEAHMLSTS----AWNALLKTLE-------------EPP--KHV  150 (613)
T ss_pred             EEEECCCCCCHHHHH-HHHHHHCCCCCCCCCEEEEECCHHHCCHH----HHHHHHHHCC-------------CCC--CCC
T ss_conf             884065557889999-99997085875799459998162217999----9999998534-------------898--783


Q ss_pred             EEEEECCCCC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHH
Q ss_conf             9999348655-441311724799825878689998999860898998625781313228999999973177410234788
Q gi|254780270|r  484 MFIMTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFE  562 (820)
Q Consensus       484 ~fi~tan~~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~  562 (820)
                      +||+..++.+ ||++.+.|--.+.+..-+..+=..         .++.. .+.+.+.++++|+..|.+.  -+.++|+--
T Consensus       151 iFIL~Ttep~KLLpTIlSRCQrf~Fkri~~~~I~~---------~L~~I-~~kE~i~ie~~AL~~Ia~~--adGs~RDAl  218 (613)
T PRK05896        151 VFIFATTEFQKIPLTIISRCQRYNFKKLNNSELQE---------LLKSI-AKKEKIKIEDNAIDKIADL--ADGSLRDGL  218 (613)
T ss_pred             EEEEEECCHHHCCHHHHHCCCCEECCCCCHHHHHH---------HHHHH-HHHCCCCCCHHHHHHHHHH--CCCCHHHHH
T ss_conf             79998288154937664035500178899899999---------99999-9973998789999999997--688487898


Q ss_pred             HHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHCC
Q ss_conf             87999989876542117852012796786753052
Q gi|254780270|r  563 RALMKIARKAVTKIVKNSDTTVSINENNLQDYLGV  597 (820)
Q Consensus       563 r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~lg~  597 (820)
                      ..+..+.-...          -.||.+++.+.+|.
T Consensus       219 slLdQ~~~~~~----------~~it~~~v~~~~g~  243 (613)
T PRK05896        219 SILDQLSTFKN----------KKIDIEDINKTFGL  243 (613)
T ss_pred             HHHHHHHHHCC----------CCCCHHHHHHHHCC
T ss_conf             89999998356----------88629999999677


No 58 
>KOG0730 consensus
Probab=99.32  E-value=2.2e-10  Score=97.42  Aligned_cols=221  Identities=22%  Similarity=0.340  Sum_probs=137.4

Q ss_pred             HHHHHHCHHHHHHHHHHHHHHHHH--------CCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHH
Q ss_conf             766520116899999999999984--------244467359986056565027999999770882499861888888883
Q gi|254780270|r  337 LDQDHFGLEKVKERIIEYLAVQMR--------VIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADI  408 (820)
Q Consensus       337 Ld~~hyGl~~vK~rile~lav~~~--------~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i  408 (820)
                      =.+|.=|||++|+.+-|-+ .+-+        .+-....-++|+||||+|||++||.+|+.-+-+|..|+.--+..    
T Consensus       432 ~W~dIGGlE~lK~elq~~V-~~p~~~pe~F~r~Gi~ppkGVLlyGPPGC~KT~lAkalAne~~~nFlsvkgpEL~s----  506 (693)
T KOG0730         432 SWDDIGGLEELKRELQQAV-EWPLKHPEKFARFGISPPKGVLLYGPPGCGKTLLAKALANEAGMNFLSVKGPELFS----  506 (693)
T ss_pred             CHHHCCCHHHHHHHHHHHH-HHHHHCHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEECCCHHHHH----
T ss_conf             8220457899999999998-61665659998725788754777789986247899998646358726415789987----


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHCC-CCCEEEEEECHHHHHHHCCCCHH-------HHHHHHCCCCCCCCEEEEECCCCCCC
Q ss_conf             56320014567128999998327-88739999331554231177115-------56655406001681332010352364
Q gi|254780270|r  409 RGHRRTYIGSMPGRIIQSLKRAK-RSNPLLLLDEIDKMGSDLRGDPS-------AALLEVLDPAQNSSFVDHYLEVEYDL  480 (820)
Q Consensus       409 ~gh~~ty~ga~pg~ii~~l~~~~-~~npv~~ldeidk~~~~~~gdp~-------~allevldp~qn~~f~d~y~~~~~dl  480 (820)
                           -|+|-----|=+...+|. +.-.|++|||||-++..--|+-.       |.||.-+|-            +. .+
T Consensus       507 -----k~vGeSEr~ir~iF~kAR~~aP~IiFfDEiDsi~~~R~g~~~~v~~RVlsqLLtEmDG------------~e-~~  568 (693)
T KOG0730         507 -----KYVGESERAIREVFRKARQVAPCIIFFDEIDALAGSRGGSSSGVTDRVLSQLLTEMDG------------LE-AL  568 (693)
T ss_pred             -----HHCCCHHHHHHHHHHHHHHCCCEEEEHHHHHHHHHCCCCCCCCHHHHHHHHHHHHCCC------------CC-CC
T ss_conf             -----7518258999999999862698377446666666304787551489999999987004------------10-14


Q ss_pred             CCEEEEEECCCCC-CCHHHCC--CE-EEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCC
Q ss_conf             4279999348655-4413117--24-799825878689998999860898998625781313228999999973177410
Q gi|254780270|r  481 SDVMFIMTANTLN-IPLPLMD--RM-EIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEA  556 (820)
Q Consensus       481 s~v~fi~tan~~~-i~~~l~d--rm-e~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~Ea  556 (820)
                      .+|+.|+--|-.+ |+++|+.  |+ .+|.++---.+-..+|.+.|     .++.-+.+. +.     +++|.+.-..=+
T Consensus       569 k~V~ViAATNRpd~ID~ALlRPGRlD~iiyVplPD~~aR~~Ilk~~-----~kkmp~~~~-vd-----l~~La~~T~g~S  637 (693)
T KOG0730         569 KNVLVIAATNRPDMIDPALLRPGRLDRIIYVPLPDLEARLEILKQC-----AKKMPFSED-VD-----LEELAQATEGYS  637 (693)
T ss_pred             CCEEEEECCCCHHHCCHHHCCCCCCCEEEEECCCCHHHHHHHHHHH-----HHCCCCCCC-CC-----HHHHHHHHCCCC
T ss_conf             7089995058810126977598653305751583478899999999-----733999865-56-----999999854677


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHC
Q ss_conf             2347888799998987654211785201279678675305
Q gi|254780270|r  557 GVRSFERALMKIARKAVTKIVKNSDTTVSINENNLQDYLG  596 (820)
Q Consensus       557 GvR~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~lg  596 (820)
                      |     ..|..+|+.+++--+...-..-.|+..+..+.|.
T Consensus       638 G-----Ael~~lCq~A~~~a~~e~i~a~~i~~~hf~~al~  672 (693)
T KOG0730         638 G-----AEIVAVCQEAALLALRESIEATEITWQHFEEALK  672 (693)
T ss_pred             H-----HHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHH
T ss_conf             3-----8999999999999998752654344899999998


No 59 
>KOG0736 consensus
Probab=99.30  E-value=1.8e-10  Score=98.20  Aligned_cols=147  Identities=24%  Similarity=0.426  Sum_probs=106.5

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHC-CCCCEEEEEECHH
Q ss_conf             673599860565650279999997708824998618888888835632001456712899999832-7887399993315
Q gi|254780270|r  365 KGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRA-KRSNPLLLLDEID  443 (820)
Q Consensus       365 ~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~-~~~npv~~ldeid  443 (820)
                      .-+..+|.|+||+|||...+..|+-||+.++.++.--+.  ++-++|--|       +..+...+| .|.+.|++|--.|
T Consensus       430 ~~~~vLLhG~~g~GK~t~V~~vas~lg~h~~evdc~el~--~~s~~~~et-------kl~~~f~~a~~~~pavifl~~~d  500 (953)
T KOG0736         430 LNPSVLLHGPPGSGKTTVVRAVASELGLHLLEVDCYELV--AESASHTET-------KLQAIFSRARRCSPAVLFLRNLD  500 (953)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHCCCEEECCHHHHH--HCCCCHHHH-------HHHHHHHHHHHCCCEEEEEECCC
T ss_conf             553799867999875799999999838725701389886--436331378-------99999998752686289872242


Q ss_pred             HHHHHCCCCHHHHHHHHCCCC-CCCCEEEEECCCCCCCCCEEEEEECCCC-CCCHHHCCC-EEEEEECCCCHHHHHHHHH
Q ss_conf             542311771155665540600-1681332010352364427999934865-544131172-4799825878689998999
Q gi|254780270|r  444 KMGSDLRGDPSAALLEVLDPA-QNSSFVDHYLEVEYDLSDVMFIMTANTL-NIPLPLMDR-MEIIRIAGYTEEEKLQIAK  520 (820)
Q Consensus       444 k~~~~~~gdp~~allevldp~-qn~~f~d~y~~~~~dls~v~fi~tan~~-~i~~~l~dr-me~i~~~~y~~~ek~~i~~  520 (820)
                      -++-+..|.-..-++-++--. +|.       +++|+--.++||||.++. +||+-.+.- .+.|+++.-..+|..+|.+
T Consensus       501 vl~id~dgged~rl~~~i~~~ls~e-------~~~~~~~~~ivv~t~~s~~~lp~~i~~~f~~ei~~~~lse~qRl~iLq  573 (953)
T KOG0736         501 VLGIDQDGGEDARLLKVIRHLLSNE-------DFKFSCPPVIVVATTSSIEDLPADIQSLFLHEIEVPALSEEQRLEILQ  573 (953)
T ss_pred             EEEECCCCCHHHHHHHHHHHHHHCC-------CCCCCCCCEEEEEECCCCCCCCHHHHHHHHHHCCCCCCCHHHHHHHHH
T ss_conf             4553377744277999999997202-------356779965999962530239878987526521377888788999999


Q ss_pred             HHHHHHH
Q ss_conf             8608989
Q gi|254780270|r  521 NHLVKKV  527 (820)
Q Consensus       521 ~~l~p~~  527 (820)
                      -|+--..
T Consensus       574 ~y~~~~~  580 (953)
T KOG0736         574 WYLNHLP  580 (953)
T ss_pred             HHHHCCC
T ss_conf             9983065


No 60 
>PRK08451 DNA polymerase III subunits gamma and tau; Validated
Probab=99.29  E-value=6e-11  Score=101.70  Aligned_cols=208  Identities=20%  Similarity=0.228  Sum_probs=133.2

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCC-------------EEEEECCCCCCH
Q ss_conf             6520116899999999999984244467359986056565027999999770882-------------499861888888
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQ-------------YVRMSLGGVYDE  405 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~-------------f~~islgg~~d~  405 (820)
                      .|..|.+.|++.+...     +..+.-+..++|.||+||||||+|+.+|++|+-.             +..+.-|.--|-
T Consensus        14 ~evIGQe~iv~~L~nA-----i~~~Rl~HAYLFsGPrGvGKTt~ArifAkaLnC~~~~~~~PCg~C~sC~~i~~g~hpDV   88 (523)
T PRK08451         14 DELIGQESVSKTLSLA-----LDNNRLAHAYLFSGLRGSGKTSSARIFSRALVCEQGPSSTPCGTCAQCQAALEGRHIDI   88 (523)
T ss_pred             HHCCCCHHHHHHHHHH-----HHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCCE
T ss_conf             4404949999999999-----98599671587578998688999999999975999999898887888999864899985


Q ss_pred             HHHCCCCCCCCCCCCHHHHHHHHHC------CCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCC
Q ss_conf             8835632001456712899999832------7887399993315542311771155665540600168133201035236
Q gi|254780270|r  406 ADIRGHRRTYIGSMPGRIIQSLKRA------KRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYD  479 (820)
Q Consensus       406 ~~i~gh~~ty~ga~pg~ii~~l~~~------~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~d  479 (820)
                      -|+.+-..+-|..     |+.++..      ...--|+++||.|.|+..    .++|||-.|.             -|= 
T Consensus        89 iEiDaasn~gID~-----IReLie~~~~~P~~gryKV~IIDEah~Lt~~----A~NALLKTLE-------------EPP-  145 (523)
T PRK08451         89 IEMDAASNRGIDD-----IRNLIEQTKYKPSMARFKIFIIDEVHMLTKE----AFNALLKTLE-------------EPP-  145 (523)
T ss_pred             EEECCCCCCCHHH-----HHHHHHHHCCCCCCCCEEEEEEECCCCCCHH----HHHHHHHHCC-------------CCC-
T ss_conf             5105533368999-----9999997235886797279998260304899----9999999703-------------898-


Q ss_pred             CCCEEEEEECCCCC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHH
Q ss_conf             44279999348655-44131172479982587868999899986089899862578131322899999997317741023
Q gi|254780270|r  480 LSDVMFIMTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGV  558 (820)
Q Consensus       480 ls~v~fi~tan~~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGv  558 (820)
                       ++|+||+..++.+ ||++.+.|--.+.+..-+..+-+.         .++.. +..+.+.++++|+..|.+.  -+.++
T Consensus       146 -~~vvFILaTTep~KLp~TIlSRCQ~f~Fk~I~~~~I~~---------~L~~I-~~~E~i~~e~~AL~~IA~~--a~Gsl  212 (523)
T PRK08451        146 -SYVKFILATTDPLKLPATILSRTQHFRFKQIPQNSIIS---------HLKTI-LNKEGVSYEPEALEILARS--GSGSL  212 (523)
T ss_pred             -CCCEEEEECCCHHHCHHHHHHHHHCCCCCCCCHHHHHH---------HHHHH-HHHCCCCCCHHHHHHHHHH--CCCCH
T ss_conf             -78379997599476848887420311033799999999---------99999-9983998799999999997--78948


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHCC
Q ss_conf             478887999989876542117852012796786753052
Q gi|254780270|r  559 RSFERALMKIARKAVTKIVKNSDTTVSINENNLQDYLGV  597 (820)
Q Consensus       559 R~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~lg~  597 (820)
                      |+-.-.+....-..          .-.||.+++.+.||.
T Consensus       213 RDalslLdQ~i~~~----------~~~i~~~~v~~~lG~  241 (523)
T PRK08451        213 RDTLTLLDQAIIFC----------KNAITESKVADMLGL  241 (523)
T ss_pred             HHHHHHHHHHHHHC----------CCCCCHHHHHHHHCC
T ss_conf             68987999999847----------998779999998588


No 61 
>PRK09862 putative ATP-dependent protease; Provisional
Probab=99.29  E-value=8.1e-10  Score=93.17  Aligned_cols=225  Identities=25%  Similarity=0.341  Sum_probs=105.4

Q ss_pred             HHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHC----------------------------
Q ss_conf             5201168999999999999842444673599860565650279999997708----------------------------
Q gi|254780270|r  340 DHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATG----------------------------  391 (820)
Q Consensus       340 ~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~----------------------------  391 (820)
                      |..|.+.+| |-+|.-|-       .|--|+|+||||+|||.+|+.+...|-                            
T Consensus       192 dv~Gq~~ak-raleIAAA-------GgHnlLl~GpPG~GKTMlA~rlp~ILPpLt~~e~lEv~~I~Svag~~~~~~~~~~  263 (506)
T PRK09862        192 DVVGQEQGK-RGLEITAA-------GGHNLLLIGPPGTGKTMLASRINGLLPDLSNEEALESAAILSLVNAESVQKQWRQ  263 (506)
T ss_pred             HHCCCHHHH-HHHHHHHC-------CCCCEEEECCCCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             536979999-99999744-------6886598769994598999775123899898999999999987189877775466


Q ss_pred             CCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHC-CCCCCCCEE
Q ss_conf             8249986188888888356320014567128999998327887399993315542311771155665540-600168133
Q gi|254780270|r  392 RQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVL-DPAQNSSFV  470 (820)
Q Consensus       392 r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevl-dp~qn~~f~  470 (820)
                      ||| |-.--.....+-|-|-+    -..||-|-.|      -|.|.+|||+-..+.        .-||.| -|=.+...+
T Consensus       264 rPf-R~PHHs~S~~aliGGG~----~~~PGEISLA------H~GVLFLDElpEF~r--------~vLe~LRqPLE~g~I~  324 (506)
T PRK09862        264 RPF-RSPHHSASLTAMVGGGA----IPGPGEISLA------HNGVLFLDELPEFER--------RTLDALREPIESGQIH  324 (506)
T ss_pred             CCE-ECCCCCCCHHHHHCCCC----CCCCCCEEEC------CCCEEEECCHHCCCH--------HHHHHHHHHHCCCEEE
T ss_conf             850-37887654766637999----9999722213------575788455000688--------8999877622477599


Q ss_pred             ----EEECCCCCCCCCEEE-----------------EEECC----CCC-CCHHHCCCEEE-EEECC--C-----------
Q ss_conf             ----201035236442799-----------------99348----655-44131172479-98258--7-----------
Q gi|254780270|r  471 ----DHYLEVEYDLSDVMF-----------------IMTAN----TLN-IPLPLMDRMEI-IRIAG--Y-----------  510 (820)
Q Consensus       471 ----d~y~~~~~dls~v~f-----------------i~tan----~~~-i~~~l~drme~-i~~~~--y-----------  510 (820)
                          .+-+.+|-|   .++                 -||..    |.+ |+.||+||+.+ ++++-  |           
T Consensus       325 IsRa~~~~~~PA~---F~LVaAmNPCPCG~~~~~~~~Ct~~~~~rY~~rlSGPllDRiDl~v~v~~~~~~~l~~~~~~~e  401 (506)
T PRK09862        325 LSRTRAKITYPAR---FQLVAAMNPSPTGHYQGNHNRCTPEQTLRYLNRLSGPFLDRFDLSLEIPLPPPGILSKTVVPGE  401 (506)
T ss_pred             EEECCCEEEECCH---HHHEHHCCCCCCCCCCCCCCCCCHHHHHHHHHHCCHHHHHCEEEEEECCCCCHHHHHCCCCCCC
T ss_conf             9966867986153---3111103788888899997778989999998656622130364799816899666632489898


Q ss_pred             ---CHHHHHHHHHHHHHHHHHHHHC-CC----CCCCCCCHHHHHHHHHCCCC-CCHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             ---8689998999860898998625-78----13132289999999731774-102347888799998987654211785
Q gi|254780270|r  511 ---TEEEKLQIAKNHLVKKVLTEHA-LK----QEECCISDGVLLDIIRLFTH-EAGVRSFERALMKIARKAVTKIVKNSD  581 (820)
Q Consensus       511 ---~~~ek~~i~~~~l~p~~~~~~~-~~----~~~~~~~~~~i~~ii~~Yt~-EaGvR~l~r~i~~i~r~~~~~~~~~~~  581 (820)
                         +..|++..|++--.-++-+-|+ ++    ...+.+++++...+-+-+++ .--.|...|.+     |+|+-++.=..
T Consensus       402 sS~~ir~rV~~Ar~~q~~R~~~~Na~l~~~~l~~~~~l~~~~~~~L~~a~~~~~lS~R~~~riL-----rvARTIADL~g  476 (506)
T PRK09862        402 SSATVKQRVMAARERQFKRQNKLNAWLDSPEIRQFCKLESEDARWLEETLIHLGLSIRAWQRLL-----KVARTIADIDQ  476 (506)
T ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHCCCCHHHHHHHHHHHHHCCCCHHHHHHHH-----HHHHHHHHHCC
T ss_conf             8899999999999999985516565799899976549997899999999996595799999999-----99999985559


Q ss_pred             CEECCCHHHHHHHHCCCCC
Q ss_conf             2012796786753052000
Q gi|254780270|r  582 TTVSINENNLQDYLGVPRY  600 (820)
Q Consensus       582 ~~~~i~~~~l~~~lg~~~~  600 (820)
                       .-.|+.+++.+.|.-..+
T Consensus       477 -~~~i~~~Hi~eAl~yR~~  494 (506)
T PRK09862        477 -SDIITRQHLQEAVSYRAI  494 (506)
T ss_pred             -CCCCCHHHHHHHHHHHHH
T ss_conf             -999998999999971767


No 62 
>PRK06645 DNA polymerase III subunits gamma and tau; Validated
Probab=99.28  E-value=9.1e-11  Score=100.35  Aligned_cols=215  Identities=22%  Similarity=0.248  Sum_probs=141.8

Q ss_pred             HHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCC-----------------EEEEECCCC
Q ss_conf             520116899999999999984244467359986056565027999999770882-----------------499861888
Q gi|254780270|r  340 DHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQ-----------------YVRMSLGGV  402 (820)
Q Consensus       340 ~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~-----------------f~~islgg~  402 (820)
                      |.-|.+.+...+-.     .+..+.-++...|.||.||||||.|+-+|+||+-.                 +..|.-|--
T Consensus        22 ~liGQ~~~~~~l~n-----~i~~~~~~~aylf~G~rG~GKTt~Ari~ak~lnc~~~~~~~~~~~~c~~c~~c~~i~~~~~   96 (507)
T PRK06645         22 ELQGQEVLVKVLSY-----TILNDRLAGGYLLTGIRGVGKTTSARIIAKAVNCSALITENTTIKTCEKCTNCISFNNHNH   96 (507)
T ss_pred             HHCCCHHHHHHHHH-----HHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCC
T ss_conf             62393999999999-----9973996634774587997889999999999679998888998888888767899865899


Q ss_pred             CCHHHHCCCCCCCCCCCCHHHHHHHHHC--CCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCC
Q ss_conf             8888835632001456712899999832--78873999933155423117711556655406001681332010352364
Q gi|254780270|r  403 YDEADIRGHRRTYIGSMPGRIIQSLKRA--KRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDL  480 (820)
Q Consensus       403 ~d~~~i~gh~~ty~ga~pg~ii~~l~~~--~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dl  480 (820)
                      .|.-||.+-++|=|.-+- .++...+-+  ...--|+++||++.+|.+.    .+|||..|+             -|-  
T Consensus        97 ~dv~EiDaas~~gv~~ir-~l~~~~~~~p~~~~~kv~iidE~hmls~~a----~nallktlE-------------epp--  156 (507)
T PRK06645         97 PDIIEIDAASKTSVDDIR-RIIESAEYKPLQGKHKIFIIDEVHMLSKGA----FNALLKTLE-------------EPP--  156 (507)
T ss_pred             CCEEEEECCCCCCHHHHH-HHHHHCCCCCCCCCEEEEEECCHHHCCHHH----HHHHHHHHH-------------CCC--
T ss_conf             985996378888889999-998635517876743589952142248999----999999742-------------786--


Q ss_pred             CCEEEEEECCCCC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHH
Q ss_conf             4279999348655-441311724799825878689998999860898998625781313228999999973177410234
Q gi|254780270|r  481 SDVMFIMTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVR  559 (820)
Q Consensus       481 s~v~fi~tan~~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR  559 (820)
                      ++|.||+..++.+ ||.+.+.|--..++..-+.++-..         .++... +.+.+.++++|+..|.+.  -|.+||
T Consensus       157 ~~~~Fi~atte~~kip~ti~srcq~f~~~~i~~~~i~~---------~l~~i~-~~E~~~~~~~al~~ia~~--a~Gs~R  224 (507)
T PRK06645        157 PHIIFIFATTEVQKIPATIISRCQRYDLRRLSFEEIFK---------LLEYIT-KQENLKADIEALRIIAYK--SEGSAR  224 (507)
T ss_pred             CCEEEEEECCCHHHCCHHHHHHCEEEEEECCCHHHHHH---------HHHHHH-HHCCCCCCHHHHHHHHHH--CCCCHH
T ss_conf             44389997485364837888543278754599799999---------999999-976877778999999985--599867


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHCCC
Q ss_conf             788879999898765421178520127967867530520
Q gi|254780270|r  560 SFERALMKIARKAVTKIVKNSDTTVSINENNLQDYLGVP  598 (820)
Q Consensus       560 ~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~lg~~  598 (820)
                      +--..+...   ++..  .+.  .-.|+.+.+.+.||-.
T Consensus       225 Dalslldqa---i~~~--~~~--~~~I~~~~V~~MLGl~  256 (507)
T PRK06645        225 DAVSILDQA---ASMS--AKS--DNIISPQVINQMLGLV  256 (507)
T ss_pred             HHHHHHHHH---HHHH--CCC--CCCCCHHHHHHHHCCC
T ss_conf             899999999---9975--489--8702699999983899


No 63 
>PRK13407 bchI magnesium chelatase subunit I; Provisional
Probab=99.28  E-value=7.1e-10  Score=93.60  Aligned_cols=227  Identities=17%  Similarity=0.261  Sum_probs=139.0

Q ss_pred             HHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHC----------------------------
Q ss_conf             5201168999999999999842444673599860565650279999997708----------------------------
Q gi|254780270|r  340 DHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATG----------------------------  391 (820)
Q Consensus       340 ~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~----------------------------  391 (820)
                      +.-|.+.+|.-++    +...++..  --+.+.||||+|||.+|++++..|-                            
T Consensus         9 ~IvGQe~~K~AL~----laav~p~~--ggvLi~G~~GtgKStlaR~l~~iLP~~~~~e~~~~~~~~~~~~~~~~~~~~~~   82 (334)
T PRK13407          9 AIVGQEEMKQAMV----LTAIDPGI--GGVLVFGDRGTGKSTAVRALAALLPLIKAVEGCPVNSARPEDCPEWAEVSSTT   82 (334)
T ss_pred             HHCCCHHHHHHHH----HHHCCCCC--CEEEEECCCCCCHHHHHHHHHHHCCCCCHHCCCCCCCCCCCCCHHHHHCCCCC
T ss_conf             7649399999999----97727898--60899789986599999999972899511036755667742113343114555


Q ss_pred             -----CCEEEEECCCCCC--------HHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHH
Q ss_conf             -----8249986188888--------888356320014567128999998327887399993315542311771155665
Q gi|254780270|r  392 -----RQYVRMSLGGVYD--------EADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALL  458 (820)
Q Consensus       392 -----r~f~~islgg~~d--------~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~all  458 (820)
                           .||+.+.+|-..|        ++-++|-.+   -..||-|-.|      .+.|.|+|||--+..    .-.++||
T Consensus        83 ~~~~~~p~v~lPl~atedr~~G~ldie~al~~G~~---~~~PGlLa~A------h~GVLylDEinll~~----~vld~Ll  149 (334)
T PRK13407         83 MVERPTPVIDLPLGATEDRVVGALDIERALTRGEK---AFEPGLLARA------NRGYLYIDEVNLLED----HIVDLLL  149 (334)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCC---CCCCCHHHHC------CCCEEEEECHHHCCH----HHHHHHH
T ss_conf             34489987678999998664474218888626987---7886054340------288678720533338----8999999


Q ss_pred             HHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCC--CCCHHHCCCEEE-EEECC-CCHHHHHHHHHHHHH----------
Q ss_conf             5406001681332010352364427999934865--544131172479-98258-786899989998608----------
Q gi|254780270|r  459 EVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTL--NIPLPLMDRMEI-IRIAG-YTEEEKLQIAKNHLV----------  524 (820)
Q Consensus       459 evldp~qn~~f~d~y~~~~~dls~v~fi~tan~~--~i~~~l~drme~-i~~~~-y~~~ek~~i~~~~l~----------  524 (820)
                      +++..-+|.-=++.+ .+.|. ++.++|+|+|-.  .+.++|+||+-+ +++++ ...++.++|.++-+-          
T Consensus       150 ~~~e~G~~~IeReg~-s~~~P-arF~LVatmNPeEg~Lrp~lLDRf~l~v~v~~~~~~~~r~eiv~r~~~~~~~~~~~~~  227 (334)
T PRK13407        150 DVAQSGENVVEREGL-SIRHP-ARFVLVGSGNPEEGELRPQLLDRFGLSVEVRSPRDVETRVEVITRRDAYDADHDAFMA  227 (334)
T ss_pred             HHHHCCCEEEEECCE-EEECC-CCCEEEEEECCCCCCCCHHHHHHHCEEEEECCCCCHHHHHHHHHHHHHHHHCHHHHHH
T ss_conf             887169579997763-46036-6265898208887775989983610068714878877766889999986538799999


Q ss_pred             ----------HHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHH---HHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHH
Q ss_conf             ----------9899862578131322899999997317741023---478887999989876542117852012796786
Q gi|254780270|r  525 ----------KKVLTEHALKQEECCISDGVLLDIIRLFTHEAGV---RSFERALMKIARKAVTKIVKNSDTTVSINENNL  591 (820)
Q Consensus       525 ----------p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGv---R~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l  591 (820)
                                -++.+... .-.++.++++.+.++.. .+.+.|+   |---+ +-+..|..|  -+.+.   -.|+.++|
T Consensus       228 ~~~~e~~~l~~~i~~Ar~-~l~~v~~~d~~~~~~~~-~~~~~~~~g~Ra~i~-l~r~ARa~A--aL~Gr---~~V~~~dl  299 (334)
T PRK13407        228 KWGAEDMQLRGRILGARA-ALPQLKTPDTVLHDCAA-LCIALGSDGLRGELT-LLRAARAQA--AFEGA---ETVGRSHL  299 (334)
T ss_pred             HHHHHHHHHHHHHHHHHH-HHHCCCCCHHHHHHHHH-HHHHHCCCCCHHHHH-HHHHHHHHH--HHCCC---CCCCHHHH
T ss_conf             889899999999999987-51146899999999999-999858987109999-999999999--97499---97899999


Q ss_pred             HHHH
Q ss_conf             7530
Q gi|254780270|r  592 QDYL  595 (820)
Q Consensus       592 ~~~l  595 (820)
                      ....
T Consensus       300 ~~aa  303 (334)
T PRK13407        300 RSVA  303 (334)
T ss_pred             HHHH
T ss_conf             9999


No 64 
>PRK07133 DNA polymerase III subunits gamma and tau; Validated
Probab=99.28  E-value=3.1e-10  Score=96.32  Aligned_cols=190  Identities=20%  Similarity=0.316  Sum_probs=129.0

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCE----------EEEECCCCCCHHHH
Q ss_conf             65201168999999999999842444673599860565650279999997708824----------99861888888883
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQY----------VRMSLGGVYDEADI  408 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f----------~~islgg~~d~~~i  408 (820)
                      +|.-|.+.|+..+..-     +....-+....|+||.||||||+|+.+|+||+-.-          +.-..|+-.|.-||
T Consensus        18 ~EVIGQe~Vv~tL~nA-----I~~gRIaHAYLF~GPRGvGKTT~ARIfAKaLNC~~~~d~~~pC~~C~~~~~~s~DViEI   92 (718)
T PRK07133         18 DEIKGQDHIIETLKNI-----IKSGKISHAYLFSGPHGTGKTSVAKIFANALNCSHKTDLIEPCQNCIENFNNNLDIIEM   92 (718)
T ss_pred             HHHCCCHHHHHHHHHH-----HHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHCCCCCCCEEEE
T ss_conf             4422859999999999-----97499750586238998688999999999967999999999770214304789873775


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHCCCC------CEEEEEECHHHHHHHCCCCHHHHHHHHCC-CCCCCCEEEEECCCCCCCC
Q ss_conf             5632001456712899999832788------73999933155423117711556655406-0016813320103523644
Q gi|254780270|r  409 RGHRRTYIGSMPGRIIQSLKRAKRS------NPLLLLDEIDKMGSDLRGDPSAALLEVLD-PAQNSSFVDHYLEVEYDLS  481 (820)
Q Consensus       409 ~gh~~ty~ga~pg~ii~~l~~~~~~------npv~~ldeidk~~~~~~gdp~~allevld-p~qn~~f~d~y~~~~~dls  481 (820)
                      .+-+.|-|..     |+.|++.=..      --|+++||.+.|+..    ..+|||-.|. |-                +
T Consensus        93 DAASn~gVDd-----IReLie~v~y~P~~gkYKVyIIDEvHMLS~~----AfNALLKtLEEPP----------------~  147 (718)
T PRK07133         93 DAASNNGVDE-----IRELRENVKNLPQISKYKIYIIDEVHMLSKS----AFNALLKTLEEPP----------------K  147 (718)
T ss_pred             CCCCCCCHHH-----HHHHHHHHCCCCCCCCEEEEEEECCCCCCHH----HHHHHHHHHCCCC----------------C
T ss_conf             4556688899-----9999998255887787249999662007999----9999998502798----------------7


Q ss_pred             CEEEEEECCCCC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHH
Q ss_conf             279999348655-4413117247998258786899989998608989986257813132289999999731774102347
Q gi|254780270|r  482 DVMFIMTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRS  560 (820)
Q Consensus       482 ~v~fi~tan~~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~  560 (820)
                      +|.||+-..+.+ ||+..+.|.-...+..-+..+-..         .++.. +..+.+.++++|+..|.+.  -+.|+|+
T Consensus       148 hvvFILaTTep~KIP~TIlSRCQrFdFkrI~~~~I~~---------~L~~I-~~kE~I~~e~eAL~lIA~~--a~GSmRD  215 (718)
T PRK07133        148 HVIFILATTDVQKIPLTILSRVQRFNFRRISEDVIVH---------QLENI-LEKEKIKYEKNALKLIASL--ASGSLRD  215 (718)
T ss_pred             CCEEEEEECCHHHCCHHHHHCCEEEECCCCCHHHHHH---------HHHHH-HHHCCCCCCHHHHHHHHHH--CCCCHHH
T ss_conf             8279997088254848774122033588899999999---------99999-9985997789999999997--6884888


Q ss_pred             HHHHHHHHHH
Q ss_conf             8887999989
Q gi|254780270|r  561 FERALMKIAR  570 (820)
Q Consensus       561 l~r~i~~i~r  570 (820)
                      --..+..+.-
T Consensus       216 AlSlLDQv~~  225 (718)
T PRK07133        216 ALSIADQVSI  225 (718)
T ss_pred             HHHHHHHHHH
T ss_conf             9879999998


No 65 
>KOG0733 consensus
Probab=99.27  E-value=1.2e-10  Score=99.39  Aligned_cols=193  Identities=26%  Similarity=0.339  Sum_probs=122.2

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHHCCCC-------CCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEE----CCCCCCHHH
Q ss_conf             65201168999999999999842444-------6735998605656502799999977088249986----188888888
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQMRVIKN-------KGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMS----LGGVYDEAD  407 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~~~~~~~-------~g~il~l~gppgvGKts~~~sia~al~r~f~~is----lgg~~d~~~  407 (820)
                      +|.=||++.=..+.|.+.. ...|+.       ...-++|.||||+|||+||..||.-||-||..||    .+|+.-|+|
T Consensus       190 ~diGG~d~~~~el~~li~~-i~~Pe~~~~lGv~PprGvLlHGPPGCGKT~lA~AiAgel~vPf~~isApeivSGvSGESE  268 (802)
T KOG0733         190 SDIGGLDKTLAELCELIIH-IKHPEVFSSLGVRPPRGVLLHGPPGCGKTSLANAIAGELGVPFLSISAPEIVSGVSGESE  268 (802)
T ss_pred             HHCCCHHHHHHHHHHHHHH-HCCCHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHHHCCCCEEEECCHHHHCCCCCCCH
T ss_conf             5416738999999999988-528116866287799751644899864789999975212885485141465315575228


Q ss_pred             HCCCCCCCCCCCCHHHHHHHHHCCCCC-EEEEEECHHHHHHHCCC-------CHHHHHHHHCCCCCCCCE-EEEECCCCC
Q ss_conf             356320014567128999998327887-39999331554231177-------115566554060016813-320103523
Q gi|254780270|r  408 IRGHRRTYIGSMPGRIIQSLKRAKRSN-PLLLLDEIDKMGSDLRG-------DPSAALLEVLDPAQNSSF-VDHYLEVEY  478 (820)
Q Consensus       408 i~gh~~ty~ga~pg~ii~~l~~~~~~n-pv~~ldeidk~~~~~~g-------dp~~allevldp~qn~~f-~d~y~~~~~  478 (820)
                                   -+|=.-..+|...- +|+++||||-++..-.+       -..+-||.-+|-=-|..+ .|       
T Consensus       269 -------------kkiRelF~~A~~~aPcivFiDeIDAI~pkRe~aqreMErRiVaQLlt~mD~l~~~~~~g~-------  328 (802)
T KOG0733         269 -------------KKIRELFDQAKSNAPCIVFIDEIDAITPKREEAQREMERRIVAQLLTSMDELSNEKTKGD-------  328 (802)
T ss_pred             -------------HHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCC-------
T ss_conf             -------------999999998736697599851100136440457889999999999985100256666899-------


Q ss_pred             CCCCEEEEEECCCCC-CCHHHC-----CCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCC
Q ss_conf             644279999348655-441311-----72479982587868999899986089899862578131322899999997317
Q gi|254780270|r  479 DLSDVMFIMTANTLN-IPLPLM-----DRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLF  552 (820)
Q Consensus       479 dls~v~fi~tan~~~-i~~~l~-----drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Y  552 (820)
                         .|+.|.+-|--+ +.++||     ||==.+.+|+-+..|+       ++-.+++...+..   .|+-.-|.++--.|
T Consensus       329 ---~VlVIgATnRPDslDpaLRRaGRFdrEI~l~vP~e~aR~~-------IL~~~~~~lrl~g---~~d~~qlA~lTPGf  395 (802)
T KOG0733         329 ---PVLVIGATNRPDSLDPALRRAGRFDREICLGVPSETAREE-------ILRIICRGLRLSG---DFDFKQLAKLTPGF  395 (802)
T ss_pred             ---CEEEEECCCCCCCCCHHHHCCCCCCCEEEECCCCHHHHHH-------HHHHHHHHCCCCC---CCCHHHHHHCCCCC
T ss_conf             ---7699824789765587773256553235306896688999-------9999986277787---76899997518875


Q ss_pred             --------CCCCHHHHHHHHH
Q ss_conf             --------7410234788879
Q gi|254780270|r  553 --------THEAGVRSFERAL  565 (820)
Q Consensus       553 --------t~EaGvR~l~r~i  565 (820)
                              ++|||.--++|.+
T Consensus       396 VGADL~AL~~~Aa~vAikR~l  416 (802)
T KOG0733         396 VGADLMALCREAAFVAIKRIL  416 (802)
T ss_pred             CCHHHHHHHHHHHHHHHHHHH
T ss_conf             214199999999999999986


No 66 
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones]
Probab=99.26  E-value=2.6e-09  Score=89.38  Aligned_cols=169  Identities=24%  Similarity=0.326  Sum_probs=114.3

Q ss_pred             HHHHHHCCCCCEEEEEECHHHHHHHC-CC--CHHH-----HHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCC----
Q ss_conf             99998327887399993315542311-77--1155-----665540600168133201035236442799993486----
Q gi|254780270|r  424 IQSLKRAKRSNPLLLLDEIDKMGSDL-RG--DPSA-----ALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANT----  491 (820)
Q Consensus       424 i~~l~~~~~~npv~~ldeidk~~~~~-~g--dp~~-----allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~----  491 (820)
                      .|.-..+-..|.++++|||||+.... .|  |++-     -||-+..-   .+..-+|=-+  .-.++|||++---    
T Consensus       241 ~~eAi~~aE~~GIvFIDEIDKIa~~~~~g~~dvSREGVQRDlLPlvEG---stV~TKyG~V--kTdHILFIasGAFh~sK  315 (444)
T COG1220         241 KQEAIDAAEQNGIVFIDEIDKIAKRGGSGGPDVSREGVQRDLLPLVEG---STVSTKYGPV--KTDHILFIASGAFHVAK  315 (444)
T ss_pred             HHHHHHHHHHCCEEEEEHHHHHHHCCCCCCCCCCHHHHCCCCCCCCCC---CEEECCCCCC--CCCEEEEEECCCEECCC
T ss_conf             999999988569089734667874378899886643201021031057---5443154440--14437887148200378


Q ss_pred             -CC-CCHHHCCCEEE-EEECCCCHHHHHHHHH---HHHHHHHHHHHCCCCCCCCCCHHHHHHHHHC------CCCCCHHH
Q ss_conf             -55-44131172479-9825878689998999---8608989986257813132289999999731------77410234
Q gi|254780270|r  492 -LN-IPLPLMDRMEI-IRIAGYTEEEKLQIAK---NHLVKKVLTEHALKQEECCISDGVLLDIIRL------FTHEAGVR  559 (820)
Q Consensus       492 -~~-i~~~l~drme~-i~~~~y~~~ek~~i~~---~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~------Yt~EaGvR  559 (820)
                       .+ ||. |--|+-+ +++.+.|.++=..|-.   +-|+.+-..-..-..-.+.|++++|..|.+-      -|---|-|
T Consensus       316 PSDLiPE-LQGRfPIRVEL~~Lt~~Df~rILtep~~sLikQY~aLlkTE~v~l~FtddaI~~iAeiA~~vN~~~ENIGAR  394 (444)
T COG1220         316 PSDLIPE-LQGRFPIRVELDALTKEDFERILTEPKASLIKQYKALLKTEGVELEFTDDAIKRIAEIAYQVNEKTENIGAR  394 (444)
T ss_pred             HHHCCHH-HCCCCCEEEECCCCCHHHHHHHHCCCHHHHHHHHHHHHHHCCEEEEECHHHHHHHHHHHHHHCCCCCCHHHH
T ss_conf             1321766-627773488704489989999963760789999999973158348853799999999999855430001178


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHCCC
Q ss_conf             788879999898765421178520127967867530520
Q gi|254780270|r  560 SFERALMKIARKAVTKIVKNSDTTVSINENNLQDYLGVP  598 (820)
Q Consensus       560 ~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~lg~~  598 (820)
                      -|.-.+.++.-.+..+--+-....++|+.+-+.+-||.-
T Consensus       395 RLhTvlErlLediSFeA~d~~g~~v~Id~~yV~~~l~~l  433 (444)
T COG1220         395 RLHTVLERLLEDISFEAPDMSGQKVTIDAEYVEEKLGDL  433 (444)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCEEEECHHHHHHHHHHH
T ss_conf             899999999987070587789975897589999999877


No 67 
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]
Probab=99.25  E-value=1.5e-10  Score=98.76  Aligned_cols=259  Identities=22%  Similarity=0.305  Sum_probs=168.9

Q ss_pred             HHHHHHHHHHHHHCHHHHHHHHHHHHHHHH----HC-CC-------CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEE
Q ss_conf             688998776652011689999999999998----42-44-------4673599860565650279999997708824998
Q gi|254780270|r  330 LDFAIRILDQDHFGLEKVKERIIEYLAVQM----RV-IK-------NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRM  397 (820)
Q Consensus       330 l~~a~~iLd~~hyGl~~vK~rile~lav~~----~~-~~-------~~g~il~l~gppgvGKts~~~sia~al~r~f~~i  397 (820)
                      -+..++.||+-.-|-+.+|.-+-  .||..    ++ ..       .|+ =++|+||-|.|||-||+..|+.|+-||.  
T Consensus        52 P~eik~~Ld~YVIGQe~AKKvLs--VAVYNHYKRl~~~~~~~dvEL~KS-NILLiGPTGsGKTlLAqTLAk~LnVPFa--  126 (408)
T COG1219          52 PKEIKAHLDEYVIGQEQAKKVLS--VAVYNHYKRLNNKEDNDDVELSKS-NILLIGPTGSGKTLLAQTLAKILNVPFA--  126 (408)
T ss_pred             HHHHHHHHHHHEECCHHHHCEEE--EEEEHHHHHHHCCCCCCCEEEEEC-CEEEECCCCCCHHHHHHHHHHHHCCCEE--
T ss_conf             69999986524326254310346--641068899860488776353203-1799888997577999999998489847--


Q ss_pred             ECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCC------CCEEEEEECHHHHHHHC-C----CCH-----HHHHHHHC
Q ss_conf             61888888883563200145671289999983278------87399993315542311-7----711-----55665540
Q gi|254780270|r  398 SLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKR------SNPLLLLDEIDKMGSDL-R----GDP-----SAALLEVL  461 (820)
Q Consensus       398 slgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~------~npv~~ldeidk~~~~~-~----gdp-----~~allevl  461 (820)
                          +.|..-+.-  --|||-----|++-|..+--      -..+|++|||||++.-. +    -|.     .-|||.++
T Consensus       127 ----iADATtLTE--AGYVGEDVENillkLlqaadydV~rAerGIIyIDEIDKIarkSen~SITRDVSGEGVQQALLKii  200 (408)
T COG1219         127 ----IADATTLTE--AGYVGEDVENILLKLLQAADYDVERAERGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKII  200 (408)
T ss_pred             ----ECCCCCHHH--CCCCCHHHHHHHHHHHHHCCCCHHHHHCCEEEEECHHHHHCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             ----514441210--66355008999999998764588888288599851025420578987234367358999999997


Q ss_pred             C------CCCCCCEEEEECCCCCCCCCEEEEEECCCCCCCHH--------------------------------------
Q ss_conf             6------00168133201035236442799993486554413--------------------------------------
Q gi|254780270|r  462 D------PAQNSSFVDHYLEVEYDLSDVMFIMTANTLNIPLP--------------------------------------  497 (820)
Q Consensus       462 d------p~qn~~f~d~y~~~~~dls~v~fi~tan~~~i~~~--------------------------------------  497 (820)
                      .      |-|--.=+.|-==+.+|-|++||||----..+...                                      
T Consensus       201 EGTvasVPPqGGRKHP~Qe~iqvDT~NILFIcgGAF~GlekiI~~R~~~~~iGF~a~~~~~~~~~~~~~~l~~vepeDLv  280 (408)
T COG1219         201 EGTVASVPPQGGRKHPQQEFIQVDTSNILFICGGAFAGLEKIIKKRLGKKGIGFGAEVKSKSKKKEEGELLKQVEPEDLV  280 (408)
T ss_pred             CCCEECCCCCCCCCCCCCCEEEECCCCEEEEECCCCCCHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHCCHHHHH
T ss_conf             07510239998887984204887376346782440103999999862687424566445344441288998754868788


Q ss_pred             -------HCCCEEEEE-ECCCCHHHHHHHH---HHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHC-CCCCCHHHHHHHHH
Q ss_conf             -------117247998-2587868999899---98608989986257813132289999999731-77410234788879
Q gi|254780270|r  498 -------LMDRMEIIR-IAGYTEEEKLQIA---KNHLVKKVLTEHALKQEECCISDGVLLDIIRL-FTHEAGVRSFERAL  565 (820)
Q Consensus       498 -------l~drme~i~-~~~y~~~ek~~i~---~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~-Yt~EaGvR~l~r~i  565 (820)
                             +.-|+-||- +...+.+.-++|-   +|-|+.+-.+-..+..-.+.|+++|+..|.+. ..|-.|-|.|.-.+
T Consensus       281 kFGLIPEfIGRlPvia~L~~Lde~aLv~ILtePkNAlvKQYq~Lf~~d~V~L~F~~~AL~~IA~~A~~rkTGARGLRsI~  360 (408)
T COG1219         281 KFGLIPEFIGRLPVIATLEELDEDALVQILTEPKNALVKQYQKLFEMDGVELEFTEEALKAIAKKAIERKTGARGLRSII  360 (408)
T ss_pred             HCCCCHHHHCCCCEEEEHHHCCHHHHHHHHHCCCHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHCCCHHHHHHHH
T ss_conf             70883887266632646101599999999726517899999999644691699748999999999998433535799999


Q ss_pred             HHHHHHHHHHHHCCC-CCEECCCHHHHHHHHCCCC
Q ss_conf             999898765421178-5201279678675305200
Q gi|254780270|r  566 MKIARKAVTKIVKNS-DTTVSINENNLQDYLGVPR  599 (820)
Q Consensus       566 ~~i~r~~~~~~~~~~-~~~~~i~~~~l~~~lg~~~  599 (820)
                      +.++..+-.++-..+ -..+.|+.+.+.....+..
T Consensus       361 E~~lld~MfelPs~~~v~~v~I~~~~v~~~~~p~l  395 (408)
T COG1219         361 EELLLDVMFELPSLEDVEKVVITEEVVDGNAEPLL  395 (408)
T ss_pred             HHHHHHHHHHCCCCCCCEEEEEEHHHHCCCCCCEE
T ss_conf             99999988527886785089976888478888727


No 68 
>KOG0745 consensus
Probab=99.25  E-value=6.4e-10  Score=93.94  Aligned_cols=216  Identities=22%  Similarity=0.351  Sum_probs=132.4

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHC------CCCCEEEEEECH
Q ss_conf             99860565650279999997708824998618888888835632001456712899999832------788739999331
Q gi|254780270|r  369 LCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRA------KRSNPLLLLDEI  442 (820)
Q Consensus       369 l~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~------~~~npv~~ldei  442 (820)
                      +.|+||-|.|||-||+.+|+.|+-||+--..--+.        .--|||-----+|+.|-..      ++--.+++|||+
T Consensus       229 vLllGPtGsGKTllaqTLAr~ldVPfaIcDcTtLT--------QAGYVGeDVEsvi~KLl~~A~~nVekAQqGIVflDEv  300 (564)
T KOG0745         229 VLLLGPTGSGKTLLAQTLARVLDVPFAICDCTTLT--------QAGYVGEDVESVIQKLLQEAEYNVEKAQQGIVFLDEV  300 (564)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEECCCCHH--------HCCCCCCCHHHHHHHHHHHCCCCHHHHHCCEEEEEHH
T ss_conf             79977888764389999999708876873255220--------0553454299999999997257899882673887601


Q ss_pred             HHHHHHCCC-----CH-----HHHHHHHC------CCCCCCCEEEEECCCCCCCCCEEEEEECCCCCCCHHHCCCEEE--
Q ss_conf             554231177-----11-----55665540------6001681332010352364427999934865544131172479--
Q gi|254780270|r  443 DKMGSDLRG-----DP-----SAALLEVL------DPAQNSSFVDHYLEVEYDLSDVMFIMTANTLNIPLPLMDRMEI--  504 (820)
Q Consensus       443 dk~~~~~~g-----dp-----~~allevl------dp~qn~~f~d~y~~~~~dls~v~fi~tan~~~i~~~l~drme~--  504 (820)
                      |||+....|     |.     .-|||.+|      =|+-|..-.-.==.|.+|-+++||||+--..++....-.||+-  
T Consensus       301 DKi~~~~~~i~~~RDVsGEGVQQaLLKllEGtvVnVpeK~~~~~~rgd~vqiDTtnILFiasGAF~~Ldk~I~rR~~d~s  380 (564)
T KOG0745         301 DKITKKAESIHTSRDVSGEGVQQALLKLLEGTVVNVPEKGSRRKPRGDTVQIDTTNILFIASGAFVGLDKIISRRLDDKS  380 (564)
T ss_pred             HHHCCCCCCCCCCCCCCCHHHHHHHHHHHCCCEECCCCCCCCCCCCCCEEEEECCCEEEEECCCCCCHHHHHHHHHCCHH
T ss_conf             24413676545444566266999999985262770267787778999858971366688803432356989887630000


Q ss_pred             -------------------------------------------------------E-EECCCCHHHHHHHH---HHHHHH
Q ss_conf             -------------------------------------------------------9-82587868999899---986089
Q gi|254780270|r  505 -------------------------------------------------------I-RIAGYTEEEKLQIA---KNHLVK  525 (820)
Q Consensus       505 -------------------------------------------------------i-~~~~y~~~ek~~i~---~~~l~p  525 (820)
                                                                             | -+.+.+...=++|-   ++-|+|
T Consensus       381 lGFg~~s~~~vr~~~~~~s~~~~~~~~~~~lL~~~~~~DLisfGmIPEfVGRfPVlVplh~L~~~~Lv~VLtEPknaL~~  460 (564)
T KOG0745         381 LGFGAPSSKGVRANMATKSGVENDAEKRDELLEKVESGDLISFGMIPEFVGRFPVLVPLHSLDEDQLVRVLTEPKNALGK  460 (564)
T ss_pred             CCCCCCCCCCCHHHCCCCCCCCHHHHHHHHHHHHCCCCCHHHHCCCHHHHCCCCEEEECCCCCHHHHHHHHHCCHHHHHH
T ss_conf             15678887420011034667304677889998634632135526728771665257652426888899987355466899


Q ss_pred             HHHHHHCCCCCCCCCCHHHHHHHHHCC-CCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHH
Q ss_conf             899862578131322899999997317-7410234788879999898765421178520127967867
Q gi|254780270|r  526 KVLTEHALKQEECCISDGVLLDIIRLF-THEAGVRSFERALMKIARKAVTKIVKNSDTTVSINENNLQ  592 (820)
Q Consensus       526 ~~~~~~~~~~~~~~~~~~~i~~ii~~Y-t~EaGvR~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~  592 (820)
                      +--+-.++..-++.|+.+|++.|.+.- .|-.|-|.|.-.++++.-.+..++-...-..+.|+.+.+.
T Consensus       461 Qyk~lf~~~nV~L~fTe~Al~~IAq~Al~r~TGARgLRsIlE~~LleamfevPGSdI~~V~Vdee~v~  528 (564)
T KOG0745         461 QYKKLFGMDNVELHFTEKALEAIAQLALKRKTGARGLRSILESLLLEAMFEVPGSDIKAVLVDEEAVK  528 (564)
T ss_pred             HHHHHHCCCCEEEEECHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEECHHHHC
T ss_conf             99998555774698669999999999876143467899999999764014578875479996178845


No 69 
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]
Probab=99.24  E-value=1.9e-10  Score=97.98  Aligned_cols=219  Identities=25%  Similarity=0.376  Sum_probs=141.5

Q ss_pred             HHHHHCHHHHHHHHHHHHHHHHHCCCC-------CCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCC
Q ss_conf             665201168999999999999842444-------6735998605656502799999977088249986188888888356
Q gi|254780270|r  338 DQDHFGLEKVKERIIEYLAVQMRVIKN-------KGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRG  410 (820)
Q Consensus       338 d~~hyGl~~vK~rile~lav~~~~~~~-------~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~g  410 (820)
                      =+|.=||++-.+.|-|-+-.--.+|..       ...-.+|+||||||||-|||.+|...+-.|.|++      .||+- 
T Consensus       150 Y~dIGGL~~Qi~EirE~VELPL~~PElF~~~GI~PPKGVLLYGPPGTGKTLLAkAVA~~T~AtFIrvv------gSElV-  222 (406)
T COG1222         150 YEDIGGLDEQIQEIREVVELPLKNPELFEELGIDPPKGVLLYGPPGTGKTLLAKAVANQTDATFIRVV------GSELV-  222 (406)
T ss_pred             HHHCCCHHHHHHHHHHHHCCCCCCHHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHHCCCCEEEEEC------CHHHH-
T ss_conf             65335889999999998403366888999749999971276689997588999998720586699942------19999-


Q ss_pred             CCCCCCCCCCHHHHHHHHHCCCCCE-EEEEECHHHHHHH-C----CCCH--HHHHHHHCCCCCCCCEEEEECCCCCCCCC
Q ss_conf             3200145671289999983278873-9999331554231-1----7711--55665540600168133201035236442
Q gi|254780270|r  411 HRRTYIGSMPGRIIQSLKRAKRSNP-LLLLDEIDKMGSD-L----RGDP--SAALLEVLDPAQNSSFVDHYLEVEYDLSD  482 (820)
Q Consensus       411 h~~ty~ga~pg~ii~~l~~~~~~np-v~~ldeidk~~~~-~----~gdp--~~allevldp~qn~~f~d~y~~~~~dls~  482 (820)
                        .-|+|--+-.+=+...-|+..-| +|++||||-+++. +    -||-  .-.|||+|.  |=..|-.        ..+
T Consensus       223 --qKYiGEGaRlVRelF~lArekaPsIIFiDEIDAIg~kR~d~~t~gDrEVQRTmleLL~--qlDGFD~--------~~n  290 (406)
T COG1222         223 --QKYIGEGARLVRELFELAREKAPSIIFIDEIDAIGAKRFDSGTSGDREVQRTMLELLN--QLDGFDP--------RGN  290 (406)
T ss_pred             --HHHHCCCHHHHHHHHHHHHHCCCEEEEEECHHHHHCCCCCCCCCCHHHHHHHHHHHHH--HCCCCCC--------CCC
T ss_conf             --9983411699999999874149849998311223111136888850999999999998--6058897--------887


Q ss_pred             EEEEEECCCCC-CCHHH-----CCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCC
Q ss_conf             79999348655-44131-----1724799825878689998999860898998625781313228999999973177410
Q gi|254780270|r  483 VMFIMTANTLN-IPLPL-----MDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEA  556 (820)
Q Consensus       483 v~fi~tan~~~-i~~~l-----~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~Ea  556 (820)
                      |=.|+--|-.+ .+++|     +||.  |++|--..+-+.+|.+-|-     .++.+.+ ++.|     +.++..-.--+
T Consensus       291 vKVI~ATNR~D~LDPALLRPGR~DRk--IEfplPd~~gR~~Il~IHt-----rkM~l~~-dvd~-----e~la~~~~g~s  357 (406)
T COG1222         291 VKVIMATNRPDILDPALLRPGRFDRK--IEFPLPDEEGRAEILKIHT-----RKMNLAD-DVDL-----ELLARLTEGFS  357 (406)
T ss_pred             EEEEEECCCCCCCCHHHCCCCCCCCE--EECCCCCHHHHHHHHHHHH-----HHCCCCC-CCCH-----HHHHHHCCCCC
T ss_conf             68998558855557665088754530--1168989789999999876-----2146766-7699-----99987538995


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHH
Q ss_conf             234788879999898765421178520127967867530
Q gi|254780270|r  557 GVRSFERALMKIARKAVTKIVKNSDTTVSINENNLQDYL  595 (820)
Q Consensus       557 GvR~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~l  595 (820)
                      |     -.|.+||-.+..--+....  ..||.++..+..
T Consensus       358 G-----AdlkaictEAGm~AiR~~R--~~Vt~~DF~~Av  389 (406)
T COG1222         358 G-----ADLKAICTEAGMFAIRERR--DEVTMEDFLKAV  389 (406)
T ss_pred             H-----HHHHHHHHHHHHHHHHHCC--CEECHHHHHHHH
T ss_conf             6-----7799999987599998604--733399999999


No 70 
>KOG1051 consensus
Probab=99.24  E-value=4.2e-09  Score=87.75  Aligned_cols=164  Identities=26%  Similarity=0.451  Sum_probs=120.9

Q ss_pred             CCCCCCCC-CCCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCC-CC---CCCEEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             04158766-32210688998776652011689999999999998424-44---673599860565650279999997708
Q gi|254780270|r  317 GVPWDKKS-KTKKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRVI-KN---KGLILCFVGPPGVGKTSLAQSIAKATG  391 (820)
Q Consensus       317 ~lPW~~~t-~~~~dl~~a~~iLd~~hyGl~~vK~rile~lav~~~~~-~~---~g~il~l~gppgvGKts~~~sia~al~  391 (820)
                      .+|-...+ .+...+..-++.|.+..-|-+++=.-|-+-  ++.-.. ..   ..--+.|.||-|||||-+||..|+-+=
T Consensus       539 gip~~~~~~~e~~~l~~L~~~L~~~V~gQ~eAv~aIa~A--I~~sr~gl~~~~~~awflflGpdgvGKt~lAkaLA~~~F  616 (898)
T KOG1051         539 GIPVDRLAEAEAERLKKLEERLHERVIGQDEAVAAIAAA--IRRSRAGLKDPNPDAWFLFLGPDGVGKTELAKALAEYVF  616 (898)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHH--HHHCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHC
T ss_conf             782144316678999999999975446637789999999--984320357888885899978884138999999999972


Q ss_pred             ---CCEEEEECCCCCCHHHHCCCCCCCCCCCCH-HHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCC
Q ss_conf             ---824998618888888835632001456712-8999998327887399993315542311771155665540600168
Q gi|254780270|r  392 ---RQYVRMSLGGVYDEADIRGHRRTYIGSMPG-RIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNS  467 (820)
Q Consensus       392 ---r~f~~islgg~~d~~~i~gh~~ty~ga~pg-~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~  467 (820)
                         --|+||.|+--...+..-|----|+|..-| ++-.++++  ..+.|||||||||.-.    |-..-||.++|-   -
T Consensus       617 gse~~~IriDmse~~evskligsp~gyvG~e~gg~Lteavrr--rP~sVvLfdeIEkAh~----~v~n~llq~lD~---G  687 (898)
T KOG1051         617 GSEENFIRLDMSEFQEVSKLIGSPPGYVGKEEGGQLTEAVKR--RPYSVVLFEEIEKAHP----DVLNILLQLLDR---G  687 (898)
T ss_pred             CCCCCEEEECHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHC--CCCEEEEEECHHHCCH----HHHHHHHHHHHC---C
T ss_conf             886426896145555565304899555463057788899716--9965999830222288----899999999862---7


Q ss_pred             CEEEEECCCCCCCCCEEEEEECCCC
Q ss_conf             1332010352364427999934865
Q gi|254780270|r  468 SFVDHYLEVEYDLSDVMFIMTANTL  492 (820)
Q Consensus       468 ~f~d~y~~~~~dls~v~fi~tan~~  492 (820)
                      .++|-+ +-.+|+.+++||.|.|.-
T Consensus       688 rltDs~-Gr~Vd~kN~I~IMTsn~~  711 (898)
T KOG1051         688 RLTDSH-GREVDFKNAIFIMTSNVG  711 (898)
T ss_pred             CCCCCC-CCEEECCCEEEEEECCCC
T ss_conf             400588-867504645999942631


No 71 
>COG4930 Predicted ATP-dependent Lon-type protease [Posttranslational modification, protein turnover, chaperones]
Probab=99.23  E-value=1.4e-10  Score=98.95  Aligned_cols=196  Identities=25%  Similarity=0.416  Sum_probs=151.7

Q ss_pred             CCHHHHHHHH-CCCCC-CCCCHH-CCCCCCCCCEEEECCCC-CEEEEEEEEEECCCCCEEECCCH-HHHHHHHHHHHHHH
Q ss_conf             7967867530-52000-332000-22336500000000016-80799999997489972443256-89999999999999
Q gi|254780270|r  586 INENNLQDYL-GVPRY-KYGKIE-GEDQVGIVTGLAWTEVG-GEILTVEGVIMPGKGEITITGNL-KEIMKESILAASSY  660 (820)
Q Consensus       586 i~~~~l~~~l-g~~~~-~~~~~~-~~~~~G~v~GLa~t~~G-G~~l~IE~~~~~g~g~l~lTG~l-g~vmkES~~~A~s~  660 (820)
                      |..++|+++. ..|-- -.+.++ .-++||+|.-.+.+..| -++-..|+..+.|+|+-...|.= ..-.|||+.++..|
T Consensus       475 idne~l~e~fvsvpe~gg~~lipag~~kpg~~~~v~~~~~g~~glyrfe~q~~ag~gk~~~sg~gs~t~~keair~~f~y  554 (683)
T COG4930         475 IDNETLEEFFVSVPEQGGSELIPAGMPKPGVVHLVTQAESGMTGLYRFETQMTAGNGKHSVSGLGSSTSAKEAIRVGFDY  554 (683)
T ss_pred             ECCCCHHHHHEECCCCCCCEECCCCCCCCCEEEEEEECCCCCEEEEEEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             41621787836173358862067899998638887410357413588888985058733346678772078899988888


Q ss_pred             HHHHHHHCCCCHHHHHHCCCEEECCCCCCCCCCCCHHHHH--HHHHHHHHHCCCCCCCCEEEEEEEECCEEEEECCHHHH
Q ss_conf             9998886299855742078147448888478887306899--99999998368887561066368503025000656899
Q gi|254780270|r  661 VRSKATTFGIIPSAFNEINIHVHVPEGATPKDGPSAGIAM--ATAIVSIMTCIPVYKNVAMTGELTLRGRVLPIGGLKEK  738 (820)
Q Consensus       661 ~k~~~~~~~~~~~~~~~~diHih~p~Ga~pKDGPSAGi~i--~tal~S~~~~~~v~~~iAmTGEitl~G~VlpiGGi~eK  738 (820)
                      -|+++.+..-.. .|+..+-|+|+-+=-  --|||.-.++  ..||-|.+..+||....+.-|.+||-|-|-|+-.+-.-
T Consensus       555 fk~n~~~vs~t~-~~~e~~y~lhv~~l~--~~g~s~~~sl~a~ialcs~~l~k~~qeq~~vlgsmtlgg~i~~~~~la~~  631 (683)
T COG4930         555 FKGNLSRVSATA-KFSEHEYHLHVVELH--NTGPSTATSLAALIALCSVLLAKPVQEQMVVLGSMTLGGVINPVQDLAAS  631 (683)
T ss_pred             HHCCHHHHHCEE-EECCCEEEEEEEEEC--CCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHEEEECCCCCCHHHHHHHH
T ss_conf             503155400015-203210267765300--67840466699999998998602077656331001305404168888999


Q ss_pred             HHHHHHCCCCEEECCHHHHHHHHHCCHHHHCCCEEEECC-CHHHHHH
Q ss_conf             999997099699803677550776148877097999819-3999888
Q gi|254780270|r  739 LLAALRAGVTKVLIPEENIKDLMDIPENVKNGLEIIPVS-FMGEVLK  784 (820)
Q Consensus       739 ~laA~raGi~~viiP~~N~~d~~~ip~~~~~~l~~~~v~-~~~evl~  784 (820)
                      +--|..+|-|+|++|-....|+.-+|.+.-.+..+-|-+ -++-|++
T Consensus       632 lq~~~dsgakkv~lp~ssa~~i~tvp~~lftkfqvsfy~~pvdavyk  678 (683)
T COG4930         632 LQLAFDSGAKKVLLPMSSAVDIPTVPAELFTKFQVSFYSEPVDAVYK  678 (683)
T ss_pred             HHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHEEEEECCCHHHHHH
T ss_conf             99988458755887633457767789799624146433482889998


No 72 
>CHL00081 chlI Mg-protoporyphyrin IX chelatase
Probab=99.21  E-value=4e-09  Score=87.94  Aligned_cols=229  Identities=16%  Similarity=0.228  Sum_probs=141.9

Q ss_pred             HHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH-------C----------------------
Q ss_conf             20116899999999999984244467359986056565027999999770-------8----------------------
Q gi|254780270|r  341 HFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKAT-------G----------------------  391 (820)
Q Consensus       341 hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al-------~----------------------  391 (820)
                      .-|.+.+|..++    ....++...|  +++.|+||+|||++++++|..|       |                      
T Consensus        14 IvGQe~~k~aLl----l~av~p~iGg--VLi~G~~GtgKStlvRala~lLP~i~~v~~~~f~~~p~~p~~~~~~~~~~~~   87 (347)
T CHL00081         14 IVGQEEMKLALL----LNVIDPKIGG--VMIMGDRGTGKSTTIRALVDLLPEIEVVKNDPFNSDPRDPDLMSDEVRERIR   87 (347)
T ss_pred             HCCHHHHHHHHH----HHHCCCCCCE--EEEECCCCCCHHHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCHHHHHHHC
T ss_conf             538499999999----9825788786--9987899874999999999857874220688767898981002426665431


Q ss_pred             -----------CCEEEEECCCCCC--------HHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCC
Q ss_conf             -----------8249986188888--------888356320014567128999998327887399993315542311771
Q gi|254780270|r  392 -----------RQYVRMSLGGVYD--------EADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGD  452 (820)
Q Consensus       392 -----------r~f~~islgg~~d--------~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gd  452 (820)
                                 .||+-++||-..|        ++-++..++.   -.||-+-      .....|+|+|||--+...    
T Consensus        88 ~~~~~~~~~~~~p~v~lPlgaTEDrv~GslDie~al~~G~~~---f~pGlLa------~A~rGiLyvDEINll~d~----  154 (347)
T CHL00081         88 NGEKIPTKKIKIPMVDLPLGATEDRVCGTIDIEKALTEGVKA---FEPGLLA------KANRGILYVDEVNLLDDH----  154 (347)
T ss_pred             CCCCCCCEECCCCEEECCCCCCCCEECCCHHHHHHHHCCCCC---CCCCHHH------HCCCCEEEEEHHHHHHHH----
T ss_conf             466675211468625368888523011400099898458711---5653122------203885886145432379----


Q ss_pred             HHHHHHHHCCCCCCCCEEEEEC-CCCCCCCCEEEEEECCCC--CCCHHHCCCEE-EEEECC-CCHHHHHHHHHHHHH---
Q ss_conf             1556655406001681332010-352364427999934865--54413117247-998258-786899989998608---
Q gi|254780270|r  453 PSAALLEVLDPAQNSSFVDHYL-EVEYDLSDVMFIMTANTL--NIPLPLMDRME-IIRIAG-YTEEEKLQIAKNHLV---  524 (820)
Q Consensus       453 p~~allevldp~qn~~f~d~y~-~~~~dls~v~fi~tan~~--~i~~~l~drme-~i~~~~-y~~~ek~~i~~~~l~---  524 (820)
                      -.++||++..--||.-=+|-+= ..|   ++.+.|+|.|-.  +.++.|+||+- .+.+.+ ...+|.++|.++.+-   
T Consensus       155 ~v~~LLda~a~G~~~VEReG~S~~~P---a~F~liaT~NPeEgeLrp~llDRF~l~v~v~~~~~~e~R~eiv~~r~~f~~  231 (347)
T CHL00081        155 LVDILLDSAASGWNTVEREGISIRHP---ARFVLIGSGNPEEGELRPQLLDRFGMHAEIRTVKDPELRVKIVEQRSNFDK  231 (347)
T ss_pred             HHHHHHHHHHCCEEEECCCCEEECCC---CCEEEEECCCCCCCCCCHHHHHHEEEEEECCCCCCHHHHHHHHHHHHHHHH
T ss_conf             99999999855808980464233057---500688557865567488888263226745887898999999999997651


Q ss_pred             ----------------HHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCH
Q ss_conf             ----------------9899862578131322899999997317741023478887999989876542117852012796
Q gi|254780270|r  525 ----------------KKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDTTVSINE  588 (820)
Q Consensus       525 ----------------p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~~~~~~~i~~  588 (820)
                                      ..++...--.-.++.++++.+.++++-+ .+.||-.+.-.|..+--..|.-.+.+.+   .++.
T Consensus       232 ~p~~f~~~~~~~~~~l~~~I~~Ar~~L~~V~v~~~~~~~i~~~~-~~~~v~g~RA~I~l~raARA~AAL~GR~---~V~~  307 (347)
T CHL00081        232 NPENFREKYSESQDALKTQIILARQLLPNVEIDYDLRVKISQIC-SELDVDGLRGDIVTNRAAKALAAFNGRD---EVTP  307 (347)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHH-HHHCCCCCCHHHHHHHHHHHHHHHCCCC---CCCH
T ss_conf             96999999887899999999999864477355999999999999-9848998718999999999999986998---3689


Q ss_pred             HHHHHHH
Q ss_conf             7867530
Q gi|254780270|r  589 NNLQDYL  595 (820)
Q Consensus       589 ~~l~~~l  595 (820)
                      +++....
T Consensus       308 eDv~~aa  314 (347)
T CHL00081        308 GDIEKVI  314 (347)
T ss_pred             HHHHHHH
T ss_conf             9999999


No 73 
>TIGR00635 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR004605 All proteins in this family for which functions are known are 5'-3' DNA helicases that, as part of a complex with RuvA homologs serve as a 5'-3' Holliday junction helicase. RuvA specifically binds Holliday junctions as a sandwich of two tetramers and maintains the configuration of the junction. It forms a complex with two hexameric rings of RuvB, the subunit that contains helicase activity. The complex drives ATP-dependent branch migration of the Holliday junction recombination intermediate. The endonuclease RuvC resolves junctions.; GO: 0003677 DNA binding, 0005524 ATP binding, 0009378 Holliday junction helicase activity, 0006281 DNA repair, 0006310 DNA recombination.
Probab=99.19  E-value=1.9e-10  Score=97.87  Aligned_cols=178  Identities=29%  Similarity=0.383  Sum_probs=127.2

Q ss_pred             HHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCC
Q ss_conf             52011689999999999998424446735998605656502799999977088249986188888888356320014567
Q gi|254780270|r  340 DHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSM  419 (820)
Q Consensus       340 ~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~  419 (820)
                      |-=|-++||+++==||-=-|.++.+=. .+.|.||||.||||||.-||+=||-...-.|=+-+.=               
T Consensus         5 eFiGQ~~vk~~L~l~I~AAk~R~e~LD-H~LL~GPPGLGKTTLA~IiA~Emg~~l~iTsGP~L~k---------------   68 (305)
T TIGR00635         5 EFIGQEKVKEQLQLFIEAAKMRQEALD-HLLLYGPPGLGKTTLAHIIANEMGVNLKITSGPALEK---------------   68 (305)
T ss_pred             HCCCCHHHHHHHHHHHHHHHHCCCCCC-CEEEECCCCCCHHHHHHHHHHHHCCCCEEEECCCCCC---------------
T ss_conf             105828899999999999982489734-1663175687467899999998389326740675547---------------


Q ss_pred             CHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECC-------CCCCCCCEEEE-EECCC
Q ss_conf             12899999832788739999331554231177115566554060016813320103-------52364427999-93486
Q gi|254780270|r  420 PGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLE-------VEYDLSDVMFI-MTANT  491 (820)
Q Consensus       420 pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~-------~~~dls~v~fi-~tan~  491 (820)
                      ||-+.-.|-.-.- --|+++|||--++..        -=|+|=|.--+==.|=-++       |..||-..-.| ||--.
T Consensus        69 PgDlaaiLt~L~~-gDVLFIDEIHRL~p~--------~EE~LYpAMEDF~lDi~IG~Gp~Ar~v~ldLpPFTLvGATTR~  139 (305)
T TIGR00635        69 PGDLAAILTNLEE-GDVLFIDEIHRLSPA--------IEELLYPAMEDFRLDIVIGKGPSARSVRLDLPPFTLVGATTRA  139 (305)
T ss_pred             HHHHHHHHHHCCC-CCEEECCHHHHCCHH--------HHHHCCCCCCCEEEEEEEECCCCCCEEEECCCCCCCCCCCCCC
T ss_conf             5789999970568-963101256504833--------4531053001217877871289852576068694420000347


Q ss_pred             CCCCHHHCCCEEEEE-ECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCC
Q ss_conf             554413117247998-2587868999899986089899862578131322899999997317
Q gi|254780270|r  492 LNIPLPLMDRMEIIR-IAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLF  552 (820)
Q Consensus       492 ~~i~~~l~drme~i~-~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Y  552 (820)
                      =-+..||+||.=+|. +.=||.+|=..|.+++-          .--++.+++++...|-+.-
T Consensus       140 G~lt~PLrdRFG~~~rl~fY~~~EL~~Iv~R~A----------~~L~~ei~~~~a~~IArrS  191 (305)
T TIGR00635       140 GMLTSPLRDRFGIILRLEFYTPEELAEIVSRSA----------GLLNIEIEQEAALEIARRS  191 (305)
T ss_pred             CCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHH----------HHCCCCCCHHHHHHHHHHC
T ss_conf             741031334544745402689878999987533----------4414300778999998754


No 74 
>TIGR01241 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: IPR005936   Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site . The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases .   Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins.   Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule.    This group of metallopeptidases belong to MEROPS peptidase family M41 (FtsH endopeptidase family, clan MA(E)). The predicted active site residues for members of this family and thermolysin, the type example for clan MA, occur in the motif HEXXH.    FtsH is a membrane-anchored ATP-dependent protease that degrades misfolded or misassembled membrane proteins as well as a subset of cytoplasmic regulatory proteins. FtsH is a 647-residue protein of 70 kDa, with two putative transmembrane segments towards its N terminus which anchor the protein to the membrane, giving rise to a periplasmic domain of 70 residues and a cytoplasmic segment of 520 residues containing the ATPase and protease domains . ; GO: 0004222 metalloendopeptidase activity, 0030163 protein catabolic process, 0016020 membrane.
Probab=99.17  E-value=2.3e-11  Score=104.84  Aligned_cols=285  Identities=24%  Similarity=0.408  Sum_probs=167.5

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHHCC----CCCCCE---EEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCC
Q ss_conf             652011689999999999998424----446735---9986056565027999999770882499861888888883563
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQMRVI----KNKGLI---LCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGH  411 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~~~~~----~~~g~i---l~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh  411 (820)
                      +|.=|.|++||-+.|..--.| +|    +.-|.|   .+||||||||||-|||.||===+.||.+||  | +|==|    
T Consensus        59 ~DVAG~dEAKeEl~EiVdFLK-~P~kf~~LGaKIPKGVLLvGPPGTGKTLLAKAvAGEA~VPFF~iS--G-SdFVE----  130 (505)
T TIGR01241        59 KDVAGIDEAKEELVEIVDFLK-NPSKFTKLGAKIPKGVLLVGPPGTGKTLLAKAVAGEAGVPFFSIS--G-SDFVE----  130 (505)
T ss_pred             CCCCCCHHHHHHHHHHHHHCC-CCHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHCCCCCCCEEEC--C-CCEEE----
T ss_conf             344453233343331342226-963798727889871473178784246788752025889624740--7-61011----


Q ss_pred             CCCCCCCCCHHHHHHHHHCCCCCE-EEEEECHHHHHHHCCCC--HHHH----------HHHHCCCCCCCCEEEEECCCCC
Q ss_conf             200145671289999983278873-99993315542311771--1556----------6554060016813320103523
Q gi|254780270|r  412 RRTYIGSMPGRIIQSLKRAKRSNP-LLLLDEIDKMGSDLRGD--PSAA----------LLEVLDPAQNSSFVDHYLEVEY  478 (820)
Q Consensus       412 ~~ty~ga~pg~ii~~l~~~~~~np-v~~ldeidk~~~~~~gd--p~~a----------llevldp~qn~~f~d~y~~~~~  478 (820)
                        =+||==-.|+=.-..+|+.+-| +|++||||=+|+. ||-  -.++          ||==-     +.|..+      
T Consensus       131 --MFVGVGASRVRDLFeqAK~nAPCIIFIDEIDAVGr~-RGaG~lGGGnDEREQTLNQLLVEM-----DGF~~~------  196 (505)
T TIGR01241       131 --MFVGVGASRVRDLFEQAKKNAPCIIFIDEIDAVGRQ-RGAGELGGGNDEREQTLNQLLVEM-----DGFGTN------  196 (505)
T ss_pred             --CCCCCCCEEHHHHHHHHHHHCCCEEEEECHHHCCCC-CCCCCCCCCCCHHHHHHHHHHEEC-----CCCCCC------
T ss_conf             --120564000144579999718970564010000333-564366765413554332331331-----785898------


Q ss_pred             CCCCEEEEEECCCCC-CCHHH-----CCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCC
Q ss_conf             644279999348655-44131-----172479982587868999899986089899862578131322899999997317
Q gi|254780270|r  479 DLSDVMFIMTANTLN-IPLPL-----MDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLF  552 (820)
Q Consensus       479 dls~v~fi~tan~~~-i~~~l-----~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Y  552 (820)
                        -.|+-||--|=.| .+++|     -||==+|..|.|.-  -.+|-+=|+-            .+.+++++=...|-.-
T Consensus       197 --~gvIv~AATNRPDvLD~ALLRPGRFDRQv~V~~PD~~G--R~~IL~VH~~------------~~kLa~~vdL~~~Ar~  260 (505)
T TIGR01241       197 --TGVIVIAATNRPDVLDPALLRPGRFDRQVVVDLPDIKG--REEILKVHAK------------NKKLAPDVDLKAVARR  260 (505)
T ss_pred             --CCEEEEEECCCCCCCCCCCCCCCCCCCEEECCCCCHHH--HHHHHHHHHC------------CCCCCCCCCHHHHHHH
T ss_conf             --85799850488411651006878744513458887467--8999999854------------8899702477999701


Q ss_pred             CC-CCHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHHH-----HCCCC---------------------------
Q ss_conf             74-1023478887999989876542117852012796786753-----05200---------------------------
Q gi|254780270|r  553 TH-EAGVRSFERALMKIARKAVTKIVKNSDTTVSINENNLQDY-----LGVPR---------------------------  599 (820)
Q Consensus       553 t~-EaGvR~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~-----lg~~~---------------------------  599 (820)
                      |- =||-     .|+.+|=.+|+--+....+  .|+..++++.     .|+.|                           
T Consensus       261 TPGfSGA-----DLaNl~NEAALlAAR~n~~--~i~~~~~eeA~Drv~~G~ekKsr~is~~eK~~vAYHEaGHAl~G~~~  333 (505)
T TIGR01241       261 TPGFSGA-----DLANLLNEAALLAARKNKT--EITMNDIEEAVDRVIAGLEKKSRVISEKEKKIVAYHEAGHALVGLLL  333 (505)
T ss_pred             CCCCCHH-----HHHHHHHHHHHHHHHCCCC--EECHHHHHHHHHHHHCCCCCCCCCCCHHHCCEEEEECHHHHHHHHHC
T ss_conf             5687678-----8999999999998617986--56288898787765227667885326777422201115789999735


Q ss_pred             CCCCCHHCCCCC--CC-CCEEEEC-CCCCEEEEEE-E-------EEECCC-------C-CEEECCCHHHHHHHHHHHHHH
Q ss_conf             033200022336--50-0000000-0168079999-9-------997489-------9-724432568999999999999
Q gi|254780270|r  600 YKYGKIEGEDQV--GI-VTGLAWT-EVGGEILTVE-G-------VIMPGK-------G-EITITGNLKEIMKESILAASS  659 (820)
Q Consensus       600 ~~~~~~~~~~~~--G~-v~GLa~t-~~GG~~l~IE-~-------~~~~g~-------g-~l~lTG~lg~vmkES~~~A~s  659 (820)
                      -.++.+++-+-+  |. +-|.+|. |-.|+-.-+. .       +.|-|.       | .=+-||=..|..|     |-.
T Consensus       334 ~~~DpV~KvTIIPRG~~AlG~t~~lP~~~D~~l~~k~~L~~~i~~~lGGRaAEe~~fG~~~vttGA~nD~~~-----AT~  408 (505)
T TIGR01241       334 KDADPVHKVTIIPRGQGALGYTQFLPEEGDKYLYTKKQLLAKIAVLLGGRAAEEIIFGEEEVTTGASNDLKQ-----ATN  408 (505)
T ss_pred             CCCCCCCCEEECCCCCCCCCCEEECCCCCCCCCCCHHHHHHHHHHHHHHHHEEEEECCCCCCCCCCCHHHHH-----HHH
T ss_conf             344752325631478441551683677444100368899999998732031002230788732362115899-----999


Q ss_pred             HHHHHHHHCCCCHH
Q ss_conf             99998886299855
Q gi|254780270|r  660 YVRSKATTFGIIPS  673 (820)
Q Consensus       660 ~~k~~~~~~~~~~~  673 (820)
                      .+|+--.+||..++
T Consensus       409 iAr~MVT~~GMS~k  422 (505)
T TIGR01241       409 IARAMVTEWGMSEK  422 (505)
T ss_pred             HHHHHCCCCCCCCC
T ss_conf             99973153367420


No 75 
>KOG0733 consensus
Probab=99.15  E-value=1.8e-09  Score=90.57  Aligned_cols=222  Identities=22%  Similarity=0.346  Sum_probs=135.1

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHHCCC-------CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCC
Q ss_conf             6520116899999999999984244-------467359986056565027999999770882499861888888883563
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQMRVIK-------NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGH  411 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~~~~~~-------~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh  411 (820)
                      .|.=||++|++....++---..+++       .-..-++|+||||.|||-|||.+|+--|-.|  ||.-|    .|+-  
T Consensus       511 ~dIGaL~~vR~eL~~aI~~PiK~pd~~k~lGi~~PsGvLL~GPPGCGKTLlAKAVANEag~NF--isVKG----PELl--  582 (802)
T KOG0733         511 DDIGALEEVRLELNMAILAPIKRPDLFKALGIDAPSGVLLCGPPGCGKTLLAKAVANEAGANF--ISVKG----PELL--  582 (802)
T ss_pred             HHCCCHHHHHHHHHHHHHHHCCCHHHHHHHCCCCCCCEEEECCCCCCHHHHHHHHHHHCCCCE--EEECC----HHHH--
T ss_conf             641249999999999986002388899982888987238757998618899999850304754--76238----8999--


Q ss_pred             CCCCCCCCCHHHHHHHHHCCCCC-EEEEEECHHHHHHH--CCCCH-----HHHHHHHCCCCCCCCEEEEECCCCCCCCCE
Q ss_conf             20014567128999998327887-39999331554231--17711-----556655406001681332010352364427
Q gi|254780270|r  412 RRTYIGSMPGRIIQSLKRAKRSN-PLLLLDEIDKMGSD--LRGDP-----SAALLEVLDPAQNSSFVDHYLEVEYDLSDV  483 (820)
Q Consensus       412 ~~ty~ga~pg~ii~~l~~~~~~n-pv~~ldeidk~~~~--~~gdp-----~~allevldp~qn~~f~d~y~~~~~dls~v  483 (820)
                       --|||-----+=|..-+|..+- +||+|||||-+...  ..|.-     .+-||.=||--             -+=.+|
T Consensus       583 -NkYVGESErAVR~vFqRAR~saPCVIFFDEiDaL~p~R~~~~s~~s~RvvNqLLtElDGl-------------~~R~gV  648 (802)
T KOG0733         583 -NKYVGESERAVRQVFQRARASAPCVIFFDEIDALVPRRSDEGSSVSSRVVNQLLTELDGL-------------EERRGV  648 (802)
T ss_pred             -HHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCCCCHHHHHHHHHHHHHHCCC-------------CCCCCE
T ss_conf             -877423789999999986238983898511120276557777505899999999873162-------------111425


Q ss_pred             EEEEECCCCC-CCHHH-----CCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHH--CCCCC
Q ss_conf             9999348655-44131-----1724799825878689998999860898998625781313228999999973--17741
Q gi|254780270|r  484 MFIMTANTLN-IPLPL-----MDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIR--LFTHE  555 (820)
Q Consensus       484 ~fi~tan~~~-i~~~l-----~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~--~Yt~E  555 (820)
                      +.|+--|--+ |.+++     +|+.=.+.+|  ..+|++.|-|.+.     +.++ .+-.-.+.=+.|-..-+  .||  
T Consensus       649 ~viaATNRPDiIDpAiLRPGRlDk~LyV~lP--n~~eR~~ILK~~t-----kn~k-~pl~~dVdl~eia~~~~c~gft--  718 (802)
T KOG0733         649 YVIAATNRPDIIDPAILRPGRLDKLLYVGLP--NAEERVAILKTIT-----KNTK-PPLSSDVDLDEIARNTKCEGFT--  718 (802)
T ss_pred             EEEEECCCCCCCCHHHCCCCCCCCEEEECCC--CHHHHHHHHHHHH-----CCCC-CCCCCCCCHHHHHHCCCCCCCC--
T ss_conf             9995068976555655187755742450699--8788999999985-----3579-9887545899985123226875--


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHCC--------C-C-----CEECCCHHHHHHHHCCC
Q ss_conf             023478887999989876542117--------8-5-----20127967867530520
Q gi|254780270|r  556 AGVRSFERALMKIARKAVTKIVKN--------S-D-----TTVSINENNLQDYLGVP  598 (820)
Q Consensus       556 aGvR~l~r~i~~i~r~~~~~~~~~--------~-~-----~~~~i~~~~l~~~lg~~  598 (820)
                       |     -.|+.+||+++.--++.        . +     .++.+|..+.++.+..-
T Consensus       719 -G-----ADLaaLvreAsi~AL~~~~~~~~~~~~~~~~~~~~~~~t~~hF~eA~~~i  769 (802)
T KOG0733         719 -G-----ADLAALVREASILALRESLFEIDSSEDDVTVRSSTIIVTYKHFEEAFQRI  769 (802)
T ss_pred             -H-----HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEECHHHHHHHHHHC
T ss_conf             -3-----65999999999999999986111257663023200243089999999863


No 76 
>KOG4159 consensus
Probab=99.12  E-value=4.7e-10  Score=94.96  Aligned_cols=191  Identities=18%  Similarity=0.183  Sum_probs=125.6

Q ss_pred             CCCEEEEEEEECCCEECCCEEEEEECCCHHHHHHHHHHHHC-CCEEEEEECCCCCCCCCCHHHEECCCEEEEEEEEEECC
Q ss_conf             77636756631782568871430642948999999999972-98499997368677788865602531489999979988
Q gi|254780270|r   23 ADGIIYPLLPLRDIVVFPYMIVPLFVGREKSVRALDEAMNS-HKKIILVTQMNSNDENPIASSVYRIGTIVDIVQILRLP  101 (820)
Q Consensus        23 ~~~~~LPIlPLrn~VLFPG~vlPL~V~eprsi~aIe~al~~-d~~I~vV~qkD~~~e~p~~edLy~VGTlakI~qi~klp  101 (820)
                      +.---.|+||+ .+..||....|++||+++|..|+++++.. +.+++++. -|+..   +....+++||+.+|.++..+.
T Consensus       172 ~~e~~~p~f~v-~~~~~p~v~cpl~vfe~~y~lm~~r~~~~~~~rf~i~~-sd~~~---~~~~~~e~g~i~ei~~v~~l~  246 (398)
T KOG4159         172 SRECESPLFPV-CTLAFPEVPCPLQVFEPRYRLMIRRLLETGDKRFGICL-SDSSK---GSGQAAEIGCILEIRKVESLG  246 (398)
T ss_pred             CCCCCCCCCCC-CCCCCCCCCCCHHHCCCHHHHHHHHHHHHCCEEEEEEC-CCCCC---CCCHHHHCCCHHHHCCCCCCC
T ss_conf             32024776330-40003356671787064299999999862550221242-66557---863143333104330350025


Q ss_pred             CCEEEEEEEEEEEEEEEEEEECCCEEEEEEEEECCCC---C-CC---HHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHH
Q ss_conf             9809999997547999988707981999999804888---8-84---789999999999999999854557778887641
Q gi|254780270|r  102 DGTVKILVEGSVRARIVEYIEREDFLEAITQVLPDPT---E-DP---VELEALSRSVIAEFSNYIKLNKKISPEVIGITS  174 (820)
Q Consensus       102 DG~~~ILVeGl~RvkI~ei~~~~pyl~A~Ve~l~d~~---~-d~---~eleAL~~~L~e~f~eli~l~~~i~~E~~~~l~  174 (820)
                      ||++.+...|..||++..+.+.++|.+|.+++++|.+   . ..   .....++..+......+..   .........+.
T Consensus       247 dgrsv~~~~gk~r~r~~~~~~~d~y~~~~ve~l~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~v~~~~~~~~~  323 (398)
T KOG4159         247 DGRSVVDSIGKSRFRVLLFSQTDGYPVADVEYLEDRPAVKVEGHDEPETLVELMKEVVKKECLWFE---SVADPMKGRLL  323 (398)
T ss_pred             CCCHHHHHHCCCCEEEEEECCCCCCEEEEEEEEECCHHHHHCCCHHCHHHHHHHHHHHHHHHHHHH---CCCHHHHHHHH
T ss_conf             640456542576514565217876314443223074776421520021688888998886664662---24235441466


Q ss_pred             CCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             26886789999885235898999998743247999999999999865
Q gi|254780270|r  175 QIEGFSKLADVIAANLSIKVAERQKILEAVSVKERLEMLLVFMESEI  221 (820)
Q Consensus       175 ~iddp~~LAD~IAs~L~l~~eeKQeLLE~~Di~eRLe~Ll~lL~~Ei  221 (820)
                      .--.+..+.+...+.+.......+.+++..+...|+......+.+..
T Consensus       324 ~~~~~~p~le~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~sl~  370 (398)
T KOG4159         324 VHFGCMPFLEINFECLESGPAWCWWKTALLPSEARLKSEFLAMRSLK  370 (398)
T ss_pred             HCCCCCCCCHHCHHHHCCCHHHHHHHHHCCCCHHHHHHHHHHCCCHH
T ss_conf             40265641211455411541889999841772778899998523400


No 77 
>KOG0734 consensus
Probab=99.11  E-value=1.8e-08  Score=82.88  Aligned_cols=280  Identities=25%  Similarity=0.326  Sum_probs=157.7

Q ss_pred             CCCHHHHHHHHHHHHHHCHHHHHHHHH---HHHHHHHHCCCCC---CCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEC
Q ss_conf             221068899877665201168999999---9999998424446---7359986056565027999999770882499861
Q gi|254780270|r  326 TKKNLDFAIRILDQDHFGLEKVKERII---EYLAVQMRVIKNK---GLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSL  399 (820)
Q Consensus       326 ~~~dl~~a~~iLd~~hyGl~~vK~ril---e~lav~~~~~~~~---g~il~l~gppgvGKts~~~sia~al~r~f~~isl  399 (820)
                      ...|-.....+-=+|.-|.+++|+-+=   |||---.......   ..-++|+||||+|||-||+.||---|-||+..| 
T Consensus       291 ~ev~p~~~~nv~F~dVkG~DEAK~ELeEiVefLkdP~kftrLGGKLPKGVLLvGPPGTGKTlLARAvAGEA~VPFF~~s-  369 (752)
T KOG0734         291 SEVDPEQMKNVTFEDVKGVDEAKQELEEIVEFLKDPTKFTRLGGKLPKGVLLVGPPGTGKTLLARAVAGEAGVPFFYAS-  369 (752)
T ss_pred             CCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHCCCHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHCCCCCCEEECC-
T ss_conf             4468466416550021472789999999999860908764314758885387689997556999986055689747416-


Q ss_pred             CCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCC-CEEEEEECHHHHHHHCCC-CHH------HHHHHHCC-CCCCCCEE
Q ss_conf             8888888835632001456712899999832788-739999331554231177-115------56655406-00168133
Q gi|254780270|r  400 GGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRS-NPLLLLDEIDKMGSDLRG-DPS------AALLEVLD-PAQNSSFV  470 (820)
Q Consensus       400 gg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~-npv~~ldeidk~~~~~~g-dp~------~allevld-p~qn~~f~  470 (820)
                      |.--||        -|||--.-|+-.-...|+.. -++|++||||-+|..-+- |-.      +-||-=+| -+||.   
T Consensus       370 GSEFdE--------m~VGvGArRVRdLF~aAk~~APcIIFIDEiDavG~kR~~~~~~y~kqTlNQLLvEmDGF~qNe---  438 (752)
T KOG0734         370 GSEFDE--------MFVGVGARRVRDLFAAAKARAPCIIFIDEIDAVGGKRNPSDQHYAKQTLNQLLVEMDGFKQNE---  438 (752)
T ss_pred             CCCHHH--------HHHCCCHHHHHHHHHHHHHCCCEEEEEECHHHHCCCCCCCHHHHHHHHHHHHHHHHCCCCCCC---
T ss_conf             620445--------422014899999999987349859997200220566786277899989999999842867688---


Q ss_pred             EEECCCCCCCCCEEEEEECCCCC-CCHHH-----CCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHH
Q ss_conf             20103523644279999348655-44131-----1724799825878689998999860898998625781313228999
Q gi|254780270|r  471 DHYLEVEYDLSDVMFIMTANTLN-IPLPL-----MDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGV  544 (820)
Q Consensus       471 d~y~~~~~dls~v~fi~tan~~~-i~~~l-----~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~  544 (820)
                                 .|++|.--|-.+ .+++|     .||-  |.+|.--..-..+|.+-||-.            +.+++++
T Consensus       439 -----------GiIvigATNfpe~LD~AL~RPGRFD~~--v~Vp~PDv~GR~eIL~~yl~k------------i~~~~~V  493 (752)
T KOG0734         439 -----------GIIVIGATNFPEALDKALTRPGRFDRH--VTVPLPDVRGRTEILKLYLSK------------IPLDEDV  493 (752)
T ss_pred             -----------CEEEEECCCCHHHHHHHHCCCCCCCEE--EECCCCCCCCHHHHHHHHHHC------------CCCCCCC
T ss_conf             -----------669995168745556873488755336--746897733289999999834------------8765677


Q ss_pred             HHHHHHCCCC-CCHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHH-----HHCCCCCCCCCHHCCCCCCCCCEEE
Q ss_conf             9999731774-102347888799998987654211785201279678675-----3052000332000223365000000
Q gi|254780270|r  545 LLDIIRLFTH-EAGVRSFERALMKIARKAVTKIVKNSDTTVSINENNLQD-----YLGVPRYKYGKIEGEDQVGIVTGLA  618 (820)
Q Consensus       545 i~~ii~~Yt~-EaGvR~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~-----~lg~~~~~~~~~~~~~~~G~v~GLa  618 (820)
                      =-.||..=|- =+| -+    |+.++--+|++-+.+.  ...++.++|+.     ..|++|-.. .+.++.+-    --|
T Consensus       494 D~~iiARGT~GFsG-Ad----LaNlVNqAAlkAa~dg--a~~VtM~~LE~akDrIlMG~ERks~-~i~~eak~----~TA  561 (752)
T KOG0734         494 DPKIIARGTPGFSG-AD----LANLVNQAALKAAVDG--AEMVTMKHLEFAKDRILMGPERKSM-VIDEEAKK----ITA  561 (752)
T ss_pred             CHHHHCCCCCCCCH-HH----HHHHHHHHHHHHHHCC--CCCCCHHHHHHHHHHEEECCCCCCC-CCCHHHHH----HHH
T ss_conf             87672268898765-78----9988889999998637--4011088776544332115211334-46814544----344


Q ss_pred             ECCCCCEE--------EEE-EEEEECCCCCEEECCCHHHHHHHHH
Q ss_conf             00016807--------999-9999748997244325689999999
Q gi|254780270|r  619 WTEVGGEI--------LTV-EGVIMPGKGEITITGNLKEIMKESI  654 (820)
Q Consensus       619 ~t~~GG~~--------l~I-E~~~~~g~g~l~lTG~lg~vmkES~  654 (820)
                      |-..|-.+        +|+ -++.||--..|-.|-+|-+.=+-|.
T Consensus       562 yHE~GHAivA~yTk~A~PlhKaTImPRG~sLG~t~~LPe~D~~~~  606 (752)
T KOG0734         562 YHEGGHAIVALYTKGAMPLHKATIMPRGPSLGHTSQLPEKDRYSI  606 (752)
T ss_pred             HHCCCCEEEEEECCCCCCCCCEEECCCCCCCCCEEECCCCCHHHH
T ss_conf             332672588751278866430253257766663134686540457


No 78 
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]
Probab=99.10  E-value=4.1e-09  Score=87.81  Aligned_cols=154  Identities=23%  Similarity=0.295  Sum_probs=93.7

Q ss_pred             HHHCHHHHHHHHHHHHHHHHHCCCCCCC-EEEEECCCCCCHHHHHHHHHHHHCCCEE-------------EEECCCCCCH
Q ss_conf             5201168999999999999842444673-5998605656502799999977088249-------------9861888888
Q gi|254780270|r  340 DHFGLEKVKERIIEYLAVQMRVIKNKGL-ILCFVGPPGVGKTSLAQSIAKATGRQYV-------------RMSLGGVYDE  405 (820)
Q Consensus       340 ~hyGl~~vK~rile~lav~~~~~~~~g~-il~l~gppgvGKts~~~sia~al~r~f~-------------~islgg~~d~  405 (820)
                      ++||.+.+..+.+.+.  ..+.   +++ .++|.||||+|||+.|..+|+.|.-...             .+..|--.|-
T Consensus         2 ~~~~~~~~~~~l~~~~--~~~~---~~~halL~~Gp~G~Gktt~a~~lA~~l~~~~~~~~~~~~~~~~~~~~~~~~~~d~   76 (325)
T COG0470           2 ELVPWQEAVKRLLVQA--LESG---RLPHALLFYGPPGVGKTTAALALAKELLCENPTGLLPCGHCRSCKLIPAGNHPDF   76 (325)
T ss_pred             CCCCCHHHHHHHHHHH--HHCC---CCCCCEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCCCCCE
T ss_conf             6433235899999999--8658---8876100379999978999999999965866433455200224443202568865


Q ss_pred             HHHCCCCCCCCCCCCHHHHHHHHHCC------CCCEEEEEECHHHHHHHCCCCHHHHHHHHC-CCCCCCCEEEEECCCCC
Q ss_conf             88356320014567128999998327------887399993315542311771155665540-60016813320103523
Q gi|254780270|r  406 ADIRGHRRTYIGSMPGRIIQSLKRAK------RSNPLLLLDEIDKMGSDLRGDPSAALLEVL-DPAQNSSFVDHYLEVEY  478 (820)
Q Consensus       406 ~~i~gh~~ty~ga~pg~ii~~l~~~~------~~npv~~ldeidk~~~~~~gdp~~allevl-dp~qn~~f~d~y~~~~~  478 (820)
                      -|+.--..-..+ .--..|..+.+..      ...=|+++||+|+|+.    |-++|||-++ .|.              
T Consensus        77 lel~~s~~~~~~-i~~~~vr~~~~~~~~~~~~~~~kviiidead~mt~----~A~nallk~lEep~--------------  137 (325)
T COG0470          77 LELNPSDLRKID-IIVEQVRELAEFLSESPLEGGYKVVIIDEADKLTE----DAANALLKTLEEPP--------------  137 (325)
T ss_pred             EEECCCCCCCCC-CHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCH----HHHHHHHHHCCCCC--------------
T ss_conf             997732133330-06999999998604465667726999732032698----88876754332488--------------


Q ss_pred             CCCCEEEEEECCCCC-CCHHHCCCEEEEEECCCCHHHHHHHH
Q ss_conf             644279999348655-44131172479982587868999899
Q gi|254780270|r  479 DLSDVMFIMTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQIA  519 (820)
Q Consensus       479 dls~v~fi~tan~~~-i~~~l~drme~i~~~~y~~~ek~~i~  519 (820)
                        ++..||+++|+.+ |.+|++.|-.++++..-+..+.+...
T Consensus       138 --~~~~~il~~n~~~~il~tI~SRc~~i~f~~~~~~~~i~~~  177 (325)
T COG0470         138 --KNTRFILITNDPSKILPTIRSRCQRIRFKPPSRLEAIAWL  177 (325)
T ss_pred             --CCEEEEEEECCHHHCHHHHHHHEEEEECCCCCHHHHHHHH
T ss_conf             --8716999749855564787756078876774188999985


No 79 
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional
Probab=99.08  E-value=2.1e-08  Score=82.47  Aligned_cols=205  Identities=20%  Similarity=0.346  Sum_probs=140.7

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHC---CCEEEEECCCCCC---HHHHCCCCCC-CCCCC---CHHHHHHHHHCCC
Q ss_conf             44673599860565650279999997708---8249986188888---8883563200-14567---1289999983278
Q gi|254780270|r  363 KNKGLILCFVGPPGVGKTSLAQSIAKATG---RQYVRMSLGGVYD---EADIRGHRRT-YIGSM---PGRIIQSLKRAKR  432 (820)
Q Consensus       363 ~~~g~il~l~gppgvGKts~~~sia~al~---r~f~~islgg~~d---~~~i~gh~~t-y~ga~---pg~ii~~l~~~~~  432 (820)
                      ....|+| +.|++||||..+|+.|...=.   .||+.|.++++.+   |+|+=||.+- |.||.   +|++-++      
T Consensus       164 ~s~~~VL-I~GEsGTGKe~~Ar~IH~~S~r~~~pFv~vnc~ai~~~l~eseLFG~~kgaftga~~~~~G~~e~A------  236 (457)
T PRK11361        164 LSQASVL-ISGESGTGKELIARAIHYNSRRAKGPFIKVNCAALPESLLESELFGHEKGAFTGAQTLRQGLFERA------  236 (457)
T ss_pred             CCCCCEE-EECCCCCCHHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCHHHC------
T ss_conf             8899589-988998578999999998379889983876478798577899971876678788531469861335------


Q ss_pred             CCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEEC--CCCCCCCCEEEEEECC-CC-C-CC-----HHHCCCE
Q ss_conf             873999933155423117711556655406001681332010--3523644279999348-65-5-44-----1311724
Q gi|254780270|r  433 SNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYL--EVEYDLSDVMFIMTAN-TL-N-IP-----LPLMDRM  502 (820)
Q Consensus       433 ~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~--~~~~dls~v~fi~tan-~~-~-i~-----~~l~drm  502 (820)
                      .+.-++||||+.|+.+.+    ..||.+|.   +..|.---=  .+++   +|-+||+.| ++ + +.     .-|.-|+
T Consensus       237 ~gGTLfLdeI~~l~~~~Q----~kLLr~L~---~~~~~~~g~~~~~~~---dvRiIaaT~~~L~~~v~~g~Fr~DLyyrL  306 (457)
T PRK11361        237 NEGTLLLDEIGEMPLVLQ----AKLLRILQ---EREFERIGGHQTIKV---DIRIIAATNRDLQAMVKEGTFREDLFYRL  306 (457)
T ss_pred             CCCCEECCCHHHHHHHHH----HHHHHHHH---CCCEEECCCCCEEEE---CCEEEECCCCCHHHHHHCCCCHHHHHHHH
T ss_conf             998263146645239999----99999986---492785699713665---34899657878599987583238899530


Q ss_pred             EEEEE--CCCCH-HHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             79982--58786-8999899986089899862578131322899999997317741023478887999989876542117
Q gi|254780270|r  503 EIIRI--AGYTE-EEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKN  579 (820)
Q Consensus       503 e~i~~--~~y~~-~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~  579 (820)
                      -++.+  |+.-. .|-+----+|.+-+...++|..  ...|+++++.. ...|.+-.-||+|+..+...+-     ... 
T Consensus       307 ~~~~i~lPpLReR~eDI~~L~~~fl~~~~~~~~~~--~~~~s~~a~~~-L~~y~WPGNvREL~n~ierav~-----~~~-  377 (457)
T PRK11361        307 NVIHLILPPLRDRREDISLLANHFLQKFSSENQRD--IIDIDPMAMSL-LTAWSWPGNIRELSNVIERAVV-----MNS-  377 (457)
T ss_pred             CEEEEECCCHHHCHHHHHHHHHHHHHHHHHHCCCC--CCCCCHHHHHH-HHCCCCCCHHHHHHHHHHHHHH-----HCC-
T ss_conf             22125173854587549999999999999974999--89889999999-9569999799999999999998-----289-


Q ss_pred             CCCEECCCHHHHHHHHC
Q ss_conf             85201279678675305
Q gi|254780270|r  580 SDTTVSINENNLQDYLG  596 (820)
Q Consensus       580 ~~~~~~i~~~~l~~~lg  596 (820)
                         .-.|+.+++...+.
T Consensus       378 ---~~~i~~~~l~~~~~  391 (457)
T PRK11361        378 ---GPIIFSEDLPPQIR  391 (457)
T ss_pred             ---CCCCCHHHCCHHHH
T ss_conf             ---98156676848661


No 80 
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional
Probab=99.07  E-value=1.2e-08  Score=84.35  Aligned_cols=208  Identities=20%  Similarity=0.323  Sum_probs=132.6

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHC---CCEEEEECCCCCC---HHHHCCCCCC-CCCC---CCHHHHHHHHHCCC
Q ss_conf             44673599860565650279999997708---8249986188888---8883563200-1456---71289999983278
Q gi|254780270|r  363 KNKGLILCFVGPPGVGKTSLAQSIAKATG---RQYVRMSLGGVYD---EADIRGHRRT-YIGS---MPGRIIQSLKRAKR  432 (820)
Q Consensus       363 ~~~g~il~l~gppgvGKts~~~sia~al~---r~f~~islgg~~d---~~~i~gh~~t-y~ga---~pg~ii~~l~~~~~  432 (820)
                      .+..||| +.|.+||||..+|++|...=.   .||+.+.++.+.+   |+|+-||.+- +-||   .+|++-+      .
T Consensus       207 ~sd~pVL-I~GEtGTGKelvAr~IH~~S~R~~~Pfv~vNCaalpe~l~EseLFGh~kGaFtGA~~~r~G~fe~------A  279 (510)
T PRK05022        207 ASDLNVL-ITGETGVGKELVARAIHQASPRAVKPLVYLNCAALPESLAESELFGHVKGAFTGAISNRSGKFEL------A  279 (510)
T ss_pred             CCCCCEE-EECCCCCCHHHHHHHHHHCCCCCCCCCEEEECCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCEEE------C
T ss_conf             8999889-88989813999999999668878998578889999856789986597778868865567881017------7


Q ss_pred             CCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCC-C-C-CC-----HHHCCCEEE
Q ss_conf             87399993315542311771155665540600168133201035236442799993486-5-5-44-----131172479
Q gi|254780270|r  433 SNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANT-L-N-IP-----LPLMDRMEI  504 (820)
Q Consensus       433 ~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~-~-~-i~-----~~l~drme~  504 (820)
                      .+..++||||+.++.+.+    +.||.+|.   |..|+---=+-+.. .+|=+||+.|- + + +-     +-|..|+-+
T Consensus       280 ~gGTLfLDEI~~Lpl~~Q----~KLLrvLq---~g~iqrvG~~~~~~-vdvRIIAATnrdL~~~V~~G~FR~DLYyRLsv  351 (510)
T PRK05022        280 DGGTLFLDEIGELPLALQ----AKLLRVLQ---YGEIQRVGSDRSLR-VDVRVIAATNRDLREEVLAGRFRADLYHRLSV  351 (510)
T ss_pred             CCCEEEEECHHHCCHHHH----HHHHHHHH---CCEEEECCCCCEEE-EEEEEEEECCCCHHHHHHCCCHHHHHHHHHHC
T ss_conf             898798757454999999----99999984---79588558994666-66899960783599998839638999987620


Q ss_pred             E--EECCCCH-HHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             9--8258786-899989998608989986257813132289999999731774102347888799998987654211785
Q gi|254780270|r  505 I--RIAGYTE-EEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSD  581 (820)
Q Consensus       505 i--~~~~y~~-~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~~~  581 (820)
                      +  .+|+.-. .|-+..--.|.+-+...+.|.  ..+.|+++++.. ...|.+---||+|+..|...+   ..-...+..
T Consensus       352 ~~I~vPPLRER~eDI~lLa~~FLe~~~~~~g~--~~~~ls~eAl~~-L~~Y~WPGNVRELenvIeRA~---lla~~~~~~  425 (510)
T PRK05022        352 FPLPVPPLRERGDDVLLLAGYFLEQNRLRLGL--SSLRLSPDAQAA-LLQYDWPGNVRELEHVISRAA---LLARARRAG  425 (510)
T ss_pred             CCCCCCCHHHCHHHHHHHHHHHHHHHHHHCCC--CCCCCCHHHHHH-HHCCCCCCHHHHHHHHHHHHH---HHHCCCCCC
T ss_conf             40348086555540999999999999998298--989888999999-970999978999999999999---971566677


Q ss_pred             CEECCCHHHH
Q ss_conf             2012796786
Q gi|254780270|r  582 TTVSINENNL  591 (820)
Q Consensus       582 ~~~~i~~~~l  591 (820)
                      ...+++.+++
T Consensus       426 ~~~~i~~~~l  435 (510)
T PRK05022        426 DIVTLEAQHL  435 (510)
T ss_pred             CCCCCCHHHC
T ss_conf             6442567664


No 81 
>KOG0989 consensus
Probab=99.06  E-value=3.7e-09  Score=88.18  Aligned_cols=166  Identities=28%  Similarity=0.388  Sum_probs=105.0

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCC--CHHHHCCCCCCCCCCCCHHHHHHHHHCCCCC-------
Q ss_conf             4673599860565650279999997708824998618888--8888356320014567128999998327887-------
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVY--DEADIRGHRRTYIGSMPGRIIQSLKRAKRSN-------  434 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~--d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~n-------  434 (820)
                      ..+|.+.|+|||||||||-++..|++|+-+-- +.. |+-  ..++-||-.     --+++| +...+.-..+       
T Consensus        55 ~~lp~~LFyGPpGTGKTStalafar~L~~~~~-~~~-rvl~lnaSderGis-----vvr~Ki-k~fakl~~~~~~~~~~~  126 (346)
T KOG0989          55 RILPHYLFYGPPGTGKTSTALAFARALNCEQL-FPC-RVLELNASDERGIS-----VVREKI-KNFAKLTVLLKRSDGYP  126 (346)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCCC-CCC-CHHHHCCCCCCCCC-----CHHHHH-CCHHHHHHCCCCCCCCC
T ss_conf             68860786689998676899999998557423-555-42431366001431-----006652-37998750255656788


Q ss_pred             ----EEEEEECHHHHHHHCCCCHHHHHHHHCCC-CCCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHHHCCCEEEEEEC
Q ss_conf             ----39999331554231177115566554060-016813320103523644279999348655-441311724799825
Q gi|254780270|r  435 ----PLLLLDEIDKMGSDLRGDPSAALLEVLDP-AQNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLPLMDRMEIIRIA  508 (820)
Q Consensus       435 ----pv~~ldeidk~~~~~~gdp~~allevldp-~qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~drme~i~~~  508 (820)
                          -||+|||-|-|+++.    .+||.-++|- .|                .+-||+-.|+++ ||.||..|---...+
T Consensus       127 ~~~fKiiIlDEcdsmtsda----q~aLrr~mE~~s~----------------~trFiLIcnylsrii~pi~SRC~KfrFk  186 (346)
T KOG0989         127 CPPFKIIILDECDSMTSDA----QAALRRTMEDFSR----------------TTRFILICNYLSRIIRPLVSRCQKFRFK  186 (346)
T ss_pred             CCCCEEEEEECHHHHHHHH----HHHHHHHHHCCCC----------------CEEEEEECCCHHHCCHHHHHHHHHHCCC
T ss_conf             9863289974164530999----9999999862546----------------6599997388564772877467771288


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHH
Q ss_conf             8786899989998608989986257813132289999999731774102347888799998
Q gi|254780270|r  509 GYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIA  569 (820)
Q Consensus       509 ~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~  569 (820)
                      ..-.+.-+.         -++..+ .++.+.++++++..|.+.-  +.-.|.-+-.|.++.
T Consensus       187 ~L~d~~iv~---------rL~~Ia-~~E~v~~d~~al~~I~~~S--~GdLR~Ait~Lqsls  235 (346)
T KOG0989         187 KLKDEDIVD---------RLEKIA-SKEGVDIDDDALKLIAKIS--DGDLRRAITTLQSLS  235 (346)
T ss_pred             CCCHHHHHH---------HHHHHH-HHHCCCCCHHHHHHHHHHC--CCCHHHHHHHHHHHH
T ss_conf             764478999---------999998-8858997878999999973--872899999999861


No 82 
>TIGR00416 sms DNA repair protein RadA; InterPro: IPR004504   RadA/Sms is a highly conserved eubacterial protein that shares sequence similarity with both RecA strand transferase and lon protease. The RadA/Sms family are probable ATP-dependent proteases involved in both DNA repair and degradation of proteins, peptides, glycopeptides. They are classified in as non-peptidase homologues and unassigned peptidases in MEROPS peptidase family S16 (lon protease family, clan SJ).   RadA/Sms is involved in recombination and recombinational repair, most likely involving the stabilisation or processing of branched DNA molecules or blocked replication forks because of its genetic redundancy with RecG and RuvABC .; GO: 0003684 damaged DNA binding, 0005524 ATP binding, 0006281 DNA repair.
Probab=99.06  E-value=4.6e-10  Score=95.02  Aligned_cols=343  Identities=20%  Similarity=0.321  Sum_probs=205.4

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHH----HHHHCCCEEEEECCCCCCHH----HHCCCCCC-CCCCCCHHHHHHHHHCCCCC
Q ss_conf             46735998605656502799999----97708824998618888888----83563200-14567128999998327887
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSI----AKATGRQYVRMSLGGVYDEA----DIRGHRRT-YIGSMPGRIIQSLKRAKRSN  434 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~si----a~al~r~f~~islgg~~d~~----~i~gh~~t-y~ga~pg~ii~~l~~~~~~n  434 (820)
                      ++|..++.=|-||+||.+|---+    |+...+=.| ||  |  .||    -+|-||== --=-.|..--+++.+.-..-
T Consensus       101 vpGsliLiGG~PG~GKSTLLLqV~~~LA~~~~~~LY-Vs--G--EES~~Q~klRA~RLGit~~~~~sqaqdGinnlahdG  175 (481)
T TIGR00416       101 VPGSLILIGGDPGIGKSTLLLQVACQLAKNSMKVLY-VS--G--EESLQQIKLRATRLGITDLVEPSQAQDGINNLAHDG  175 (481)
T ss_pred             CCCCEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEE-EE--E--CCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHCCC
T ss_conf             244169846889963567899999998404881689-97--2--301677888875455324787023443245430267


Q ss_pred             EEEEEECHHHHHHHCCCCHHHHHHH-------HCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCCCCHHHCCCEEEEEE
Q ss_conf             3999933155423117711556655-------406001681332010352364427999934865544131172479982
Q gi|254780270|r  435 PLLLLDEIDKMGSDLRGDPSAALLE-------VLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLNIPLPLMDRMEIIRI  507 (820)
Q Consensus       435 pv~~ldeidk~~~~~~gdp~~alle-------vldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~i~~~l~drme~i~~  507 (820)
                      -+++|.|+|=       |--.+.+|       |.|.=||-.|-|                 -.+.               
T Consensus       176 ~L~~L~Et~~-------e~I~~~~e~~~P~~~ViDSIQ~ly~~d-----------------i~Sa---------------  216 (481)
T TIGR00416       176 NLYVLSETNL-------EQICAEIEELNPQVVVIDSIQTLYLPD-----------------ISSA---------------  216 (481)
T ss_pred             CCCCCCCCCH-------HHHHHHHHHHCCCEEEEECCCCCCCHH-----------------HCCC---------------
T ss_conf             5321575798-------999999985299489991421000000-----------------0258---------------


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCC---CHHHHHHHHHHHHH-----HHHHHHHHCC
Q ss_conf             587868999899986089899862578131322899999997317741---02347888799998-----9876542117
Q gi|254780270|r  508 AGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHE---AGVRSFERALMKIA-----RKAVTKIVKN  579 (820)
Q Consensus       508 ~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~E---aGvR~l~r~i~~i~-----r~~~~~~~~~  579 (820)
                       +=+.--=.+++  ..|-|.-|.-+           +--.||-|-|.|   ||=|=||-.++.+.     |....++++.
T Consensus       217 -PGSVsQVRE~t--~~Lmr~AKt~~-----------iaifiVGHVTKeGsiAGPkvLEH~vD~vLyfeGd~~~~~R~LRS  282 (481)
T TIGR00416       217 -PGSVSQVRECT--AELMRLAKTRG-----------IAIFIVGHVTKEGSIAGPKVLEHMVDTVLYFEGDRDSRFRILRS  282 (481)
T ss_pred             -CCCHHHHHHHH--HHHHHHHHHCC-----------CCEEEEEEECCCCCCCCCHHHHHHHHHHEECCCCCCCCCCHHHC
T ss_conf             -88423888999--99987652168-----------65799700435675434046663433110115887534440100


Q ss_pred             C---------CCEECCCHHHHHHHHCCCC-CCCCCHHCCCCCCCCCEEEECCCCCEEEEEEEEEEC---CCCCEEECCCH
Q ss_conf             8---------5201279678675305200-033200022336500000000016807999999974---89972443256
Q gi|254780270|r  580 S---------DTTVSINENNLQDYLGVPR-YKYGKIEGEDQVGIVTGLAWTEVGGEILTVEGVIMP---GKGEITITGNL  646 (820)
Q Consensus       580 ~---------~~~~~i~~~~l~~~lg~~~-~~~~~~~~~~~~G~v~GLa~t~~GG~~l~IE~~~~~---g~g~l~lTG~l  646 (820)
                      .         -.-+..+.+-|.+.+-|.. |-..+.+-..  |-.--.+|-..=--++.|+|.+.|   |+.+=.-||- 
T Consensus       283 ~KNRFGat~E~G~FeM~e~GL~ev~nPS~iFL~~~~e~~~--GSsitv~~EGtRPLlvEiQALVs~~s~anPrR~A~G~-  359 (481)
T TIGR00416       283 VKNRFGATNEIGIFEMTEQGLREVLNPSAIFLSRREEVMS--GSSITVALEGTRPLLVEIQALVSPTSFANPRRVATGL-  359 (481)
T ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCC--CCCEEEEECCCHHHHHHHHHHCCCCCCCCCCCEECCH-
T ss_conf             0156787342101000023356453145664157645666--7301234237348888887522614368863100442-


Q ss_pred             HHHHHHHHHHHHHHHHHHH-HHCCCCHHHHHHCCCEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEEEE
Q ss_conf             8999999999999999988-862998557420781474488884788873068999999999836888756106636850
Q gi|254780270|r  647 KEIMKESILAASSYVRSKA-TTFGIIPSAFNEINIHVHVPEGATPKDGPSAGIAMATAIVSIMTCIPVYKNVAMTGELTL  725 (820)
Q Consensus       647 g~vmkES~~~A~s~~k~~~-~~~~~~~~~~~~~diHih~p~Ga~pKDGPSAGi~i~tal~S~~~~~~v~~~iAmTGEitl  725 (820)
                           |.=++++=  =+.+ +++++.   +.+.|..|+| .|++.-|=||+-.||..||+|.|-+||++++.++=|||.|
T Consensus       360 -----d~NRL~~L--lAvLek~~Gl~---l~~~Dvf~~V-~GGvkv~Epa~DLA~~~a~~SSFrdr~~~~~~~~lGEVGL  428 (481)
T TIGR00416       360 -----DQNRLALL--LAVLEKRLGLP---LADQDVFLNV-AGGVKVSEPAVDLALLIALVSSFRDRPLDPDLVILGEVGL  428 (481)
T ss_pred             -----HHHHHHHH--HHHHHHHCCCC---HHHCCEEEEE-ECCEEECCHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECC
T ss_conf             -----25689999--99987640661---1117347986-2350541057889999999987517887856388876437


Q ss_pred             CCEEEEECCHHHHHHHHHHCCCCEEECCHHHHHHHHHCCHHHHCCCEEEECCCHHHHH
Q ss_conf             3025000656899999997099699803677550776148877097999819399988
Q gi|254780270|r  726 RGRVLPIGGLKEKLLAALRAGVTKVLIPEENIKDLMDIPENVKNGLEIIPVSFMGEVL  783 (820)
Q Consensus       726 ~G~VlpiGGi~eK~laA~raGi~~viiP~~N~~d~~~ip~~~~~~l~~~~v~~~~evl  783 (820)
                      .|+|.||--+.+-+-=|-+.|-|+.|+|+.|...|.+     .++|+++.|..+.+++
T Consensus       429 ~G~ir~vp~~~~R~kEaak~GFkraIvP~~~~~~W~~-----~~gi~~~~v~~v~~al  481 (481)
T TIGR00416       429 AGEIRPVPSLEERLKEAAKLGFKRAIVPKANLPKWTA-----PEGIKVIGVKKVADAL  481 (481)
T ss_pred             CCEEEECCCHHHHHHHHHHCCCCEEECCCCCCCCCCC-----CCCCEEEEHHHHHHHC
T ss_conf             7704007763167999984686344214788887524-----4562476034465409


No 83 
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional
Probab=99.05  E-value=2.3e-08  Score=82.23  Aligned_cols=184  Identities=21%  Similarity=0.322  Sum_probs=126.1

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHCC---CEEEEECCCCCC---HHHHCCCCCCCCCCCCHHHHHHHHHCCCCCE
Q ss_conf             4446735998605656502799999977088---249986188888---8883563200145671289999983278873
Q gi|254780270|r  362 IKNKGLILCFVGPPGVGKTSLAQSIAKATGR---QYVRMSLGGVYD---EADIRGHRRTYIGSMPGRIIQSLKRAKRSNP  435 (820)
Q Consensus       362 ~~~~g~il~l~gppgvGKts~~~sia~al~r---~f~~islgg~~d---~~~i~gh~~ty~ga~pg~ii~~l~~~~~~np  435 (820)
                      .....|+| +.|..||||..+|+.|..+-.|   ||+.+.+|++.+   |+|+=||-   .+..+|.+-+      ..+.
T Consensus       224 A~~d~pVL-I~GEsGTGKellAraIH~~S~R~~~pFv~vnC~alp~~l~eseLFG~a---~~~~~G~fe~------A~gG  293 (513)
T PRK10820        224 AMLSAPLL-ITGDTGTGKDLFAYACHLASPRAKKPYLALNCASIPEDAVESELFGHA---PEGKKGFFEQ------ANGG  293 (513)
T ss_pred             HCCCCCEE-EECCCCCCHHHHHHHHHHCCCCCCCCCEEEECCCCCHHHHHHHHCCCC---CCCCCCCEEE------CCCC
T ss_conf             59899889-989898249999999996688789982688899899678999863876---6688975578------5898


Q ss_pred             EEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEE--CCCCCCCCCEEEEEECCC-C-C------CCHHHCCCEEEE
Q ss_conf             99993315542311771155665540600168133201--035236442799993486-5-5------441311724799
Q gi|254780270|r  436 LLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHY--LEVEYDLSDVMFIMTANT-L-N------IPLPLMDRMEII  505 (820)
Q Consensus       436 v~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y--~~~~~dls~v~fi~tan~-~-~------i~~~l~drme~i  505 (820)
                      -++||||+-|+...+    +.||.+|.   +..|+--=  =.+++   +|=+||+.|. + .      .-.-|..|+-++
T Consensus       294 TLfLdEI~~l~~~~Q----~kLLr~Lq---~~~~~rvG~~~~~~~---dvRiIaaT~~dL~~lv~~g~FReDLyyRL~v~  363 (513)
T PRK10820        294 SVLLDEIGEMSPRMQ----AKLLRFLN---DGTFRRVGEDHEVHV---DVRVICATQKNLVELVQKGLFREDLYYRLNVL  363 (513)
T ss_pred             EEEEECHHHCCHHHH----HHHHHHHH---CCEEEECCCCCEEEE---EEEEEECCCHHHHHHHHCCCCCHHHHHHHHCC
T ss_conf             899978365999999----99999986---897996599853567---78999626530999987298508899986167


Q ss_pred             E--ECCCCH-HHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHH
Q ss_conf             8--258786-89998999860898998625781313228999999973177410234788879999
Q gi|254780270|r  506 R--IAGYTE-EEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKI  568 (820)
Q Consensus       506 ~--~~~y~~-~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i  568 (820)
                      .  +|+.-. .|-+..--+|.+-+...++|...  ..|+++++.. ...|.+---||+|+..+...
T Consensus       364 ~I~lPpLReR~eDI~~L~~~fl~~~~~~~g~~~--~~ls~~a~~~-L~~y~WPGNVREL~n~iera  426 (513)
T PRK10820        364 TLNLPPLRDCPQDIMPLTELFVARFADEQGVPR--PKLSADLSTV-LTRYGWPGNVRQLKNAIYRA  426 (513)
T ss_pred             CCCCCCHHHCHHHHHHHHHHHHHHHHHHCCCCC--CCCCHHHHHH-HHHCCCCCHHHHHHHHHHHH
T ss_conf             255888344655699999999999999759998--9847999999-97089997999999999999


No 84 
>KOG0651 consensus
Probab=99.05  E-value=1.7e-09  Score=90.68  Aligned_cols=185  Identities=30%  Similarity=0.470  Sum_probs=115.9

Q ss_pred             HHHHHHHH---HHHHHCCC------CC-CCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCC
Q ss_conf             99999999---99984244------46-7359986056565027999999770882499861888888883563200145
Q gi|254780270|r  348 KERIIEYL---AVQMRVIK------NK-GLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIG  417 (820)
Q Consensus       348 K~rile~l---av~~~~~~------~~-g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~g  417 (820)
                      .+.|-|+.   +|-..|+.      .+ +.+++|.||||+|||-+|+.||..||-.|..++-|.+-|         -|+|
T Consensus       138 ~~qirelre~ielpl~np~lf~rvgIk~Pkg~ll~GppGtGKTlla~~Vaa~mg~nfl~v~ss~lv~---------kyiG  208 (388)
T KOG0651         138 FYQIRELREVIELPLTNPELFLRVGIKPPKGLLLYGPPGTGKTLLARAVAATMGVNFLKVVSSALVD---------KYIG  208 (388)
T ss_pred             HHHHHHHHHHEEEECCCCHHCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEHHHHHH---------HHCC
T ss_conf             8888998865574024810023457778825687679998645999999986598547744766633---------0026


Q ss_pred             CCCHHHHHHHHH-C-CCCCEEEEEECHHHHHHH-C-CC-----CHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEE
Q ss_conf             671289999983-2-788739999331554231-1-77-----1155665540600168133201035236442799993
Q gi|254780270|r  418 SMPGRIIQSLKR-A-KRSNPLLLLDEIDKMGSD-L-RG-----DPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMT  488 (820)
Q Consensus       418 a~pg~ii~~l~~-~-~~~npv~~ldeidk~~~~-~-~g-----dp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~t  488 (820)
                      - |+|+|..+-+ | ..--+++++||||-++-- + .|     .....|.|+||  |=..|-        -|.+|=.|||
T Consensus       209 E-saRlIRemf~yA~~~~pciifmdeiDAigGRr~se~Ts~dreiqrTLMeLln--qmdgfd--------~l~rVk~Ima  277 (388)
T KOG0651         209 E-SARLIRDMFRYAREVIPCIIFMDEIDAIGGRRFSEGTSSDREIQRTLMELLN--QMDGFD--------TLHRVKTIMA  277 (388)
T ss_pred             C-HHHHHHHHHHHHHHHCCEEEEEHHHHHHCCEEECCCCCHHHHHHHHHHHHHH--HHCCCH--------HCCCCCEEEE
T ss_conf             5-7889999997786527557751012311457733555205999999999987--421401--------2066317985


Q ss_pred             CCCCC-CCHHHC-C-CEEE-EEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCC--------CCCC
Q ss_conf             48655-441311-7-2479-982587868999899986089899862578131322899999997317--------7410
Q gi|254780270|r  489 ANTLN-IPLPLM-D-RMEI-IRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLF--------THEA  556 (820)
Q Consensus       489 an~~~-i~~~l~-d-rme~-i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Y--------t~Ea  556 (820)
                      -|+.+ ..+||+ + ||+- |++|=-...-.+.|-|=|-  +.+..+|      .|.++++.++.+.+        |+|+
T Consensus       278 tNrpdtLdpaLlRpGRldrk~~iPlpne~~r~~I~Kih~--~~i~~~G------eid~eaivK~~d~f~gad~rn~~tEa  349 (388)
T KOG0651         278 TNRPDTLDPALLRPGRLDRKVEIPLPNEQARLGILKIHV--QPIDFHG------EIDDEAILKLVDGFNGADLRNVCTEA  349 (388)
T ss_pred             CCCCCCCCHHHCCCCCCCCEECCCCCCHHHCEEEEEECC--CCCCCCC------CCCHHHHHHHHHCCCHHHHHHHCCCC
T ss_conf             388665665542875211100268855442402676235--4113345------54589999887415708776212346


Q ss_pred             HHHH
Q ss_conf             2347
Q gi|254780270|r  557 GVRS  560 (820)
Q Consensus       557 GvR~  560 (820)
                      |+=.
T Consensus       350 g~Fa  353 (388)
T KOG0651         350 GMFA  353 (388)
T ss_pred             CCCC
T ss_conf             5110


No 85 
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]
Probab=99.04  E-value=5.7e-08  Score=79.16  Aligned_cols=204  Identities=21%  Similarity=0.277  Sum_probs=124.8

Q ss_pred             HCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCC-----EEEEECCCCCCHHHHCC--CC----CCCCCCCCHHHHHHHH
Q ss_conf             4244467359986056565027999999770882-----49986188888888356--32----0014567128999998
Q gi|254780270|r  360 RVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQ-----YVRMSLGGVYDEADIRG--HR----RTYIGSMPGRIIQSLK  428 (820)
Q Consensus       360 ~~~~~~g~il~l~gppgvGKts~~~sia~al~r~-----f~~islgg~~d~~~i~g--h~----~ty~ga~pg~ii~~l~  428 (820)
                      +++..... +.++||||||||...+-+++.+..+     ++.|..=..+-.-.+-.  ++    --..|.--..+.+.+.
T Consensus        37 ~~~~~p~n-~~iyG~~GTGKT~~~~~v~~~l~~~~~~~~~~yINc~~~~t~~~i~~~i~~~~~~~p~~g~~~~~~~~~l~  115 (366)
T COG1474          37 LRGERPSN-IIIYGPTGTGKTATVKFVMEELEESSANVEVVYINCLELRTPYQVLSKILNKLGKVPLTGDSSLEILKRLY  115 (366)
T ss_pred             HCCCCCCC-EEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHH
T ss_conf             55899860-79988999873289999999997331567579995130787879999999982689976763268999999


Q ss_pred             HC---CCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCC-CCCCCEEEEECCCCCCCCCEEEEEECCCCC----CCHHHCC
Q ss_conf             32---788739999331554231177115566554060-016813320103523644279999348655----4413117
Q gi|254780270|r  429 RA---KRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDP-AQNSSFVDHYLEVEYDLSDVMFIMTANTLN----IPLPLMD  500 (820)
Q Consensus       429 ~~---~~~npv~~ldeidk~~~~~~gdp~~allevldp-~qn~~f~d~y~~~~~dls~v~fi~tan~~~----i~~~l~d  500 (820)
                      +.   .-...|+.|||+|.+.....    ..|++++.- +.|             -++|.+|+.+|+.+    +.+-+.+
T Consensus       116 ~~~~~~~~~~IvvLDEid~L~~~~~----~~LY~L~r~~~~~-------------~~~v~vi~i~n~~~~~~~ld~rv~s  178 (366)
T COG1474         116 DNLSKKGKTVIVILDEVDALVDKDG----EVLYSLLRAPGEN-------------KVKVSIIAVSNDDKFLDYLDPRVKS  178 (366)
T ss_pred             HHHHHCCCEEEEEECCHHHHHCCCC----CHHHHEECCCCCC-------------CEEEEEEEEECCHHHHHHHHHHHHH
T ss_conf             9777418759999764765415464----1455111247767-------------5379999973548899987566765


Q ss_pred             CE--EEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             24--7998258786899989998608989986257813132289999999731774102347888799998987654211
Q gi|254780270|r  501 RM--EIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVK  578 (820)
Q Consensus       501 rm--e~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~  578 (820)
                      |+  +-|.+++|+.+|=..|-++      ..+.|+.+  -.++++++..+...+..++|  +..+-| .+||.++ ++++
T Consensus       179 ~l~~~~I~F~pY~a~el~~Il~~------R~~~~~~~--~~~~~~vl~lia~~~a~~~G--DAR~ai-dilr~A~-eiAe  246 (366)
T COG1474         179 SLGPSEIVFPPYTAEELYDILRE------RVEEGFSA--GVIDDDVLKLIAALVAAESG--DARKAI-DILRRAG-EIAE  246 (366)
T ss_pred             CCCCCEEEECCCCHHHHHHHHHH------HHHHHHCC--CCCCHHHHHHHHHHHHHCCC--CHHHHH-HHHHHHH-HHHH
T ss_conf             06876355289898999999999------99854046--87480399999998876186--477608-9999999-9865


Q ss_pred             CCCCEECCCHHHHHHH
Q ss_conf             7852012796786753
Q gi|254780270|r  579 NSDTTVSINENNLQDY  594 (820)
Q Consensus       579 ~~~~~~~i~~~~l~~~  594 (820)
                      ....+ +++.+.+...
T Consensus       247 ~~~~~-~v~~~~v~~a  261 (366)
T COG1474         247 REGSR-KVSEDHVREA  261 (366)
T ss_pred             HCCCC-CCCHHHHHHH
T ss_conf             40788-5370047889


No 86 
>pfam00493 MCM MCM2/3/5 family.
Probab=99.04  E-value=6.4e-09  Score=86.38  Aligned_cols=201  Identities=23%  Similarity=0.330  Sum_probs=111.7

Q ss_pred             HHHHHHHHCHHHHHHHHHHHHHHHHHC--C---CCCCC-EEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHH
Q ss_conf             877665201168999999999999842--4---44673-59986056565027999999770882499861888888883
Q gi|254780270|r  335 RILDQDHFGLEKVKERIIEYLAVQMRV--I---KNKGL-ILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADI  408 (820)
Q Consensus       335 ~iLd~~hyGl~~vK~rile~lav~~~~--~---~~~g~-il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i  408 (820)
                      +.+--..||++.||.-|+=.|.=+..+  +   ..+|. -++|+|-||||||.|.|.+++...|--+. +--|.. .+.+
T Consensus        20 ~siaP~i~G~~~vK~ai~l~l~gg~~~~~~~~~~~Rg~ihiLLvGdPG~gKSqlLk~~~~~~pr~~~t-sg~~ss-~~GL   97 (327)
T pfam00493        20 RSIAPSIYGHEDVKKAILLQLFGGVKKNLPDGTRLRGDINVLLVGDPGTAKSQLLKYVAKLAPRAVYT-SGKGSS-AAGL   97 (327)
T ss_pred             HHHCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHCCCCEEE-CCCCCC-CCCC
T ss_conf             98597124987999999999808987658888620365118984699815609999999868870883-177665-6776


Q ss_pred             CC--------CCCCCCCCCCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCC
Q ss_conf             56--------3200145671289999983278873999933155423117711556655406001681332010352364
Q gi|254780270|r  409 RG--------HRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDL  480 (820)
Q Consensus       409 ~g--------h~~ty~ga~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dl  480 (820)
                      .+        ..++.   -+|-+|      -..+.|.++||+||++...+    +||+|..  ||..--.+.= ++.+-|
T Consensus        98 Ta~~~~d~~~~~~~l---eaGalv------lAd~Gv~cIDEfdk~~~~d~----saL~EAM--EqqtVsIaKa-Gi~~tL  161 (327)
T pfam00493        98 TAAVVRDPDTGEWTL---EAGALV------LADGGVCCIDEFDKMNEEDR----VAIHEAM--EQQTISIAKA-GIVATL  161 (327)
T ss_pred             EEEEEEECCCCCEEE---ECCCEE------ECCCCEEEEECCCCCCHHHH----HHHHHHH--HHCEEEEECC-CEEEEE
T ss_conf             158998068883698---368477------55898278500555887679----9999999--8681776338-538972


Q ss_pred             -CCEEEEEECCCC--------------CCCHHHCCCEEEEEEC-CCCH-HHHHHHHHHHHH-----------------HH
Q ss_conf             -427999934865--------------5441311724799825-8786-899989998608-----------------98
Q gi|254780270|r  481 -SDVMFIMTANTL--------------NIPLPLMDRMEIIRIA-GYTE-EEKLQIAKNHLV-----------------KK  526 (820)
Q Consensus       481 -s~v~fi~tan~~--------------~i~~~l~drme~i~~~-~y~~-~ek~~i~~~~l~-----------------p~  526 (820)
                       .++..|||||..              ++|+||+||...|.+- +|.. +.-..||+.-+-                 +.
T Consensus       162 ~ar~sVlAaaNP~~g~yd~~~~~~~ni~Lp~~lLsRFDLif~l~D~~~~~~D~~ia~~i~~~~~~~~~~~~~~~~~~~~~  241 (327)
T pfam00493       162 NARCSVLAAANPIFGRYDPKKSVAENINLPPPLLSRFDLIFVLLDKPDEEKDEELAKHIVDLHRHGEEEEIETEDYVDPE  241 (327)
T ss_pred             CCCCEEEEEECCCCCCCCCCCCHHHHCCCCHHHHCCEEEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHH
T ss_conf             58717998527767737888898885589767745010798840689868899999999998744688655568879999


Q ss_pred             HHHHH-CCCC--CCCCCCHHHHHHHHHCCC
Q ss_conf             99862-5781--313228999999973177
Q gi|254780270|r  527 VLTEH-ALKQ--EECCISDGVLLDIIRLFT  553 (820)
Q Consensus       527 ~~~~~-~~~~--~~~~~~~~~i~~ii~~Yt  553 (820)
                      .++++ .+..  -.-.+++++.++|...|.
T Consensus       242 ~l~~yi~~ar~~~~P~ls~ea~~~i~~~y~  271 (327)
T pfam00493       242 LLRKYIAYARENIFPKLSDEAREKLVNYYV  271 (327)
T ss_pred             HHHHHHHHHHHHCCCCCCHHHHHHHHHHHH
T ss_conf             999999999852788779899999999999


No 87 
>KOG2028 consensus
Probab=99.04  E-value=2.1e-08  Score=82.52  Aligned_cols=207  Identities=21%  Similarity=0.345  Sum_probs=129.9

Q ss_pred             HHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCC---EEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHH---HCC
Q ss_conf             984244467359986056565027999999770882---49986188888888356320014567128999998---327
Q gi|254780270|r  358 QMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQ---YVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLK---RAK  431 (820)
Q Consensus       358 ~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~---f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~---~~~  431 (820)
                      +++..+..-|-+-|-|||||||||||++||..-..+   |+.+|--... ..+.|+            |+..-+   .-.
T Consensus       154 rs~ieq~~ipSmIlWGppG~GKTtlArlia~tsk~~SyrfvelSAt~a~-t~dvR~------------ife~aq~~~~l~  220 (554)
T KOG2028         154 RSLIEQNRIPSMILWGPPGTGKTTLARLIASTSKKHSYRFVELSATNAK-TNDVRD------------IFEQAQNEKSLT  220 (554)
T ss_pred             HHHHHCCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCEEEEEEECCCCC-HHHHHH------------HHHHHHHHHHHH
T ss_conf             9998708887058866998765889999986057774279997414566-188999------------999988787652


Q ss_pred             CCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEEC-CCCCCCCCEEEE--EECCCC-CCCHHHCCCEEEEEE
Q ss_conf             8873999933155423117711556655406001681332010-352364427999--934865-544131172479982
Q gi|254780270|r  432 RSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYL-EVEYDLSDVMFI--MTANTL-NIPLPLMDRMEIIRI  507 (820)
Q Consensus       432 ~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~-~~~~dls~v~fi--~tan~~-~i~~~l~drme~i~~  507 (820)
                      -..-|+++|||-..                    |+.-+|-|| -|.  -..++||  +|-|-. +...||+.|--|+-+
T Consensus       221 krkTilFiDEiHRF--------------------NksQQD~fLP~VE--~G~I~lIGATTENPSFqln~aLlSRC~VfvL  278 (554)
T KOG2028         221 KRKTILFIDEIHRF--------------------NKSQQDTFLPHVE--NGDITLIGATTENPSFQLNAALLSRCRVFVL  278 (554)
T ss_pred             CCEEEEEEHHHHHH--------------------HHHHHHCCCCEEC--CCCEEEEECCCCCCCCCHHHHHHHCCCEEEE
T ss_conf             44069873776553--------------------2321100342130--6706998536689760112778731606673


Q ss_pred             CCCCHHHHHHHHHH--HHHHHHH-HHHCCCCCCCCCCHHHHHHHHHCCCCC--CHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             58786899989998--6089899-862578131322899999997317741--023478887999989876542117852
Q gi|254780270|r  508 AGYTEEEKLQIAKN--HLVKKVL-TEHALKQEECCISDGVLLDIIRLFTHE--AGVRSFERALMKIARKAVTKIVKNSDT  582 (820)
Q Consensus       508 ~~y~~~ek~~i~~~--~l~p~~~-~~~~~~~~~~~~~~~~i~~ii~~Yt~E--aGvR~l~r~i~~i~r~~~~~~~~~~~~  582 (820)
                      ...+.++-..|-.+  -++-+.- ---++....+.+++.+|+++...-.-.  ++.--||-.+.-.|-      -.++..
T Consensus       279 ekL~~n~v~~iL~raia~l~dser~~~~l~n~s~~ve~siidyla~lsdGDaR~aLN~Lems~~m~~t------r~g~~~  352 (554)
T KOG2028         279 EKLPVNAVVTILMRAIASLGDSERPTDPLPNSSMFVEDSIIDYLAYLSDGDARAALNALEMSLSMFCT------RSGQSS  352 (554)
T ss_pred             CCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHH------HCCCCC
T ss_conf             36888999999999987632102568899983124568899999870473188887789999998875------247765


Q ss_pred             EECCCHHHHHHHHCCCCCCCCCH
Q ss_conf             01279678675305200033200
Q gi|254780270|r  583 TVSINENNLQDYLGVPRYKYGKI  605 (820)
Q Consensus       583 ~~~i~~~~l~~~lg~~~~~~~~~  605 (820)
                      ...++.+++++.|.....-+++.
T Consensus       353 ~~~lSidDvke~lq~s~~~YDr~  375 (554)
T KOG2028         353 RVLLSIDDVKEGLQRSHILYDRA  375 (554)
T ss_pred             CCEECHHHHHHHHHHCCCEECCC
T ss_conf             64002888999985312000455


No 88 
>PRK07764 DNA polymerase III subunits gamma and tau; Validated
Probab=99.02  E-value=9e-09  Score=85.25  Aligned_cols=188  Identities=21%  Similarity=0.285  Sum_probs=122.5

Q ss_pred             HHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCC-------------EEEEECCC--CCC
Q ss_conf             520116899999999999984244467359986056565027999999770882-------------49986188--888
Q gi|254780270|r  340 DHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQ-------------YVRMSLGG--VYD  404 (820)
Q Consensus       340 ~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~-------------f~~islgg--~~d  404 (820)
                      +.-|.+.|++.+...+     ..+.-+.-.+|.||-||||||+|+.+|++||-.             +..|.-||  --|
T Consensus        16 eviGQe~v~~~L~~Ai-----~~gri~HAYLFsGprG~GKTt~ARilAkaLNC~~~~~~~PCg~C~sC~~i~~g~~~~~D   90 (775)
T PRK07764         16 EVVGQEHVTEPLSTAL-----DSGRINHAYLFSGPRGCGKTSSARILARSLNCAQGPTSTPCGVCDSCVALAPGGPGSLD   90 (775)
T ss_pred             HHCCCHHHHHHHHHHH-----HCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCCCC
T ss_conf             6228599999999999-----81997633762378887888999999999668999998988887637888638988886


Q ss_pred             HHHHCCCCCCCCCCCCHHHHHHHHHC------CCCCEEEEEECHHHHHHHCCCCHHHHHHHHCC-CCCCCCEEEEECCCC
Q ss_conf             88835632001456712899999832------78873999933155423117711556655406-001681332010352
Q gi|254780270|r  405 EADIRGHRRTYIGSMPGRIIQSLKRA------KRSNPLLLLDEIDKMGSDLRGDPSAALLEVLD-PAQNSSFVDHYLEVE  477 (820)
Q Consensus       405 ~~~i~gh~~ty~ga~pg~ii~~l~~~------~~~npv~~ldeidk~~~~~~gdp~~allevld-p~qn~~f~d~y~~~~  477 (820)
                      .-||.+-+.+=|.-     |..|+..      ...--||++||.+.|+..-    .+|||.+|. |-             
T Consensus        91 viEiDAAS~~gVdd-----iReL~e~~~y~P~~~ryKVyIIDEaHmls~~a----fNALLKtLEEPP-------------  148 (775)
T PRK07764         91 VVEIDAASHGGVDD-----ARELRERAFFAPAQSRYRIFIIDEAHMVTTAG----FNALLKIVEEPP-------------  148 (775)
T ss_pred             EEEECCCCCCCHHH-----HHHHHHHCCCCCCCCCEEEEEEECHHHHCHHH----HHHHHHHHCCCC-------------
T ss_conf             68731565568899-----99999854768767863599985354407999----999988622786-------------


Q ss_pred             CCCCCEEEEEECCCCC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCC
Q ss_conf             3644279999348655-441311724799825878689998999860898998625781313228999999973177410
Q gi|254780270|r  478 YDLSDVMFIMTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEA  556 (820)
Q Consensus       478 ~dls~v~fi~tan~~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~Ea  556 (820)
                         .+|+||+.--..+ ||...+.|-....+.--+.++-..    | +-+++     ..+.|.++++++..|++.  -+-
T Consensus       149 ---~hvvFIlaTTep~kip~TI~SRcq~f~Fr~i~~~~~~~----~-l~~i~-----~~E~i~~~~~al~li~r~--~~G  213 (775)
T PRK07764        149 ---EHLIFIFATTEPEKVIGTIRSRTHHYPFRLVPPGTMRP----Y-LERIC-----AQEGVVVDDAVLPLVIRA--GGG  213 (775)
T ss_pred             ---CCEEEEEECCCHHHCCHHHHHHCCCCCCCCCCHHHHHH----H-HHHHH-----HHCCCCCCHHHHHHHHHH--CCC
T ss_conf             ---46279995487354716776410234526699999999----9-99999-----983998798999999998--289


Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             2347888799998
Q gi|254780270|r  557 GVRSFERALMKIA  569 (820)
Q Consensus       557 GvR~l~r~i~~i~  569 (820)
                      ++|+--..|..++
T Consensus       214 s~RDalS~ldQl~  226 (775)
T PRK07764        214 SPRDTLSVLDQLL  226 (775)
T ss_pred             CHHHHHHHHHHHH
T ss_conf             6676899999998


No 89 
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms]
Probab=99.02  E-value=8.1e-10  Score=93.16  Aligned_cols=97  Identities=31%  Similarity=0.530  Sum_probs=84.2

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHCCCCCC--CCEEEEEEEECCEEEEECCHHHHHHHHHHCCCCEEECCHHHH-------
Q ss_conf             88478887306899999999983688875--610663685030250006568999999970996998036775-------
Q gi|254780270|r  687 GATPKDGPSAGIAMATAIVSIMTCIPVYK--NVAMTGELTLRGRVLPIGGLKEKLLAALRAGVTKVLIPEENI-------  757 (820)
Q Consensus       687 Ga~pKDGPSAGi~i~tal~S~~~~~~v~~--~iAmTGEitl~G~VlpiGGi~eK~laA~raGi~~viiP~~N~-------  757 (820)
                      ..+  +|||||.-++.++++-++.--.+.  .||=||-|.--|+|-|||||..|+.||.+||..-++.|.+|-       
T Consensus       230 ~~I--GGPSAGLMFSL~Iy~qlt~~DL~~g~~IAGTGTI~~DG~VG~IGGI~qKvvAA~~AGA~vFf~P~~~~~e~~s~s  307 (342)
T COG3480         230 ENI--GGPSAGLMFSLAIYDQLTKGDLTGGRFIAGTGTIEVDGKVGPIGGIDQKVVAAAKAGADVFFVPADNCAEEMSDS  307 (342)
T ss_pred             CCC--CCCCHHHEEEHHHHHHCCCCCCCCCEEEECCEEECCCCCCCCCCCHHHHHHHHHHCCCCEEEECCCCCCHHHCCC
T ss_conf             447--997543335298886405311358669841113346883357454767767787659859984187620220138


Q ss_pred             --HHHHHCCHHHHCCCEEEECCCHHHHHHH
Q ss_conf             --5077614887709799981939998887
Q gi|254780270|r  758 --KDLMDIPENVKNGLEIIPVSFMGEVLKH  785 (820)
Q Consensus       758 --~d~~~ip~~~~~~l~~~~v~~~~evl~~  785 (820)
                        ..-..--+.+..+|+++||.+++|.++.
T Consensus       308 ny~~a~~~ak~l~t~mkivpv~T~q~aldy  337 (342)
T COG3480         308 NYDEALVAAEDLSTAMKIVPVKTLQEALDY  337 (342)
T ss_pred             CHHHHHHHHHHHCCCCEEEEECHHHHHHHH
T ss_conf             888889988754036247851000326667


No 90 
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR005938    The ATPase Cdc48 is required for membrane fusion and protein degradation. It possesses chaperone-like activities and can functionally interact with Hsc70. Yeast CDC48 plays a role in cell division control whereas eukaryotic homologues are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus.; GO: 0016787 hydrolase activity.
Probab=99.00  E-value=2.1e-07  Score=74.81  Aligned_cols=217  Identities=27%  Similarity=0.393  Sum_probs=141.3

Q ss_pred             HHHHHCHHHHHHHHHHHHHHHHHC--------CCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHC
Q ss_conf             665201168999999999999842--------444673599860565650279999997708824998618888888835
Q gi|254780270|r  338 DQDHFGLEKVKERIIEYLAVQMRV--------IKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIR  409 (820)
Q Consensus       338 d~~hyGl~~vK~rile~lav~~~~--------~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~  409 (820)
                      =+|.-||+++|+.+-|-+- +-++        +-..+.-.+|.||||+|||-|||++|.--+-.|  |++-|-.=-|   
T Consensus       540 W~diGGlee~kq~lreave-WPlk~~~~f~k~G~~PP~Gvll~GPPGtGktllakava~es~anf--i~v~GPe~ls---  613 (980)
T TIGR01243       540 WEDIGGLEEVKQELREAVE-WPLKAPEVFEKLGIRPPKGVLLFGPPGTGKTLLAKAVATESGANF--IAVRGPEILS---  613 (980)
T ss_pred             CCCCCCHHHHHHHHHHHHH-CCCCHHHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHHCCCCCE--EEECCCHHHH---
T ss_conf             0014667899999987752-344405899860788997348746898616888887740145646--7740731223---


Q ss_pred             CCCCCCCCCCCHHHHHHHHHCCCCCE-EEEEECHHHHHHHCCCCH----------HHHHHHHCCCCCCCCEEEEECCCCC
Q ss_conf             63200145671289999983278873-999933155423117711----------5566554060016813320103523
Q gi|254780270|r  410 GHRRTYIGSMPGRIIQSLKRAKRSNP-LLLLDEIDKMGSDLRGDP----------SAALLEVLDPAQNSSFVDHYLEVEY  478 (820)
Q Consensus       410 gh~~ty~ga~pg~ii~~l~~~~~~np-v~~ldeidk~~~~~~gdp----------~~allevldp~qn~~f~d~y~~~~~  478 (820)
                          -+||.---+|-+..++|....| |+++||||-+... ||.-          .+-||.=+|-             =-
T Consensus       614 ----kWvGese~~ir~if~~arq~aP~~~f~deidaiaP~-rG~~~~~~~vtd~~~nqll~e~dG-------------~~  675 (980)
T TIGR01243       614 ----KWVGESEKAIREIFRKARQAAPAIIFFDEIDAIAPA-RGASLDEKGVTDRIVNQLLTELDG-------------LE  675 (980)
T ss_pred             ----HHHCHHHHHHHHHHHHHHHCCCEEEEEECHHHHCCC-CCCCCCCCCHHHHHHHHHHHHHHC-------------CC
T ss_conf             ----440324799999999864128737873021110541-244210010268999999986404-------------43


Q ss_pred             CCCCEEEEEECCCCC-CCHHH-----CCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCC
Q ss_conf             644279999348655-44131-----172479982587868999899986089899862578131322899999997317
Q gi|254780270|r  479 DLSDVMFIMTANTLN-IPLPL-----MDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLF  552 (820)
Q Consensus       479 dls~v~fi~tan~~~-i~~~l-----~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Y  552 (820)
                      ..|+|..|+..|-.+ +.++|     +||+  |-+|.--.+-..+|.+=|--     ...| .+++.+  +-+..-.+.|
T Consensus       676 ~~~~vvvi~atnrPdi~dPallrPGr~dr~--i~vP~Pd~~ar~~ifk~ht~-----~~~l-~~dv~l--~~la~~teGy  745 (980)
T TIGR01243       676 ELSDVVVIAATNRPDILDPALLRPGRLDRL--ILVPAPDEEARLEIFKIHTR-----SMPL-AEDVDL--EELAKKTEGY  745 (980)
T ss_pred             CCCCEEEEEECCCCCCCCCCCCCCCCCCEE--EEECCCCHHHHHHHHHHHHC-----CCCC-CCCCCH--HHHHHHHCCC
T ss_conf             436658986158874236100488741216--86059855676767655311-----1353-013438--9998651687


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHCCC-CCEE--CCCHHHHHHHHC
Q ss_conf             7410234788879999898765421178-5201--279678675305
Q gi|254780270|r  553 THEAGVRSFERALMKIARKAVTKIVKNS-DTTV--SINENNLQDYLG  596 (820)
Q Consensus       553 t~EaGvR~l~r~i~~i~r~~~~~~~~~~-~~~~--~i~~~~l~~~lg  596 (820)
                      |--        .|.++||.+++.-+... ..++  .+....+..|+.
T Consensus       746 tGa--------di~a~~rea~~~~~r~~~~~~~~~~~~~~~~~~~~~  784 (980)
T TIGR01243       746 TGA--------DIEAVVREAALAALREVVGKPWDIEVKLRELINYLQ  784 (980)
T ss_pred             CCH--------HHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHH
T ss_conf             632--------299999999999999973450245678999999998


No 91 
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional
Probab=98.99  E-value=3.6e-08  Score=80.72  Aligned_cols=190  Identities=16%  Similarity=0.319  Sum_probs=120.1

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHCC---CEEEEECCCCCC---HHHHCCCCCC-CCCC---CCHHHHHHHHHCC
Q ss_conf             4446735998605656502799999977088---249986188888---8883563200-1456---7128999998327
Q gi|254780270|r  362 IKNKGLILCFVGPPGVGKTSLAQSIAKATGR---QYVRMSLGGVYD---EADIRGHRRT-YIGS---MPGRIIQSLKRAK  431 (820)
Q Consensus       362 ~~~~g~il~l~gppgvGKts~~~sia~al~r---~f~~islgg~~d---~~~i~gh~~t-y~ga---~pg~ii~~l~~~~  431 (820)
                      .....||| +.|.+||||+.+|+.|...=.|   ||+.|.++++.+   ++++-||... +.|+   .+|++-+      
T Consensus        26 A~~~~pVL-I~GE~GtGK~~~Ar~IH~~S~r~~~pfi~v~C~~l~~~~~e~~LFG~~~g~~~~~~~~~~g~le~------   98 (325)
T PRK11608         26 APLDKPVL-IIGERGTGKELIASRLHYLSSRWQGPFISLNCAALNENLLDSELFGHEAGAFTGAQKRHPGRFER------   98 (325)
T ss_pred             HCCCCCEE-EECCCCCCHHHHHHHHHHCCCCCCCCCEEEECCCCCHHHHHHHHCCCCCCCCCCCCCCCCCHHHC------
T ss_conf             68899989-88989837999999999658867999778877989977889987277556767753246873435------


Q ss_pred             CCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCC-C-C-C-----CHHHCCCE-
Q ss_conf             887399993315542311771155665540600168133201035236442799993486-5-5-4-----41311724-
Q gi|254780270|r  432 RSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANT-L-N-I-----PLPLMDRM-  502 (820)
Q Consensus       432 ~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~-~-~-i-----~~~l~drm-  502 (820)
                      ..+..++||||+.++...+.    .||.+|+   +..|.-.==.-+.. .+|=+|||.|. + . +     -.-|..|+ 
T Consensus        99 a~gGTL~L~eI~~l~~~~Q~----~Ll~~l~---~~~~~r~g~~~~~~-~~~RiIa~t~~~l~~lv~~g~fr~dLy~rL~  170 (325)
T PRK11608         99 ADGGTLFLDELATAPMLVQE----KLLRVIE---YGELERVGGSQPLQ-VNVRLVCATNADLPAMVNEGTFRADLLDRLA  170 (325)
T ss_pred             CCCCEEEEECHHHCCHHHHH----HHHHHHH---CCCEEECCCCCCCC-CCEEEEECCCHHHHHHHHHCCCHHHHHHHHH
T ss_conf             68986997374547999999----9999986---49088579987665-6468871332208999983956799985653


Q ss_pred             -EEEEECCCCH--HHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHH
Q ss_conf             -7998258786--899989998608989986257813132289999999731774102347888799998
Q gi|254780270|r  503 -EIIRIAGYTE--EEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIA  569 (820)
Q Consensus       503 -e~i~~~~y~~--~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~  569 (820)
                       ..|++|+--.  ++=..++..| +-+...+.|... .-.|+++|++. ...|.+---||+|+..+...+
T Consensus       171 ~~~I~lPpLReR~eDI~~L~~~f-l~~~~~~~~~~~-~~~~s~~a~~~-L~~y~WPGNvrEL~n~ierav  237 (325)
T PRK11608        171 FDVVQLPPLRERQSDIMLMAEHF-AIQMCRELGLPL-FPGFTERARET-LLNYRWPGNIRELKNVVERSV  237 (325)
T ss_pred             HHHCCCCCHHHCCCCHHHHHHHH-HHHHHHHCCCCC-CCCCCHHHHHH-HHCCCCCCHHHHHHHHHHHHH
T ss_conf             01115868454710199999999-999999829998-88889999999-961999965999999999999


No 92 
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional
Probab=98.99  E-value=2e-08  Score=82.69  Aligned_cols=202  Identities=21%  Similarity=0.370  Sum_probs=132.5

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHC---CCEEEEECCCCCC---HHHHCCCCCC-CCCCC---CHHHHHHHHHCCC
Q ss_conf             44673599860565650279999997708---8249986188888---8883563200-14567---1289999983278
Q gi|254780270|r  363 KNKGLILCFVGPPGVGKTSLAQSIAKATG---RQYVRMSLGGVYD---EADIRGHRRT-YIGSM---PGRIIQSLKRAKR  432 (820)
Q Consensus       363 ~~~g~il~l~gppgvGKts~~~sia~al~---r~f~~islgg~~d---~~~i~gh~~t-y~ga~---pg~ii~~l~~~~~  432 (820)
                      ....||| +.|++||||+.+|+.|...=.   .||+.+.++++.+   ++++=||.+. |.||.   +|.+-++      
T Consensus       159 ~~~~pVL-I~GE~GTGK~~~Ar~IH~~S~r~~~pfi~vnC~~~~~~~~e~eLFG~~~gaf~ga~~~~~g~~e~a------  231 (469)
T PRK10923        159 RSSISVL-INGESGTGKELVAHALHRHSPRAKAPFIALNMAAIPKDLIESELFGHEKGAFTGANTIRQGRFEQA------  231 (469)
T ss_pred             CCCCCEE-EECCCCCCHHHHHHHHHHCCCCCCCCCEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCHHHC------
T ss_conf             8899789-989898269999999997488779995787678899778999970876678788642458736643------


Q ss_pred             CCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEE--ECCCCCCCCCEEEEEECCC-C-C------CCHHHCCCE
Q ss_conf             8739999331554231177115566554060016813320--1035236442799993486-5-5------441311724
Q gi|254780270|r  433 SNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDH--YLEVEYDLSDVMFIMTANT-L-N------IPLPLMDRM  502 (820)
Q Consensus       433 ~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~--y~~~~~dls~v~fi~tan~-~-~------i~~~l~drm  502 (820)
                      .|..++||||+.++.+.+.    .||.+|.   +..|..-  .-.++.   +|-+|||.|. + +      .-.-|..|+
T Consensus       232 ~~GTLfLdeI~~L~~~~Q~----kLl~~L~---~~~~~~~g~~~~~~~---d~RiIaat~~~L~~~v~~g~Fr~dLyyrL  301 (469)
T PRK10923        232 DGGTLFLDEIGDMPLDVQT----RLLRVLA---DGQFYRVGGYAPVKV---DVRIIAATHQNLEQRVQEGKFREDLFHRL  301 (469)
T ss_pred             CCCCEEHHHHHHCCHHHHH----HHHHHHH---CCCEEECCCCCEEEE---CCEEEEECCCCHHHHHHHCCHHHHHHHHH
T ss_conf             8992656636648999999----9999985---593785799851221---43799707879999866081779999864


Q ss_pred             EE--EEECCCCH--HHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             79--98258786--899989998608989986257813132289999999731774102347888799998987654211
Q gi|254780270|r  503 EI--IRIAGYTE--EEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVK  578 (820)
Q Consensus       503 e~--i~~~~y~~--~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~  578 (820)
                      -+  |++|+-..  ++-..++ +|++-+..++.|.  ....|+++++.. ...|.+-.-||+|+..+..++--     ..
T Consensus       302 ~~~~I~lPpLReR~eDI~~L~-~~fl~~~~~~~~~--~~~~~s~~a~~~-L~~y~WPGNvrEL~n~ier~~~~-----~~  372 (469)
T PRK10923        302 NVIRVHLPPLRERREDIPRLA-RHFLQVAARELGV--EAKLLHPETEAA-LTRLAWPGNVRQLENTCRWLTVM-----AA  372 (469)
T ss_pred             HHHCCCCCCHHHCHHHHHHHH-HHHHHHHHHHCCC--CCCCCCHHHHHH-HHCCCCCCHHHHHHHHHHHHHHH-----CC
T ss_conf             424015846544653499999-9999999998599--978789999999-97499998799999999999985-----79


Q ss_pred             CCCCEECCCHHHHHHH
Q ss_conf             7852012796786753
Q gi|254780270|r  579 NSDTTVSINENNLQDY  594 (820)
Q Consensus       579 ~~~~~~~i~~~~l~~~  594 (820)
                      +.    .|+.+++..-
T Consensus       373 ~~----~i~~~dl~~~  384 (469)
T PRK10923        373 GQ----EVLIQDLPGE  384 (469)
T ss_pred             CC----CCCHHHCCHH
T ss_conf             98----2547757298


No 93 
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members of this protein family are Hda (Homologous to DnaA). These proteins are about half the length of DnaA and homologous over length of Hda. In the model species Escherichia coli, the initiation of DNA replication requires DnaA bound to ATP rather than ADP; Hda helps facilitate the conversion of DnaA-ATP to DnaA-ADP.
Probab=98.99  E-value=4.4e-08  Score=80.05  Aligned_cols=186  Identities=16%  Similarity=0.256  Sum_probs=119.5

Q ss_pred             HHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC---CEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCC
Q ss_conf             998424446735998605656502799999977088---24998618888888835632001456712899999832788
Q gi|254780270|r  357 VQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGR---QYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRS  433 (820)
Q Consensus       357 v~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r---~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~  433 (820)
                      +..+.+...++.|.++||+|.|||.|..+++.....   ....+++....+      +        .--+++++    ..
T Consensus        29 l~~~~~~~~~~~l~i~G~~GsGKTHLl~a~~~~~~~~~~~~~yl~~~~~~~------~--------~~~~l~~l----~~   90 (226)
T TIGR03420        29 LRQLAAGKGDRFLYLWGESGSGKSHLLQAACAAAEERGKSAIYLPLAELAQ------A--------DPEVLEGL----EQ   90 (226)
T ss_pred             HHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEECHHHHHH------H--------HHHHHHHC----CC
T ss_conf             998764668886999899999889999999999862699579952999877------5--------39999727----44


Q ss_pred             CEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCC----CCCC-HHHCCC---EEEE
Q ss_conf             7399993315542311771155665540600168133201035236442799993486----5544-131172---4799
Q gi|254780270|r  434 NPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANT----LNIP-LPLMDR---MEII  505 (820)
Q Consensus       434 npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~----~~i~-~~l~dr---me~i  505 (820)
                      ..++++|.||.+....  +-..+|.++++--+++             ++ -.+.|++.    ++.- +-|+.|   +-++
T Consensus        91 ~d~l~iDDi~~i~~~~--~~e~~lF~l~N~~~~~-------------~~-~ilits~~~p~~l~~~l~dL~SRl~~~~~~  154 (226)
T TIGR03420        91 ADLVCLDDVEAIAGQP--EWQEALFHLYNRVREA-------------GG-RLLIAGRAAPAQLPLRLPDLRTRLAWGLVF  154 (226)
T ss_pred             CCEEEEECHHHHCCCH--HHHHHHHHHHHHHHHH-------------CC-EEEEECCCCHHHCCCCHHHHHHHHHCCCEE
T ss_conf             8999996633343783--7899999999999865-------------28-289867888232032017799999688568


Q ss_pred             EECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEC
Q ss_conf             82587868999899986089899862578131322899999997317741023478887999989876542117852012
Q gi|254780270|r  506 RIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDTTVS  585 (820)
Q Consensus       506 ~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~~~~~~~  585 (820)
                      ++.....+++..|.+++.     ..     .++.++++++.||+++.+|.  +|.|+..+.++-+.....       +-.
T Consensus       155 ~I~~pdd~~~~~iL~k~~-----~~-----r~i~i~~~vi~yl~~r~~R~--~~~l~~~l~~Ld~~sl~~-------kr~  215 (226)
T TIGR03420       155 QLPPLSDEEKIAALQSRA-----AR-----RGLQLPDEVADYLLRHGSRD--MGSLMALLDALDRASLAA-------KRK  215 (226)
T ss_pred             ECCCCCHHHHHHHHHHHH-----HH-----CCCCCCHHHHHHHHHHCCCC--HHHHHHHHHHHHHHHHHH-------CCC
T ss_conf             527999999999999999-----98-----59988999999999863798--999999999999999980-------899


Q ss_pred             CCHHHHHHHH
Q ss_conf             7967867530
Q gi|254780270|r  586 INENNLQDYL  595 (820)
Q Consensus       586 i~~~~l~~~l  595 (820)
                      ||-..+++.|
T Consensus       216 ITi~l~kevL  225 (226)
T TIGR03420       216 ITIPFVKEVL  225 (226)
T ss_pred             CCHHHHHHHH
T ss_conf             9999999984


No 94 
>TIGR01242 26Sp45 26S proteasome subunit P45 family; InterPro: IPR005937    Intracellular proteins, including short-lived proteins such as cyclin, Mos, Myc, p53, NF-kappaB, and IkappaB, are degraded by the ubiquitin-proteasome system. The 26S proteasome (a 2 MDa complex) is made up of two subcomplexes: the 20S proteasome and the regulatory complex. The former is a 700 kDa cylindrical protease complex consisting of four stacks of heptameric rings with 28 subunits (i.e., 7777) with molecular masses of about 20-35 kDa, whereas the latter is a 700-1000 kDa complex consisting of at least 18 subunits with molecular masses of 28-110 kDa, including 6 putative ATPases (Rpt1-Rpt6) and 12 non-ATPase subunits (Rpn1-12).     Members of the 26S proteasome subunit P45 family: ATPase p45/Sug1/Rpt6 may be phosphorylated within the proteasome. This phosphorylation event may play a key role in ATP-dependent proteolysis because a good correlation exists between the inhibition pattern of protein kinase inhibitors against the phosphorylation of p45 and that against the ATP-dependent proteolytic activity , .   More information about these protein can be found at Protein of the Month: AAA ATPases .; GO: 0016787 hydrolase activity, 0030163 protein catabolic process, 0005634 nucleus, 0005737 cytoplasm.
Probab=98.98  E-value=8.3e-09  Score=85.50  Aligned_cols=175  Identities=27%  Similarity=0.410  Sum_probs=119.0

Q ss_pred             HHHHHHHHHCHHHHHHHHHHHHHHHHHCCCC-------CCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHH
Q ss_conf             9877665201168999999999999842444-------673599860565650279999997708824998618888888
Q gi|254780270|r  334 IRILDQDHFGLEKVKERIIEYLAVQMRVIKN-------KGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEA  406 (820)
Q Consensus       334 ~~iLd~~hyGl~~vK~rile~lav~~~~~~~-------~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~  406 (820)
                      =++-=+|.=||++==+-|-|.+..=..+|..       ...-++|+||||+|||-|||++|.-.+--|.|+-      .|
T Consensus       117 P~V~y~diGGL~~Q~~E~~E~v~LPlk~PeLF~~vGI~PPKGvLLyGPPGtGKTLlAKAvA~et~ATFIrvV------gS  190 (364)
T TIGR01242       117 PNVSYEDIGGLEKQIREIREAVELPLKKPELFEEVGIEPPKGVLLYGPPGTGKTLLAKAVAHETNATFIRVV------GS  190 (364)
T ss_pred             CCEEEECCCCHHHHHHHHHHHHHCCCCCCHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHCCCCCEEEEEE------HH
T ss_conf             823340267878999999888734688831677628898986570075797688999986314551268860------44


Q ss_pred             HHCCCCCCCCCCCCHHHHHHHHHCCCCCE-EEEEECHHHHHH-----HCCCCH--HHHHHHHCCCCCCCCEEEEECCCCC
Q ss_conf             83563200145671289999983278873-999933155423-----117711--5566554060016813320103523
Q gi|254780270|r  407 DIRGHRRTYIGSMPGRIIQSLKRAKRSNP-LLLLDEIDKMGS-----DLRGDP--SAALLEVLDPAQNSSFVDHYLEVEY  478 (820)
Q Consensus       407 ~i~gh~~ty~ga~pg~ii~~l~~~~~~np-v~~ldeidk~~~-----~~~gdp--~~allevldp~qn~~f~d~y~~~~~  478 (820)
                      |+-   +-|+|----.+-.-.+-|+..-| +|++||||-+++     +..||=  .-+|+-+|--  =+.|-        
T Consensus       191 ElV---~KyIGEGArLV~~~F~LAkEKaPsIiFIDEiDAiaakR~~~~TsGdREV~RTlmQLLAE--lDGFd--------  257 (364)
T TIGR01242       191 ELV---RKYIGEGARLVREVFELAKEKAPSIIFIDEIDAIAAKRVDSSTSGDREVQRTLMQLLAE--LDGFD--------  257 (364)
T ss_pred             HHH---HHHHCCHHHHHHHHHHHHHCCCCCEEEEECHHHHHHHHCCCCCCCCHHHHHHHHHHHHH--HCCCC--------
T ss_conf             444---44413316899999998530698168610133354321146778731578899999975--24888--------


Q ss_pred             CCCCEEEEEECCCCC-CCHHH-----CCCEEEEEECCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             644279999348655-44131-----1724799825878689998999860898998
Q gi|254780270|r  479 DLSDVMFIMTANTLN-IPLPL-----MDRMEIIRIAGYTEEEKLQIAKNHLVKKVLT  529 (820)
Q Consensus       479 dls~v~fi~tan~~~-i~~~l-----~drme~i~~~~y~~~ek~~i~~~~l~p~~~~  529 (820)
                      ...+|=.|+..|-.| +++++     .||+  ||+|--+.+-.++|.+=|--.-.+.
T Consensus       258 ~rg~VkviaATNR~DilDPA~LRPGRFDR~--IEVPlP~~~GR~eIlkiHTr~~~la  312 (364)
T TIGR01242       258 PRGNVKVIAATNRPDILDPAILRPGRFDRI--IEVPLPDFEGRLEILKIHTRKMKLA  312 (364)
T ss_pred             CCCCEEEEEECCCCHHCCCCCCCCCCCCCE--EECCCCCCCCHHHHHHHHHCCCCCC
T ss_conf             767616887207620204321488861325--7316978322056655521000012


No 95 
>PRK05564 DNA polymerase III subunit delta'; Validated
Probab=98.97  E-value=2.3e-08  Score=82.11  Aligned_cols=143  Identities=20%  Similarity=0.300  Sum_probs=97.3

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCC-CCC
Q ss_conf             6520116899999999999984244467359986056565027999999770882499861888888883563200-145
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRT-YIG  417 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~t-y~g  417 (820)
                      +|.+|.+.+++++...+     ..+.-+.-+.|+||+|||||++|+.+|+++-.+-      +-      +.|--. .+.
T Consensus         4 ~~iiGq~~i~~~L~~~i-----~~~rl~HAyLF~Gp~G~GK~~~A~~~A~~ll~~~------~~------~~~~D~~~~~   66 (313)
T PRK05564          4 RTIIGHENIKNRIDNSI-----IKGKFSHASLIVGEDGIGKSILAKEIANKILGKS------EQ------REYVDIIEYK   66 (313)
T ss_pred             HHCCCHHHHHHHHHHHH-----HCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCC------CC------CCCCCEEEEE
T ss_conf             23268299999999999-----8799875043279998509999999999982899------77------8898658863


Q ss_pred             CCCHH---------HHHHHHHC--CCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEE
Q ss_conf             67128---------99999832--78873999933155423117711556655406001681332010352364427999
Q gi|254780270|r  418 SMPGR---------IIQSLKRA--KRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFI  486 (820)
Q Consensus       418 a~pg~---------ii~~l~~~--~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi  486 (820)
                      +--++         +++.+...  ....=|+++||.|+|+..    .++|||-.|             |-|=  ++++||
T Consensus        67 ~~~~~~I~vd~IR~l~~~~~~~p~~g~~KV~II~~ae~m~~~----AaNALLKtL-------------EEPP--~~t~fI  127 (313)
T PRK05564         67 PINKKSIGVDDIRNIIEEVNKKPYEGDKKVIIIYKSEKMTEQ----AQNAFLKTI-------------EEPP--KGVFII  127 (313)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEECCHHHHCHH----HHHHHHHCC-------------CCCC--CCEEEE
T ss_conf             322569998999999999840862589569998077775899----999984550-------------3689--985899


Q ss_pred             EECCCCC-CCHHHCCCEEEEEECCCCHHHHHH
Q ss_conf             9348655-441311724799825878689998
Q gi|254780270|r  487 MTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQ  517 (820)
Q Consensus       487 ~tan~~~-i~~~l~drme~i~~~~y~~~ek~~  517 (820)
                      .++++.+ +++..+.|--.+.+++-+.++-..
T Consensus       128 L~t~~~~~lLpTI~SRCQ~~~f~~l~~~~i~~  159 (313)
T PRK05564        128 LLCENLEQILDTIKSRCQIYKLNRLSKEDIEK  159 (313)
T ss_pred             EEECCHHHCCCHHHCCCEEEECCCCCHHHHHH
T ss_conf             86498354757787065356689989999999


No 96 
>PRK10365 transcriptional regulatory protein ZraR; Provisional
Probab=98.97  E-value=1.5e-08  Score=83.67  Aligned_cols=202  Identities=17%  Similarity=0.336  Sum_probs=129.0

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHC---CCEEEEECCCCCCH---HHHCCCCCC-CCCC---CCHHHHHHHHHCCC
Q ss_conf             44673599860565650279999997708---82499861888888---883563200-1456---71289999983278
Q gi|254780270|r  363 KNKGLILCFVGPPGVGKTSLAQSIAKATG---RQYVRMSLGGVYDE---ADIRGHRRT-YIGS---MPGRIIQSLKRAKR  432 (820)
Q Consensus       363 ~~~g~il~l~gppgvGKts~~~sia~al~---r~f~~islgg~~d~---~~i~gh~~t-y~ga---~pg~ii~~l~~~~~  432 (820)
                      ....|+| +.|.+||||..+|+.|...-.   .||+.+.++++.++   +++=||.+- +.||   .+|++-+      .
T Consensus       160 ~s~~pVL-I~GE~GTGK~~~Ar~IH~~S~r~~~pfv~vnC~~l~~~l~eseLFG~~~gaftga~~~~~g~~~~------A  232 (441)
T PRK10365        160 PSEATVL-IHGDSGTGKELVARAIHASSARSEKPLVTLNCAALNESLLESELFGHEKGAFTGADKRREGRFVE------A  232 (441)
T ss_pred             CCCCCEE-EECCCCHHHHHHHHHHHHCCCCCCCCCEEEECCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCEEE------C
T ss_conf             8899489-98999810999999999657877898079878989845558986177556878965346898778------8


Q ss_pred             CCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEEC--CCCCCCCCEEEEEECC-CC-C-C-----CHHHCCCE
Q ss_conf             873999933155423117711556655406001681332010--3523644279999348-65-5-4-----41311724
Q gi|254780270|r  433 SNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYL--EVEYDLSDVMFIMTAN-TL-N-I-----PLPLMDRM  502 (820)
Q Consensus       433 ~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~--~~~~dls~v~fi~tan-~~-~-i-----~~~l~drm  502 (820)
                      .+..++||||+-++...+.    .||.+|.   +..|.-.--  .+++   +|-+||+.| ++ . +     -.-|..|+
T Consensus       233 ~gGTLfLdeI~~l~~~~Q~----kLl~~l~---~~~~~~~g~~~~~~~---d~RiIaat~~~l~~~v~~g~Fr~dLy~rL  302 (441)
T PRK10365        233 DGGTLFLDEIGDISPMMQV----RLLRAIQ---EREVQRVGSNQTISV---DVRLIAATHRDLAAEVNAGRFRQDLYYRL  302 (441)
T ss_pred             CCCEECCCCCCCCCHHHHH----HHHHHHH---HHHHCCCCCCCEEEC---CCEEEECCCCCHHHHHHCCCCHHHHHHHH
T ss_conf             9982550231529999999----9998777---521000588734413---63799837889999988198258999886


Q ss_pred             EE--EEECCCCH-HHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             79--98258786-8999899986089899862578131322899999997317741023478887999989876542117
Q gi|254780270|r  503 EI--IRIAGYTE-EEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKN  579 (820)
Q Consensus       503 e~--i~~~~y~~-~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~  579 (820)
                      -+  |++|+.-. .|-+-.--+|++-+...++|..  ...|++++++. ...|.+-.-||+|+..+...+-     ...+
T Consensus       303 ~~~~i~lPpLReR~eDI~~L~~~fl~~~~~~~~~~--~~~~s~~a~~~-L~~y~WPGNvREL~n~iera~~-----~~~~  374 (441)
T PRK10365        303 NVVAIEVPSLRQRREDIPLLAGHFLQRFAERNRKA--VKGFTPQAMDL-LIHYDWPGNIRELENAVERAVV-----LLTG  374 (441)
T ss_pred             CCHHCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCC--CCCCCHHHHHH-HHCCCCCCHHHHHHHHHHHHHH-----HCCC
T ss_conf             01113782600062009999999999999984999--88889999999-9709999899999999999999-----5789


Q ss_pred             CCCEECCCHHHHHH
Q ss_conf             85201279678675
Q gi|254780270|r  580 SDTTVSINENNLQD  593 (820)
Q Consensus       580 ~~~~~~i~~~~l~~  593 (820)
                          -.|+.+++..
T Consensus       375 ----~~i~~~~l~~  384 (441)
T PRK10365        375 ----EYISERELPL  384 (441)
T ss_pred             ----CCCCHHHCCH
T ss_conf             ----8688465754


No 97 
>TIGR02397 dnaX_nterm DNA polymerase III, subunits gamma and tau; InterPro: IPR012763    This entry represents the well-conserved first N-terminal domain of DnaX, approx. 365 aa. The full-length product of the dnaX gene in Escherichia coli encodes the DNA polymerase III tau subunit. A translational frameshift leads to early termination and a truncated protein subunit gamma, about 1/3 shorter than tau and present in roughly equal amounts. This frameshift mechanism is not necessarily universal for species with DNA polymerase III but appears conserved in the extreme thermophile Thermus thermophilis.; GO: 0003887 DNA-directed DNA polymerase activity, 0005524 ATP binding, 0006260 DNA replication, 0009360 DNA polymerase III complex.
Probab=98.96  E-value=2.6e-08  Score=81.75  Aligned_cols=193  Identities=24%  Similarity=0.345  Sum_probs=137.5

Q ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEE-------------EECCCCCCHHHHCCCCCCCCCCCCHHHHHHH
Q ss_conf             244467359986056565027999999770882499-------------8618888888835632001456712899999
Q gi|254780270|r  361 VIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVR-------------MSLGGVYDEADIRGHRRTYIGSMPGRIIQSL  427 (820)
Q Consensus       361 ~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~-------------islgg~~d~~~i~gh~~ty~ga~pg~ii~~l  427 (820)
                      ..+-=+...+|.||=||||||+||-.|||||=+ -.             |.-|.--|.-||-|=++|=|.-     |+.|
T Consensus        31 ~~~ri~HAYLF~GpRGtGKTS~ARIfAKaLNC~-~~~~~PCn~C~~C~~i~~g~~~DviEiDAASN~gVD~-----IR~l  104 (363)
T TIGR02397        31 KNGRIAHAYLFSGPRGTGKTSIARIFAKALNCQ-GPDGEPCNECESCKEINSGSSLDVIEIDAASNNGVDD-----IREL  104 (363)
T ss_pred             HHCCCCCEEEECCCCCCCHHHHHHHHHHHHCCC-CCCCCCCCCCCHHHHHHCCCCCCEEEECCCCCCCHHH-----HHHH
T ss_conf             718966234502859976355899999986588-7877877775022776528986668864865687889-----9999


Q ss_pred             HHCCCCCE------EEEEECHHHHHHHCCCCHHHHHHHHC-CCCCCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHHHC
Q ss_conf             83278873------99993315542311771155665540-60016813320103523644279999348655-441311
Q gi|254780270|r  428 KRAKRSNP------LLLLDEIDKMGSDLRGDPSAALLEVL-DPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLPLM  499 (820)
Q Consensus       428 ~~~~~~np------v~~ldeidk~~~~~~gdp~~allevl-dp~qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~  499 (820)
                      +..=..-|      |+++||+-=+|++.    -+|||-.| .|=                ++|.||+---+.+ ||...+
T Consensus       105 ~e~v~y~P~~~kYKvYIIDEVHMLS~~A----FNALLKTLEEPP----------------~hV~FIlATTE~~KiP~TIl  164 (363)
T TIGR02397       105 RENVKYAPSKGKYKVYIIDEVHMLSKSA----FNALLKTLEEPP----------------EHVVFILATTEPHKIPATIL  164 (363)
T ss_pred             HHHHCCCCCCCCCCEEEEECCCCCCHHH----HHHHHHHHCCCC----------------CCEEEEEECCCHHHCCCCCE
T ss_conf             8730368755443358873230286568----999876522798----------------76288873487112055402


Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             72479982587868999899986089899862578131322899999997317741023478887999989876542117
Q gi|254780270|r  500 DRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKN  579 (820)
Q Consensus       500 drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~  579 (820)
                      .|=-...+.-=+.++=+         +-++.. ++++.+.++++||..|...  -+-|+|+-.-.+..+.--       +
T Consensus       165 SRCQrF~Fk~i~~~~i~---------~~L~~I-~~~E~I~~e~~AL~~IA~~--a~GS~RDAlsllDQ~~~~-------~  225 (363)
T TIGR02397       165 SRCQRFDFKRIPLEDIV---------ERLKKI-LDKEGIKIEDEALELIARA--ADGSMRDALSLLDQAISF-------G  225 (363)
T ss_pred             EECEEECCCCCCHHHHH---------HHHHHH-HHHHCCCCCHHHHHHHHHH--CCCCCCHHHHHHHHHHHH-------C
T ss_conf             10003126789989999---------999999-9870883177899999996--289610688999999982-------6


Q ss_pred             CCCEECCCHHHHHHHHCCC
Q ss_conf             8520127967867530520
Q gi|254780270|r  580 SDTTVSINENNLQDYLGVP  598 (820)
Q Consensus       580 ~~~~~~i~~~~l~~~lg~~  598 (820)
                      +...-.||.+++.+.||--
T Consensus       226 ~~~DG~i~~~~v~~~lGl~  244 (363)
T TIGR02397       226 NGSDGKITYEDVNEMLGLV  244 (363)
T ss_pred             CCCCCCCCHHHHHHHHCCC
T ss_conf             8878865789999983577


No 98 
>KOG0743 consensus
Probab=98.95  E-value=1.7e-07  Score=75.68  Aligned_cols=176  Identities=23%  Similarity=0.311  Sum_probs=107.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECHHHHH-
Q ss_conf             5998605656502799999977088249986188888888356320014567128999998327887399993315542-
Q gi|254780270|r  368 ILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMG-  446 (820)
Q Consensus       368 il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~ldeidk~~-  446 (820)
                      -.+|+||||+||+|+--.+|.-|+---+-+.|-.|.|-+|+|                -|..+-...-++++-.||--- 
T Consensus       237 GYLLYGPPGTGKSS~IaAmAn~L~ydIydLeLt~v~~n~dLr----------------~LL~~t~~kSIivIEDIDcs~~  300 (457)
T KOG0743         237 GYLLYGPPGTGKSSFIAAMANYLNYDIYDLELTEVKLDSDLR----------------HLLLATPNKSILLIEDIDCSFD  300 (457)
T ss_pred             CCEEECCCCCCHHHHHHHHHHHCCCCEEEEEECCCCCCHHHH----------------HHHHHCCCCCEEEEEECCCCCC
T ss_conf             412047999988899999972058736774400236838999----------------9997289971899961243230


Q ss_pred             ---------HHCCCC----HHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHHHCC--CEEEEEECCC
Q ss_conf             ---------311771----15566554060016813320103523644279999348655-4413117--2479982587
Q gi|254780270|r  447 ---------SDLRGD----PSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLPLMD--RMEIIRIAGY  510 (820)
Q Consensus       447 ---------~~~~gd----p~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~d--rme~i~~~~y  510 (820)
                               .++.|+    .-|-||.-+|-         -----  =+.-++|+|-|..+ .+++|+-  ||.+=-.=||
T Consensus       301 l~~~~~~~~~~~~~~~~~VTlSGLLNfiDG---------lwSsc--g~ERIivFTTNh~EkLDPALlRpGRmDmhI~mgy  369 (457)
T KOG0743         301 LRERRKKKKENFEGDLSRVTLSGLLNFLDG---------LWSSC--GDERIIVFTTNHKEKLDPALLRPGRMDMHIYMGY  369 (457)
T ss_pred             CCCCCCCCCCCCCCCCCEEEHHHHHHHHCC---------CCCCC--CCCEEEEEECCCHHHCCHHHCCCCCCEEEEECCC
T ss_conf             443455566454677660664775664134---------30048--8734999946871006886628875225667266


Q ss_pred             CH-HHHHHHHHHHHHH----HHHHHHCCCCCCCCCC-HHHHHHHHHCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             86-8999899986089----8998625781313228-9999999731774102347888799998987
Q gi|254780270|r  511 TE-EEKLQIAKNHLVK----KVLTEHALKQEECCIS-DGVLLDIIRLFTHEAGVRSFERALMKIARKA  572 (820)
Q Consensus       511 ~~-~ek~~i~~~~l~p----~~~~~~~~~~~~~~~~-~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~  572 (820)
                      -. +-=...|++||=-    ..+++..=......++ .++-+.++.+-.  .....|++.+..+-++.
T Consensus       370 Ctf~~fK~La~nYL~~~~~h~L~~eie~l~~~~~~tPA~V~e~lm~~~~--dad~~lk~Lv~~l~~~~  435 (457)
T KOG0743         370 CTFEAFKTLASNYLGIEEDHRLFDEIERLIEETEVTPAQVAEELMKNKN--DADVALKGLVEALESKK  435 (457)
T ss_pred             CCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHCCC--CHHHHHHHHHHHHHHHH
T ss_conf             9879999999983389887306799998763374689999999863565--38899999999987634


No 99 
>KOG0737 consensus
Probab=98.95  E-value=6.4e-08  Score=78.79  Aligned_cols=203  Identities=22%  Similarity=0.372  Sum_probs=129.0

Q ss_pred             HHHCHHHHHHHHHHHHHHHHHCCC--------CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCC
Q ss_conf             520116899999999999984244--------467359986056565027999999770882499861888888883563
Q gi|254780270|r  340 DHFGLEKVKERIIEYLAVQMRVIK--------NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGH  411 (820)
Q Consensus       340 ~hyGl~~vK~rile~lav~~~~~~--------~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh  411 (820)
                      |--||+++|+..-|-+-.-...++        .....++|.||||+|||-+||.+|+..|-.|.-+++|++.|.-+  |-
T Consensus        93 DIggLe~v~~~L~e~VilPlr~pelF~~g~Ll~p~kGiLL~GPpG~GKTmlAKA~Akeaga~fInv~~s~lt~KWf--gE  170 (386)
T KOG0737          93 DIGGLEEVKDALQELVILPLRRPELFAKGKLLRPPKGILLYGPPGTGKTMLAKAIAKEAGANFINVSVSNLTSKWF--GE  170 (386)
T ss_pred             HCCCHHHHHHHHHHHHHHCCCCHHHHCCCCCCCCCCCCEECCCCCCHHHHHHHHHHHHCCCCCCEEECCCCCHHHH--HH
T ss_conf             1335289999999877520124666414531468643051189982188999999987279710001365532667--77


Q ss_pred             CCCCCCCCCHHHHHHHHH--CCCCCEEEEEECHHHHH-HHCCCCH-HHHHHHHCCCCCCCCEEEEECCCCCCCC-CEEEE
Q ss_conf             200145671289999983--27887399993315542-3117711-5566554060016813320103523644-27999
Q gi|254780270|r  412 RRTYIGSMPGRIIQSLKR--AKRSNPLLLLDEIDKMG-SDLRGDP-SAALLEVLDPAQNSSFVDHYLEVEYDLS-DVMFI  486 (820)
Q Consensus       412 ~~ty~ga~pg~ii~~l~~--~~~~npv~~ldeidk~~-~~~~gdp-~~allevldp~qn~~f~d~y~~~~~dls-~v~fi  486 (820)
                      .-        +.+.++-.  .+-.-.+|++||||-+- .-..+|- +.|+.       +..|.-++=+.--+=+ +|+..
T Consensus       171 ~e--------Klv~AvFslAsKl~P~iIFIDEvds~L~~R~s~dHEa~a~m-------K~eFM~~WDGl~s~~~~rVlVl  235 (386)
T KOG0737         171 AQ--------KLVKAVFSLASKLQPSIIFIDEVDSFLGQRRSTDHEATAMM-------KNEFMALWDGLSSKDSERVLVL  235 (386)
T ss_pred             HH--------HHHHHHHHHHHHCCCCEEEHHHHHHHHHHCCCCHHHHHHHH-------HHHHHHHHCCCCCCCCCEEEEE
T ss_conf             88--------89999982065348615656658889864046427999999-------9999998616467887159997


Q ss_pred             EECCCC-CCCHHHCCCEE---EEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHH
Q ss_conf             934865-54413117247---99825878689998999860898998625781313228999999973177410234788
Q gi|254780270|r  487 MTANTL-NIPLPLMDRME---IIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFE  562 (820)
Q Consensus       487 ~tan~~-~i~~~l~drme---~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~  562 (820)
                      .--|.. ++..+.+-||.   .|.+|.  .+.+..|-+=+|-+..++      .  .|+=.-+...-+.||   |     
T Consensus       236 gATNRP~DlDeAiiRR~p~rf~V~lP~--~~qR~kILkviLk~e~~e------~--~vD~~~iA~~t~GyS---G-----  297 (386)
T KOG0737         236 GATNRPFDLDEAIIRRLPRRFHVGLPD--AEQRRKILKVILKKEKLE------D--DVDLDEIAQMTEGYS---G-----  297 (386)
T ss_pred             ECCCCCCCHHHHHHHHCCCEEEECCCC--HHHHHHHHHHHHCCCCCC------C--CCCHHHHHHHCCCCC---H-----
T ss_conf             079998437899998476436537984--444999999994243468------7--769888887608986---7-----


Q ss_pred             HHHHHHHHHHHHHHH
Q ss_conf             879999898765421
Q gi|254780270|r  563 RALMKIARKAVTKIV  577 (820)
Q Consensus       563 r~i~~i~r~~~~~~~  577 (820)
                      +.|-.+||.++..-+
T Consensus       298 SDLkelC~~Aa~~~i  312 (386)
T KOG0737         298 SDLKELCRLAALRPI  312 (386)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             789999998767689


No 100
>PRK08853 DNA polymerase III subunits gamma and tau; Validated
Probab=98.94  E-value=2.2e-08  Score=82.24  Aligned_cols=173  Identities=19%  Similarity=0.249  Sum_probs=118.6

Q ss_pred             HHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC-------------CEEEEECCCCCCHHHHCCCCCCCCCCCCHHHH
Q ss_conf             98424446735998605656502799999977088-------------24998618888888835632001456712899
Q gi|254780270|r  358 QMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGR-------------QYVRMSLGGVYDEADIRGHRRTYIGSMPGRII  424 (820)
Q Consensus       358 ~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r-------------~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii  424 (820)
                      ..+..+.-+...+|.||.||||||+||-+|++||-             .+.-|.-|.--|--||.+-++|-|.-+-- ++
T Consensus        30 nal~~~rl~haylf~G~rGvGKTt~ARi~Ak~lNC~~~~~~~pcg~C~~C~~i~~g~~~d~~EiDaAs~~~vdd~re-l~  108 (717)
T PRK08853         30 NALAHNRLHHAYLFSGTRGVGKTTIGRLFAKGLNCETGITSTPCGQCATCKEIDEGRFVDLLEIDAASRTKVEDTRE-LL  108 (717)
T ss_pred             HHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHCCCCCCEEEECCCCCCCHHHHHH-HH
T ss_conf             99970997405761088988898999999998678999999978887026767447877524540565678899999-99


Q ss_pred             HHHHH--CCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHHHCCC
Q ss_conf             99983--2788739999331554231177115566554060016813320103523644279999348655-44131172
Q gi|254780270|r  425 QSLKR--AKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLPLMDR  501 (820)
Q Consensus       425 ~~l~~--~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~dr  501 (820)
                      .....  +...--|+++||+..+|.+.    .+|||..|.             -|=  ..|.||+---+.+ ||...+.|
T Consensus       109 ~~~~y~p~~~~yKvyiiDEvHmls~~a----fnAlLKtlE-------------EPP--~hv~FilaTT~~~kip~TilSR  169 (717)
T PRK08853        109 DNVQYKPARGRFKVYLIDEVHMLSRHS----FNALLKTLE-------------EPP--EYVKFLLATTDPQKLPVTILSR  169 (717)
T ss_pred             HHCCCCCCCCCEEEEEEECHHHCCHHH----HHHHHHHHC-------------CCC--CCEEEEEECCCHHHCCHHHHHH
T ss_conf             855548877854799983054438999----999987603-------------787--5648998438734373889876


Q ss_pred             EEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHH
Q ss_conf             4799825878689998999860898998625781313228999999973177410234788
Q gi|254780270|r  502 MEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFE  562 (820)
Q Consensus       502 me~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~  562 (820)
                      ---..+..-+.++-..         .++.. ++.+.+.+++++|..|.+.  -+.++|+--
T Consensus       170 c~~f~l~~~~~~~i~~---------~l~~i-~~~E~i~~~~~al~~ia~~--a~Gs~Rdal  218 (717)
T PRK08853        170 CLQFHLKPISVDQIHQ---------QLDFV-LDKEQVSAEARALGLIAHA--ADGSMRDAL  218 (717)
T ss_pred             HHHCCCCCCCHHHHHH---------HHHHH-HHHCCCCCCHHHHHHHHHH--CCCCHHHHH
T ss_conf             5442326899999999---------99999-9975987699999999997--688377888


No 101
>pfam06068 TIP49 TIP49 C-terminus. This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins. The N-terminal domain contains the pfam00004 domain. In zebrafish, the liebeskummer (lik) mutation, causes development of hyperplastic embryonic hearts. lik encodes Reptin, a component of a DNA-stimulated ATPase complex. Beta-catenin and Pontin, a DNA-stimulated ATPase that is often part of complexes with Reptin, are in the same genetic pathways. The Reptin/Pontin ratio serves to regulate heart growth during development, at least in part via the beta-catenin pathway. TBP-interacting protein 49 (TIP49) was originally identified as a TBP-binding protein, and two related proteins are encoded by individual genes, tip49a and b. Although the function of this gene family has not been elucidated, they are supposed to play a critical role in nuclear events because they interact with various kinds of nuclear
Probab=98.94  E-value=4.8e-08  Score=79.74  Aligned_cols=190  Identities=31%  Similarity=0.538  Sum_probs=115.4

Q ss_pred             HHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC--CEEEEECCCCCC------HHH-----------HCCCCCCCCC--
Q ss_conf             8424446735998605656502799999977088--249986188888------888-----------3563200145--
Q gi|254780270|r  359 MRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGR--QYVRMSLGGVYD------EAD-----------IRGHRRTYIG--  417 (820)
Q Consensus       359 ~~~~~~~g~il~l~gppgvGKts~~~sia~al~r--~f~~islgg~~d------~~~-----------i~gh~~ty~g--  417 (820)
                      ...++..|..++|+||||+|||-||-.||+.||-  ||+.+|=.-+-.      |+-           ||-.+..|.|  
T Consensus        43 Ik~~K~aGraiLlaGppGTGKTAlA~aiakeLG~~vPF~~i~gSEvyS~E~kKTE~L~qafRrsIGvrIkE~~eVyEGEV  122 (395)
T pfam06068        43 IKEGKIAGRAVLIAGPPGTGKTALAIAISKELGEDTPFCPISGSEVYSLEMKKTEALTQAFRKAIGVRIKEEKEVYEGEV  122 (395)
T ss_pred             HHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEEHHEEECCCCCHHHHHHHHHHHHHCEEEEEEEEEEEEEE
T ss_conf             97277577389987799988899999999974879973450011121256548899999998875568678889999999


Q ss_pred             -----------------------------------CCCHHHHHHHHHCCCCC-EEEEEEC----HHHHHHHCC-------
Q ss_conf             -----------------------------------67128999998327887-3999933----155423117-------
Q gi|254780270|r  418 -----------------------------------SMPGRIIQSLKRAKRSN-PLLLLDE----IDKMGSDLR-------  450 (820)
Q Consensus       418 -----------------------------------a~pg~ii~~l~~~~~~n-pv~~lde----idk~~~~~~-------  450 (820)
                                                         -+..+|+++|.+-++.. -||.+|-    +-|+|.++.       
T Consensus       123 ~ei~~~~~~~p~~~~~k~~~~~~itLkT~~~~~~l~l~~~i~e~l~kekV~~GDVI~Id~~sG~V~klGRs~~~a~~~D~  202 (395)
T pfam06068       123 VELEIEEAENPLSGYGKTIKHGKITLKTTKMEKTLKLGPKIYEQLQKEKVQAGDVIYIDKNTGKVKKLGRSFARATDFDL  202 (395)
T ss_pred             EEEEEEECCCCCCCCCCCCEEEEEEEEECCCCEEEECCHHHHHHHHHCCCCCCCEEEEECCCCEEEEEECCHHHHHHCCC
T ss_conf             99997414688898765403799999975881787258899999997498668789998587159997623203433266


Q ss_pred             ----------CC-----------------HHHH----HHHHCCCCCC----------------------------CCEEE
Q ss_conf             ----------71-----------------1556----6554060016----------------------------81332
Q gi|254780270|r  451 ----------GD-----------------PSAA----LLEVLDPAQN----------------------------SSFVD  471 (820)
Q Consensus       451 ----------gd-----------------p~~a----llevldp~qn----------------------------~~f~d  471 (820)
                                |+                 -++|    ++.+.-|...                            --|.|
T Consensus       203 ~~~~~V~~P~Gev~K~KEvv~~vTLHDlDv~Nar~qg~~slf~~~~~EIt~elR~eInk~V~~~i~eG~AElvpGVLFID  282 (395)
T pfam06068       203 EATEFVPCPKGEVHKRKEVVQTVTLHDIDVANARPQGILSLFSPKKGEITSELREEINKKVNKWIEEGKAEIVPGVLFID  282 (395)
T ss_pred             CCCEEEECCCCCCEEEEEEEEEEEHHHHHHHCCCCCCHHHHHCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEECCCEEEE
T ss_conf             65479778998624688999986123412221575256764179876069999999999999998648679842746885


Q ss_pred             E----------ECC--CCCCCCCEEEEEEC---------C--CCC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHH
Q ss_conf             0----------103--52364427999934---------8--655-4413117247998258786899989998608989
Q gi|254780270|r  472 H----------YLE--VEYDLSDVMFIMTA---------N--TLN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKV  527 (820)
Q Consensus       472 ~----------y~~--~~~dls~v~fi~ta---------n--~~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~  527 (820)
                      .          ||+  +..+||-+++.+|-         |  +.. ||.-|+||+-+|...+|+.+|-.+|.+-.     
T Consensus       283 EvHMLDiEcFsfLnralEs~laPivI~ATNRG~~~IRGTd~~sPHGiP~DlLDRllII~T~py~~~ei~~Ii~iR-----  357 (395)
T pfam06068       283 EVHMLDIECFSFLNRALESELAPIVILATNRGICTIRGTDIISPHGIPLDLLDRLLIITTEPYTREEIKQILEIR-----  357 (395)
T ss_pred             CCHHCCHHHHHHHHHHHCCCCCCEEEEEECCCCEEECCCCCCCCCCCCHHHHHHEEEEECCCCCHHHHHHHHHHH-----
T ss_conf             000000589988877650567876999844652035256775888998777730258856889989999999987-----


Q ss_pred             HHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHH
Q ss_conf             98625781313228999999973177410234
Q gi|254780270|r  528 LTEHALKQEECCISDGVLLDIIRLFTHEAGVR  559 (820)
Q Consensus       528 ~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR  559 (820)
                           .+.+++.++++|+.++.+- .-+.+.|
T Consensus       358 -----a~~E~v~l~~~al~~L~~i-g~~~SLR  383 (395)
T pfam06068       358 -----AQEEGVEISEEALDLLAKI-GEETSLR  383 (395)
T ss_pred             -----HHHHCCCCCHHHHHHHHHH-HHHCCHH
T ss_conf             -----7760787798999999986-5320299


No 102
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional
Probab=98.93  E-value=6.2e-08  Score=78.89  Aligned_cols=203  Identities=21%  Similarity=0.265  Sum_probs=133.9

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHCC---CEEEEECCCCCC---HHHHCCCCCCC-CCCCCHHHHHHHHHCCCCCE
Q ss_conf             446735998605656502799999977088---249986188888---88835632001-45671289999983278873
Q gi|254780270|r  363 KNKGLILCFVGPPGVGKTSLAQSIAKATGR---QYVRMSLGGVYD---EADIRGHRRTY-IGSMPGRIIQSLKRAKRSNP  435 (820)
Q Consensus       363 ~~~g~il~l~gppgvGKts~~~sia~al~r---~f~~islgg~~d---~~~i~gh~~ty-~ga~pg~ii~~l~~~~~~np  435 (820)
                      ....||| +.|.+||||+.+|++|..+=.|   ||+.+.++.+.+   ++|+=|+..+. -+..+|++-++      .+.
T Consensus       346 ~~~~pVL-I~GE~GtGKe~lAraIH~~S~r~~~pfv~vnC~ai~~~~~e~elfG~~~~~~~~g~~g~~e~A------~gG  418 (639)
T PRK11388        346 KSSFPIL-LCGEEGVGKALLAQAIHNESERAAGPYIAVNCQLLPDEALAEEFLGSDRTDSENGRLSKFELA------HGG  418 (639)
T ss_pred             CCCCCEE-EECCCCCCHHHHHHHHHHCCCCCCCCEEEEECCCCCHHHHHHHHCCCCCCCCCCCCCCHHHCC------CCC
T ss_conf             8899689-889898109999999995577789981898789898467899873877676434668624403------698


Q ss_pred             EEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEE--CCCCCCCCCEEEEEECCC-C-C-C-----CHHHCCCEEE-
Q ss_conf             99993315542311771155665540600168133201--035236442799993486-5-5-4-----4131172479-
Q gi|254780270|r  436 LLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHY--LEVEYDLSDVMFIMTANT-L-N-I-----PLPLMDRMEI-  504 (820)
Q Consensus       436 v~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y--~~~~~dls~v~fi~tan~-~-~-i-----~~~l~drme~-  504 (820)
                      .++||||+-|..+.+    .+||.||+   ...|+..-  -.+++   +|-+||+.|. + + +     -.-|..|+-. 
T Consensus       419 TL~LdeI~~lp~~~Q----~~LlrvL~---~~~~~r~g~~~~~~v---dvRiiaat~~~l~~~v~~g~fr~dLyyrl~~~  488 (639)
T PRK11388        419 TLFLEKVEYLSVELQ----SALLQVLK---TGVITRLDSRRLIPV---DVRVIATTTADLAMLVEQNRFSRQLYYALHAF  488 (639)
T ss_pred             EEEECCHHHCCHHHH----HHHHHHHH---CCCEEECCCCCEEEE---EEEEEEECCHHHHHHHHCCCCHHHHHHHHHHH
T ss_conf             288467264999999----99999986---593785699946664---27999736450899987498549999876744


Q ss_pred             -EEECCCCHH-HHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             -982587868-999899986089899862578131322899999997317741023478887999989876542117852
Q gi|254780270|r  505 -IRIAGYTEE-EKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDT  582 (820)
Q Consensus       505 -i~~~~y~~~-ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~~~~  582 (820)
                       |++|+.-.- |.+...-+|++-+...++|-   .+.|+++++.. ...|..---||+|+..+...+..     .    .
T Consensus       489 ~i~lPpLReR~~Di~~L~~~~l~~~~~~~~~---~~~ls~~a~~~-L~~y~WPGNvrEL~nvl~~a~~~-----~----~  555 (639)
T PRK11388        489 EITIPPLRMRREDIPALVNNKLRSLEKRFST---RLKIDDDALAR-LVSYRWPGNDFELRSVIENLALS-----S----D  555 (639)
T ss_pred             HCCCCCHHHCHHHHHHHHHHHHHHHHHHCCC---CCCCCHHHHHH-HHCCCCCCHHHHHHHHHHHHHHH-----C----C
T ss_conf             1057332325343999999999999997199---99989999999-97289997999999999999983-----8----9


Q ss_pred             EECCCHHHHHHHH
Q ss_conf             0127967867530
Q gi|254780270|r  583 TVSINENNLQDYL  595 (820)
Q Consensus       583 ~~~i~~~~l~~~l  595 (820)
                      .-.|+.++|.+.+
T Consensus       556 ~~~I~~~~Lp~~~  568 (639)
T PRK11388        556 NGRIRLSDLPEHL  568 (639)
T ss_pred             CCCCCHHHCCHHH
T ss_conf             9842679780877


No 103
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]
Probab=98.92  E-value=4.9e-08  Score=79.68  Aligned_cols=182  Identities=25%  Similarity=0.341  Sum_probs=108.6

Q ss_pred             CCCCHHHHHHHHHHH-------HHHCHHHHHHHHHHHHHHHHHCCC------CCCCEEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             322106889987766-------520116899999999999984244------4673599860565650279999997708
Q gi|254780270|r  325 KTKKNLDFAIRILDQ-------DHFGLEKVKERIIEYLAVQMRVIK------NKGLILCFVGPPGVGKTSLAQSIAKATG  391 (820)
Q Consensus       325 ~~~~dl~~a~~iLd~-------~hyGl~~vK~rile~lav~~~~~~------~~g~il~l~gppgvGKts~~~sia~al~  391 (820)
                      .-.++.++|+.....       |.-|-+++||-..|.+--.+-..+      .-+.-..|+||||+|||.|||.+|--.+
T Consensus       129 ~~~~gkskak~~~~~~~~v~F~DVAG~dEakeel~EiVdfLk~p~ky~~lGakiPkGvlLvGpPGTGKTLLAkAvAgEA~  208 (596)
T COG0465         129 AFSFGKSKAKLYLEDQVKVTFADVAGVDEAKEELSELVDFLKNPKKYQALGAKIPKGVLLVGPPGTGKTLLAKAVAGEAG  208 (596)
T ss_pred             CCCCCHHHHHHHCCCCCCCCHHHHCCCHHHHHHHHHHHHHHHCCHHHHHCCCCCCCCEEEECCCCCCCHHHHHHHHCCCC
T ss_conf             66777588987413566767566418679999999999986385566752353456526855999872789999845468


Q ss_pred             CCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCE-EEEEECHHHHHHHCC-C-CHHHHHHHHCCCCCCCC
Q ss_conf             82499861888888883563200145671289999983278873-999933155423117-7-11556655406001681
Q gi|254780270|r  392 RQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNP-LLLLDEIDKMGSDLR-G-DPSAALLEVLDPAQNSS  468 (820)
Q Consensus       392 r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~np-v~~ldeidk~~~~~~-g-dp~~allevldp~qn~~  468 (820)
                      -||..+|=     .+++    .-|||--.-|+=+-..+|+.+-| +|++||||.+|..-. | -+.+--.|=+= .|=-.
T Consensus       209 VPFf~iSG-----S~FV----emfVGvGAsRVRdLF~qAkk~aP~IIFIDEiDAvGr~Rg~g~GggnderEQTL-NQlLv  278 (596)
T COG0465         209 VPFFSISG-----SDFV----EMFVGVGASRVRDLFEQAKKNAPCIIFIDEIDAVGRQRGAGLGGGNDEREQTL-NQLLV  278 (596)
T ss_pred             CCCEECCC-----HHHH----HHHCCCCCHHHHHHHHHHHCCCCCEEEEEHHHHCCCCCCCCCCCCCHHHHHHH-HHHHH
T ss_conf             98353034-----4464----43147883888999998551599669876343314545778899806999999-88885


Q ss_pred             EEEEECCCCCCCCCEEEEEECCCCC-CCHHH-----CCCEEEEEECCCCHHHHHHHHHHH
Q ss_conf             3320103523644279999348655-44131-----172479982587868999899986
Q gi|254780270|r  469 FVDHYLEVEYDLSDVMFIMTANTLN-IPLPL-----MDRMEIIRIAGYTEEEKLQIAKNH  522 (820)
Q Consensus       469 f~d~y~~~~~dls~v~fi~tan~~~-i~~~l-----~drme~i~~~~y~~~ek~~i~~~~  522 (820)
                      ..|-|-    .=+.|..|+--|-.+ ..++|     .||-.+|+.|..-..|  +|-+-|
T Consensus       279 EmDGF~----~~~gviviaaTNRpdVlD~ALlRpgRFDRqI~V~~PDi~gRe--~IlkvH  332 (596)
T COG0465         279 EMDGFG----GNEGVIVIAATNRPDVLDPALLRPGRFDRQILVELPDIKGRE--QILKVH  332 (596)
T ss_pred             HHCCCC----CCCCEEEECCCCCCCCCHHHHCCCCCCCEEEECCCCCHHHHH--HHHHHH
T ss_conf             201578----887548852678743331765288776625544785156578--887886


No 104
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional
Probab=98.91  E-value=5.6e-08  Score=79.21  Aligned_cols=137  Identities=26%  Similarity=0.321  Sum_probs=92.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCC--CEEEEECCCC----CCHHHHCCCCCCCCCCC--CHHHHHHHHHCCC---
Q ss_conf             46735998605656502799999977088--2499861888----88888356320014567--1289999983278---
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGR--QYVRMSLGGV----YDEADIRGHRRTYIGSM--PGRIIQSLKRAKR---  432 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r--~f~~islgg~----~d~~~i~gh~~ty~ga~--pg~ii~~l~~~~~---  432 (820)
                      .|..+ -|.||||||||-+|+-+|.+|+-  .-.|+.+=.+    .+|.++.|-|-.=.|-.  ||.+.+..++|..   
T Consensus       193 tKknv-IL~G~pGtGKT~lAk~lA~~l~g~~~~~rv~~VqfhpsysYEDfi~Gyrp~~~gf~~~~G~f~~~~~~A~~~p~  271 (459)
T PRK11331        193 IKKNI-ILQGPPGVGKTFVARRLAYLLTGEKAPQRVNMVQFHQSYSYEDFIQGYRPNGVGFRRKDGIFYNFCQQAKEQPE  271 (459)
T ss_pred             CCCCE-EEECCCCCCHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCHHHHHCCCCCCCCCCEECCCHHHHHHHHHHHCCC
T ss_conf             58827-96589998878999999999707887784689983588661787646056888613268369999999984989


Q ss_pred             CCEEEEEECHHHHHHHCCCCHHHH---HHHHCCCCC-C--CCEE-------EEECCCCCCCCCEEEEEECCCCC-----C
Q ss_conf             873999933155423117711556---655406001-6--8133-------20103523644279999348655-----4
Q gi|254780270|r  433 SNPLLLLDEIDKMGSDLRGDPSAA---LLEVLDPAQ-N--SSFV-------DHYLEVEYDLSDVMFIMTANTLN-----I  494 (820)
Q Consensus       433 ~npv~~ldeidk~~~~~~gdp~~a---llevldp~q-n--~~f~-------d~y~~~~~dls~v~fi~tan~~~-----i  494 (820)
                      .+-++++|||.      ||+++..   ||-++.+.- +  .+-.       |.-|.+|   +++++|.|+|+.+     +
T Consensus       272 ~~y~~iidein------r~~~~~~fgel~~liE~dkR~~~~~~~l~ys~~~~~~f~vP---~Nl~iigtmNtadrs~~~~  342 (459)
T PRK11331        272 KKYVFIIDEIN------RANLSKVFGEVMMLMEHDKRGENWSVPLTYSENDEERFYVP---ENVYIIGLMNTADRSLAVV  342 (459)
T ss_pred             CCEEEEEEHHH------CCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCEECCC---CCEEEEEECCCCCHHHHHH
T ss_conf             87699984320------33889999999999641256765225630036888533468---8659998503341068878


Q ss_pred             CHHHCCCEEEEEECCC
Q ss_conf             4131172479982587
Q gi|254780270|r  495 PLPLMDRMEIIRIAGY  510 (820)
Q Consensus       495 ~~~l~drme~i~~~~y  510 (820)
                      +.+|+-|...+++.+=
T Consensus       343 d~alrRrf~f~~~~pd  358 (459)
T PRK11331        343 DYALRRRFSFIDIEPG  358 (459)
T ss_pred             HHHHHHHHCCEECCCC
T ss_conf             9999865021215898


No 105
>PRK09112 DNA polymerase III subunit delta'; Validated
Probab=98.89  E-value=1.8e-08  Score=82.98  Aligned_cols=186  Identities=19%  Similarity=0.277  Sum_probs=111.8

Q ss_pred             HHHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC-CEEEEECCCCCCHHHHCCC----C
Q ss_conf             6652011689999999999998424446735998605656502799999977088-2499861888888883563----2
Q gi|254780270|r  338 DQDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGR-QYVRMSLGGVYDEADIRGH----R  412 (820)
Q Consensus       338 d~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r-~f~~islgg~~d~~~i~gh----~  412 (820)
                      ..+.+|.+.+...++..+.     ...-...++|.||+||||||+|..+|+.|-- +-..-.-++..+   .-++    |
T Consensus        22 ~~~liGq~~~~~~L~~a~~-----~gRl~HA~Lf~GP~GiGKaTlA~~~A~~Ll~~~~~~~~~~~~~~---pd~~~~~~r   93 (352)
T PRK09112         22 NNRLFGHEEARAFLAQAYR-----EGRLHHALLFEGPEGIGKATLAFHLANHILSHPDPNEAPETLAD---PDPASPLWR   93 (352)
T ss_pred             HHHHCCHHHHHHHHHHHHH-----CCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCC---CCCCCHHHH
T ss_conf             6462786999999999998-----49965246535899808999999999998669986668655678---887877899


Q ss_pred             CCCCCCCCH-------------H----H----HHHHHHC------CCCCEEEEEECHHHHHHHCCCCHHHHHHHHCC-CC
Q ss_conf             001456712-------------8----9----9999832------78873999933155423117711556655406-00
Q gi|254780270|r  413 RTYIGSMPG-------------R----I----IQSLKRA------KRSNPLLLLDEIDKMGSDLRGDPSAALLEVLD-PA  464 (820)
Q Consensus       413 ~ty~ga~pg-------------~----i----i~~l~~~------~~~npv~~ldeidk~~~~~~gdp~~allevld-p~  464 (820)
                      +-.-|+-|+             +    |    |+.+++-      ...--|+++||.|+|+.+    -++|||-+|. |.
T Consensus        94 ~i~~g~hpdl~~i~r~~d~k~~~~~~~I~vd~iR~l~~~~~~~~~~~~~kv~Iid~ad~m~~~----aaNALLK~LEEPp  169 (352)
T PRK09112         94 QIAQGAHPNLLHLTRPFDEKTGKFKTAITVDEIRRVTHFLSQTSGDGNWRIVIIDPADDMNRN----AANAILKTLEEPP  169 (352)
T ss_pred             HHHCCCCCCEEEEECCCCHHHHHHHCCCCHHHHHHHHHHHCCCCCCCCEEEEEECCHHHHHHH----HHHHHHHHHHCCC
T ss_conf             997489999565534322021454335777999999998454886688069998187874699----9999999853489


Q ss_pred             CCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHH
Q ss_conf             16813320103523644279999348655-44131172479982587868999899986089899862578131322899
Q gi|254780270|r  465 QNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDG  543 (820)
Q Consensus       465 qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~  543 (820)
                                      .+++||...|+.+ ++++++.|--.+.+..-+.++-....         +..+... .+ ..++
T Consensus       170 ----------------~~~~fiLit~~~~~ll~TI~SRCq~~~f~pL~~~di~~~L---------~~i~~~~-~~-~~~~  222 (352)
T PRK09112        170 ----------------ARALFILISHSSGRLLPTIRSRCQPISLKPLDDDELKKAL---------SHLGSKQ-GI-SAGE  222 (352)
T ss_pred             ----------------CCEEEEEEECCHHHCHHHHHHHCCCCCCCCCCHHHHHHHH---------HHHHHCC-CC-CCHH
T ss_conf             ----------------8748998869977776899974332148893989999999---------9875126-89-9879


Q ss_pred             HHHHHHHCCCCCCHHHHHHHH
Q ss_conf             999997317741023478887
Q gi|254780270|r  544 VLLDIIRLFTHEAGVRSFERA  564 (820)
Q Consensus       544 ~i~~ii~~Yt~EaGvR~l~r~  564 (820)
                      ++..++..  -+..||.--+.
T Consensus       223 ~~~~l~~~--a~GS~~~Al~L  241 (352)
T PRK09112        223 ETEALLQR--SEGSVRKALLL  241 (352)
T ss_pred             HHHHHHHH--HCCCHHHHHHH
T ss_conf             99999987--08998899987


No 106
>PRK08691 DNA polymerase III subunits gamma and tau; Validated
Probab=98.88  E-value=3e-08  Score=81.34  Aligned_cols=184  Identities=18%  Similarity=0.255  Sum_probs=120.5

Q ss_pred             HHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC-------------CEEEEECCCCCCHHH
Q ss_conf             2011689999999999998424446735998605656502799999977088-------------249986188888888
Q gi|254780270|r  341 HFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGR-------------QYVRMSLGGVYDEAD  407 (820)
Q Consensus       341 hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r-------------~f~~islgg~~d~~~  407 (820)
                      .-|-+-|.+-+.     ..+..+.-....+|.||-||||||+|+-+|++||-             -+..|.-|.--|--|
T Consensus        18 ~vGQ~~v~~~L~-----nal~~~rl~haylf~G~rGvGKTt~Ari~Ak~lNC~~~~~~~pCg~C~~C~~i~~g~~~D~~E   92 (704)
T PRK08691         18 LVGQEHVVKALQ-----NALDEGRLHHAYLLTGTRGVGKTTIARILAKSLNCENAQHGEPCGVCQSCTQIDAGRYVDLLE   92 (704)
T ss_pred             HCCCHHHHHHHH-----HHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCCEEE
T ss_conf             418699999999-----999819975237502789878889999999996799999999787777678785589987477


Q ss_pred             HCCCCCCCCCCCCHHHHHHHHH--CCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEE
Q ss_conf             3563200145671289999983--27887399993315542311771155665540600168133201035236442799
Q gi|254780270|r  408 IRGHRRTYIGSMPGRIIQSLKR--AKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMF  485 (820)
Q Consensus       408 i~gh~~ty~ga~pg~ii~~l~~--~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~f  485 (820)
                      |.+-++|=|.-+-. +++...-  +...--|+++||+..++..-    .+|||..|.             -|  =..|.|
T Consensus        93 iDaAs~~~vdd~R~-l~~~~~y~P~~~~yKVyiiDEvhmLs~~a----fNAlLKtLE-------------EP--P~~v~F  152 (704)
T PRK08691         93 IDAASNTGIDNIRE-VLENAQYAPTAGKYKVYIIDEVHMLSKSA----FNAMLKTLE-------------EP--PEHVKF  152 (704)
T ss_pred             EECCCCCCHHHHHH-HHHHCCCCCCCCCEEEEEEECHHHCCHHH----HHHHHHHHC-------------CC--CCCEEE
T ss_conf             42454458899999-99853468867853599983154438999----999998614-------------79--756089


Q ss_pred             EEECCCCC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHH
Q ss_conf             99348655-44131172479982587868999899986089899862578131322899999997317741023478
Q gi|254780270|r  486 IMTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSF  561 (820)
Q Consensus       486 i~tan~~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l  561 (820)
                      |+.-.+.+ ||...+.|---..+..-+.++-..         .+... +..+.+.++++++..|.+.  -+.++|+-
T Consensus       153 ilaTTdp~Klp~TIlSRC~~f~l~~~~~~~i~~---------~L~~i-~~~E~i~~e~~al~~ia~~--a~Gs~RDa  217 (704)
T PRK08691        153 ILATTDPHKVPVTVLSRCLQFVLRNMTAQQVAD---------HLAHV-LDSEKIAYEPPALQLLGRA--AAGSMRDA  217 (704)
T ss_pred             EEECCCHHHCCHHHHHHHHHHCCCCCCHHHHHH---------HHHHH-HHHCCCCCCHHHHHHHHHH--CCCCHHHH
T ss_conf             985488464758999888771026899999999---------99999-9983985689999999997--57857779


No 107
>KOG0740 consensus
Probab=98.88  E-value=3.3e-08  Score=81.02  Aligned_cols=203  Identities=23%  Similarity=0.332  Sum_probs=127.6

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHHCC----CCCCCE--EEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCC
Q ss_conf             652011689999999999998424----446735--99860565650279999997708824998618888888835632
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQMRVI----KNKGLI--LCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHR  412 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~~~~~----~~~g~i--l~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~  412 (820)
                      .|.-||+.+|.-+.|+.-.--+++    ..+++.  |+|.||||+|||-||+.||.-.+--|..||--      .+-+  
T Consensus       153 ~di~gl~~~k~~l~e~vi~p~lr~d~F~glr~p~rglLLfGPpgtGKtmL~~aiAsE~~atff~iSas------sLts--  224 (428)
T KOG0740         153 DDIAGLEDAKQSLKEAVILPLLRPDLFLGLREPVRGLLLFGPPGTGKTMLAKAIATESGATFFNISAS------SLTS--  224 (428)
T ss_pred             CCCCCHHHHHHHHHHHHHHCCCCHHHHHCCCCCCCHHHEECCCCCCHHHHHHHHHHHHCCEEEECCHH------HHHH--
T ss_conf             57740566899865423220455376523544531112005898844799999986206657630688------8653--


Q ss_pred             CCCCCCCCHHHHHHHHH-CCCCCE-EEEEECHHHHHHH--CCCCHHH--HHHHHCCCCCCCCEEEEEC-CCCCCCCCEEE
Q ss_conf             00145671289999983-278873-9999331554231--1771155--6655406001681332010-35236442799
Q gi|254780270|r  413 RTYIGSMPGRIIQSLKR-AKRSNP-LLLLDEIDKMGSD--LRGDPSA--ALLEVLDPAQNSSFVDHYL-EVEYDLSDVMF  485 (820)
Q Consensus       413 ~ty~ga~pg~ii~~l~~-~~~~np-v~~ldeidk~~~~--~~gdp~~--allevldp~qn~~f~d~y~-~~~~dls~v~f  485 (820)
                       +|+|.- -+.|.++-+ |++.-| ||++||||++=+.  -+-.++|  ...|.|=+-      | +. ..+=|  +|++
T Consensus       225 -K~~Ge~-eK~vralf~vAr~~qPsvifidEidslls~Rs~~e~e~srr~ktefLiq~------~-~~~s~~~d--rvlv  293 (428)
T KOG0740         225 -KYVGES-EKLVRALFKVARSLQPSVIFIDEIDSLLSKRSDNEHESSRRLKTEFLLQF------D-GKNSAPDD--RVLV  293 (428)
T ss_pred             -HCCCHH-HHHHHHHHHHHHHCCCEEEEECHHHHHHHHCCCCCCCCCHHHHHHHHHHH------C-CCCCCCCC--EEEE
T ss_conf             -246707-78999999998713970898402567886368754544555655777654------0-44578887--0799


Q ss_pred             EEECCCC-CCCHHHCCC-EEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHH
Q ss_conf             9934865-544131172-47998258786899989998608989986257813132289999999731774102347888
Q gi|254780270|r  486 IMTANTL-NIPLPLMDR-MEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFER  563 (820)
Q Consensus       486 i~tan~~-~i~~~l~dr-me~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r  563 (820)
                      |++-|-. .+..+.+-| +-++.+|---.+.     +.++|.+.+++++-  ....-.=++|-.+-+.|+-        -
T Consensus       294 igaTN~P~e~Dea~~Rrf~kr~yiplPd~et-----r~~~~~~ll~~~~~--~l~~~d~~~l~~~Tegysg--------s  358 (428)
T KOG0740         294 IGATNRPWELDEAARRRFVKRLYIPLPDYET-----RSLLWKQLLKEQPN--GLSDLDISLLAKVTEGYSG--------S  358 (428)
T ss_pred             EECCCCCHHHHHHHHHHHCCEEEECCCCHHH-----HHHHHHHHHHHCCC--CCCHHHHHHHHHHHCCCCC--------C
T ss_conf             8158883677888888710315535988789-----99999999976878--7417789999988617562--------2


Q ss_pred             HHHHHHHHHHHH
Q ss_conf             799998987654
Q gi|254780270|r  564 ALMKIARKAVTK  575 (820)
Q Consensus       564 ~i~~i~r~~~~~  575 (820)
                      .|.++|..++..
T Consensus       359 di~~l~kea~~~  370 (428)
T KOG0740         359 DITALCKEAAMG  370 (428)
T ss_pred             CHHHHHHHHHCC
T ss_conf             188998776238


No 108
>PTZ00112 origin recognition complex 1 protein; Provisional
Probab=98.87  E-value=1.6e-07  Score=75.78  Aligned_cols=212  Identities=21%  Similarity=0.311  Sum_probs=139.2

Q ss_pred             HCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC--------CEEEEECCCCCCH--------
Q ss_conf             011689999999999998424446735998605656502799999977088--------2499861888888--------
Q gi|254780270|r  342 FGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGR--------QYVRMSLGGVYDE--------  405 (820)
Q Consensus       342 yGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r--------~f~~islgg~~d~--------  405 (820)
                      -+-|+-++.|..|+- .+++.+..|.+|-..|.||||||.-.+++-+.|..        +|..+-+.|++=.        
T Consensus       270 pcRe~E~~~I~~Fie-~~i~q~GtG~cLYISGVPGTGKTATV~eVIr~L~~~~~~~~lp~F~fVEINGMkLt~P~qaY~~  348 (650)
T PTZ00112        270 LGREKEAKEIRTFLE-TGIKQGGTGQILYISGVPGTGKTATVYMVIKELQNKKLKGQLPWFNLFEINGVNLVHPNAAYRV  348 (650)
T ss_pred             CCCHHHHHHHHHHHH-HHCCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCEEEEECCEECCCHHHHHHH
T ss_conf             770789999999998-6411688665699978999980036999999999999708999815999736377987889999


Q ss_pred             --HHHCCCCCC-CCCCCCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCC-CCCC
Q ss_conf             --883563200-145671289999983278873999933155423117711556655406001681332010352-3644
Q gi|254780270|r  406 --ADIRGHRRT-YIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVE-YDLS  481 (820)
Q Consensus       406 --~~i~gh~~t-y~ga~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~-~dls  481 (820)
                        -.+.|.+.+ ...|  -.+.+..-..+..-.|.|+||+|-+-...+.    .|..++|             -| .--|
T Consensus       349 L~e~Ltg~k~~~~~~A--~~lL~k~F~~~r~p~VlLvDELD~LvTkkQ~----VlYNLFd-------------WPT~~~S  409 (650)
T PTZ00112        349 FYKKLFNKKPPNALNS--YKELDKLFNNNRTPSILIVDEADYIVTKTQK----VLFTLFD-------------WPTKKNS  409 (650)
T ss_pred             HHHHHHCCCCCCHHHH--HHHHHHHHCCCCCCEEEEECHHHHHHHCCCC----EEEECCC-------------CCCCCCC
T ss_conf             9999848988867899--9999998268997189997157777636774----5777366-------------8898887


Q ss_pred             CEEEEEECCCCCCCHHHC----CC--EEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCC
Q ss_conf             279999348655441311----72--479982587868999899986089899862578131322899999997317741
Q gi|254780270|r  482 DVMFIMTANTLNIPLPLM----DR--MEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHE  555 (820)
Q Consensus       482 ~v~fi~tan~~~i~~~l~----dr--me~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~E  555 (820)
                      +...|+-||+.|.|.-|+    .|  +..+..++||.++=.+|.+.-|     +  ++    -.|.++||...-+.-+.=
T Consensus       410 kLIVIaIANTMDLPERL~~RVsSRLGltRltF~PYt~~QL~eII~sRL-----~--~~----~~f~~dAIQl~ARKVAav  478 (650)
T PTZ00112        410 KLILIIISNTMDLPYKMKPSCRSRLAFGRLVFSPYKYQQIEKVIKERL-----E--NC----EIIDHTALQLCARRVTNY  478 (650)
T ss_pred             EEEEEEEEECCCCCHHHHHHHHHHCCCCEECCCCCCHHHHHHHHHHHH-----C--CC----CCCCHHHHHHHHHHHHHH
T ss_conf             079999850678606566665552288500439989999999999986-----2--67----778878999998888750


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHH
Q ss_conf             0234788879999898765421178520127967867
Q gi|254780270|r  556 AGVRSFERALMKIARKAVTKIVKNSDTTVSINENNLQ  592 (820)
Q Consensus       556 aGvR~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~  592 (820)
                      +|  +..|.| .|||++.- ...+.    .|+..++.
T Consensus       479 SG--DARRAL-dICRRAvE-~~~~~----ki~~~~i~  507 (650)
T PTZ00112        479 SG--DMRKAL-QICKLAFE-NKNGG----KITPRDMT  507 (650)
T ss_pred             CC--HHHHHH-HHHHHHHH-HCCCC----EEEHHHHH
T ss_conf             31--489999-99999997-35687----34248999


No 109
>PRK09111 DNA polymerase III subunits gamma and tau; Validated
Probab=98.86  E-value=6.8e-08  Score=78.61  Aligned_cols=198  Identities=20%  Similarity=0.269  Sum_probs=134.8

Q ss_pred             HHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCC------------------EEEEECCCCCCHHHHCCCCCCCCCCCC
Q ss_conf             84244467359986056565027999999770882------------------499861888888883563200145671
Q gi|254780270|r  359 MRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQ------------------YVRMSLGGVYDEADIRGHRRTYIGSMP  420 (820)
Q Consensus       359 ~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~------------------f~~islgg~~d~~~i~gh~~ty~ga~p  420 (820)
                      .+..+.-+....|.||-||||||+||-+|+|||-.                  +..|.-|.--|.-||.+-++|=|..+-
T Consensus        38 ~~~~~~~~~a~l~~g~rg~gktt~ari~a~~lnc~~~~~~~~~~~~~c~~c~~c~~i~~~~~~d~~e~daas~~~v~~~r  117 (600)
T PRK09111         38 AFETGRIAQAFMLTGVRGVGKTTTARILARALNYKGPDGVGGPTIDPCGVGEHCQAIMEGRHVDVIEMDAASHTGVDDIR  117 (600)
T ss_pred             HHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEECCCCCCHHHHH
T ss_conf             99729842047645789878999999999996698876668998898998865898866899875885155457888999


Q ss_pred             HHHHHHHHHC--CCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHH
Q ss_conf             2899999832--788739999331554231177115566554060016813320103523644279999348655-4413
Q gi|254780270|r  421 GRIIQSLKRA--KRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLP  497 (820)
Q Consensus       421 g~ii~~l~~~--~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~  497 (820)
                      - |+...+-+  ...--|+++||+--+|.+.    .+|||-.|.             -|=  .+|.||+-.-... ||..
T Consensus       118 ~-~~~~~~~~p~~~~~kv~iidevhmls~~a----fnallktle-------------epp--~~~~fi~att~~~k~p~t  177 (600)
T PRK09111        118 E-IIESVRYRPVSARYKVYIIDEVHMLSTAA----FNALLKTLE-------------EPP--PHVKFIFATTEIRKVPVT  177 (600)
T ss_pred             H-HHHHHCCCCCCCCEEEEEEECCCCCCHHH----HHHHHHHHH-------------CCC--CCEEEEEECCCHHHCCHH
T ss_conf             9-99860538877754699960011057999----999998762-------------598--654999962853437589


Q ss_pred             HCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             11724799825878689998999860898998625781313228999999973177410234788879999898765421
Q gi|254780270|r  498 LMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIV  577 (820)
Q Consensus       498 l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~  577 (820)
                      .+.|--...+.--+.++-..         .++.. ++.+.+.++++++..|.+.  -|.+||+---.+...+   +    
T Consensus       178 i~src~~f~~~~~~~~~~~~---------~l~~i-~~~e~~~~~~~al~~ia~~--a~GS~RDaLSlLDQai---~----  238 (600)
T PRK09111        178 VLSRCQRFDLRRIEAEVLAA---------HLARI-AEKEGVEVEPDALALIARA--AEGSVRDGLSLLDQAI---A----  238 (600)
T ss_pred             HHHHHHEECCCCCCHHHHHH---------HHHHH-HHHCCCCCCHHHHHHHHHH--CCCCCCHHHHHHHHHH---H----
T ss_conf             98544120105799999999---------99999-9860768667799999997--4898421899999999---7----


Q ss_pred             CCCCCEECCCHHHHHHHHCCC
Q ss_conf             178520127967867530520
Q gi|254780270|r  578 KNSDTTVSINENNLQDYLGVP  598 (820)
Q Consensus       578 ~~~~~~~~i~~~~l~~~lg~~  598 (820)
                      .+.   -.|+.+++.+.||--
T Consensus       239 ~~~---~~i~~~~v~~mLGl~  256 (600)
T PRK09111        239 HGA---GEVTAEQVRDMLGLA  256 (600)
T ss_pred             CCC---CCCCHHHHHHHHCCC
T ss_conf             279---875699999986887


No 110
>PRK06893 DNA replication initiation factor; Validated
Probab=98.85  E-value=5.1e-07  Score=71.96  Aligned_cols=187  Identities=17%  Similarity=0.290  Sum_probs=125.5

Q ss_pred             HHHCCCCCCCEEEEECCCCCCHHHHHHHHHH---HHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCC
Q ss_conf             9842444673599860565650279999997---7088249986188888888356320014567128999998327887
Q gi|254780270|r  358 QMRVIKNKGLILCFVGPPGVGKTSLAQSIAK---ATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSN  434 (820)
Q Consensus       358 ~~~~~~~~g~il~l~gppgvGKts~~~sia~---al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~n  434 (820)
                      .+...+..++.+.++||+|+|||.|..+++.   +-+++-..+++.-...              ..-.+++++...    
T Consensus        31 ~~~~~~~~~~~l~i~G~~gsGKTHLLqa~~~~~~~~~~~~~yi~~~~~~~--------------~~~~~l~~l~~~----   92 (229)
T PRK06893         31 RKNFIDLKQPFFYIWGGKSSGKSHLLKAVSNHYLLNQRTAIYIPLSKSQY--------------FSPAVLENLEQQ----   92 (229)
T ss_pred             HHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEEEHHHHHH--------------CCHHHHHHHHHC----
T ss_conf             97550246987999899999889999999999997189859997377564--------------069999876547----


Q ss_pred             EEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCC----CCCC-HHHCCC---EEEEE
Q ss_conf             399993315542311771155665540600168133201035236442799993486----5544-131172---47998
Q gi|254780270|r  435 PLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANT----LNIP-LPLMDR---MEIIR  506 (820)
Q Consensus       435 pv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~----~~i~-~~l~dr---me~i~  506 (820)
                      .++.+|.||.+....  +-.-+|.+++.--             .+-.+.++++|++.    +++- +=|+.|   +.+++
T Consensus        93 d~l~iDDi~~i~g~~--~~e~~lF~l~N~l-------------~~~~~~~ll~ss~~~p~~l~~~l~DL~SRl~~~~~~~  157 (229)
T PRK06893         93 DLVCLDDLQAVIGNE--EWELAIFDLFNRI-------------KESGKTLLLISANQSPHALQIKLPDLASRLTWGEIYQ  157 (229)
T ss_pred             CEEEEECHHHHCCCH--HHHHHHHHHHHHH-------------HHCCCCEEEEECCCCHHHHCCHHHHHHHHHHCCEEEE
T ss_conf             979996723424883--8999999999999-------------9759917998579883322100267999996883699


Q ss_pred             ECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEECC
Q ss_conf             25878689998999860898998625781313228999999973177410234788879999898765421178520127
Q gi|254780270|r  507 IAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDTTVSI  586 (820)
Q Consensus       507 ~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~~~~~~~i  586 (820)
                      +..-+.+++..|-+++.     +     ..++.++++++.||+++++|.  +|.|...+..+-+....       .+-.|
T Consensus       158 i~~~dd~~~~~iL~~~a-----~-----~rgl~l~~~v~~yl~~r~~R~--~~~l~~~l~~Ld~~sl~-------~kr~i  218 (229)
T PRK06893        158 LNDLTDEQKIEVLQRNA-----Y-----QRGIELSDETANFLLKRLDRD--MHTLFDALDLLDKASLQ-------AQRKL  218 (229)
T ss_pred             ECCCCHHHHHHHHHHHH-----H-----HCCCCCCHHHHHHHHHHHCCC--HHHHHHHHHHHHHHHHH-------HCCCC
T ss_conf             66777579999999999-----9-----649999989999999983478--99999999999999998-------08999


Q ss_pred             CHHHHHHHHC
Q ss_conf             9678675305
Q gi|254780270|r  587 NENNLQDYLG  596 (820)
Q Consensus       587 ~~~~l~~~lg  596 (820)
                      |-..+++.||
T Consensus       219 TiplvkevL~  228 (229)
T PRK06893        219 TIPFVKEILG  228 (229)
T ss_pred             CHHHHHHHHC
T ss_conf             9999999868


No 111
>PRK07003 DNA polymerase III subunits gamma and tau; Validated
Probab=98.84  E-value=5.8e-08  Score=79.11  Aligned_cols=171  Identities=18%  Similarity=0.238  Sum_probs=109.4

Q ss_pred             HHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC-------------CEEEEECCCCCCHHHHCCCCCCCCCCCCHHHH
Q ss_conf             98424446735998605656502799999977088-------------24998618888888835632001456712899
Q gi|254780270|r  358 QMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGR-------------QYVRMSLGGVYDEADIRGHRRTYIGSMPGRII  424 (820)
Q Consensus       358 ~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r-------------~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii  424 (820)
                      ..+..+.-+...+|.||.||||||+||-+||+||-             -+..|.-|.--|--||.+-++|-|.-+--. +
T Consensus        30 nal~~~rl~haylf~G~rGvGKTt~aRi~Ak~lnC~~~~~~~pcg~C~~C~~i~~g~~~d~iEiDaAS~~~vd~~r~l-~  108 (816)
T PRK07003         30 HALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPCGVCRACREIDEGRFVDYVEMDAASNRGVDEMAAL-L  108 (816)
T ss_pred             HHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEECCCCCCHHHHHHH-H
T ss_conf             999709863147511789888889999999986789999989787755578775588775478635543576899999-9


Q ss_pred             HHHHH--CCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHHHCCC
Q ss_conf             99983--2788739999331554231177115566554060016813320103523644279999348655-44131172
Q gi|254780270|r  425 QSLKR--AKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLPLMDR  501 (820)
Q Consensus       425 ~~l~~--~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~dr  501 (820)
                      .....  +...--|+++||+--++..-    .+|||..|.             -|=  ..|.||+---+.+ ||...+.|
T Consensus       109 ~~~~y~p~~~r~KvyiiDEvHmls~~a----fnalLKtlE-------------epP--~hv~FilaTTd~~k~p~tilSR  169 (816)
T PRK07003        109 ERAVYAPVDARFKVYMIDEVHMLTNHA----FNAMLKTLE-------------EPP--PHVKFILATTDPQKIPVTVLSR  169 (816)
T ss_pred             HHCCCCCCCCCEEEEEEECHHHCCHHH----HHHHHHHHC-------------CCC--CCEEEEEECCCHHHCCHHHHHH
T ss_conf             862247866744799984154339999----999998403-------------798--6648999558801152889877


Q ss_pred             EEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHH
Q ss_conf             47998258786899989998608989986257813132289999999731774102347
Q gi|254780270|r  502 MEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRS  560 (820)
Q Consensus       502 me~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~  560 (820)
                      ---..+...+.++-..         .++.. ++++.+.+++++|..|.+.  -..++|+
T Consensus       170 c~~f~l~~~~~~~i~~---------~l~~i-~~~E~i~~e~~al~lia~~--a~GsmRD  216 (816)
T PRK07003        170 CLQFNLKQMPAGHIVS---------HLERI-LGEERIAFEPQALRLLARA--AQGSMRD  216 (816)
T ss_pred             HHHCCCCCCCHHHHHH---------HHHHH-HHHCCCCCCHHHHHHHHHH--CCCCHHH
T ss_conf             7652236799999999---------99999-9982997799999999997--6773788


No 112
>PRK07994 DNA polymerase III subunits gamma and tau; Validated
Probab=98.83  E-value=7e-08  Score=78.52  Aligned_cols=171  Identities=20%  Similarity=0.290  Sum_probs=116.7

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHCCC-------------EEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             4467359986056565027999999770882-------------499861888888883563200145671289999983
Q gi|254780270|r  363 KNKGLILCFVGPPGVGKTSLAQSIAKATGRQ-------------YVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKR  429 (820)
Q Consensus       363 ~~~g~il~l~gppgvGKts~~~sia~al~r~-------------f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~  429 (820)
                      +.-.....|.||-||||||+|+-+|++||-.             +..|.-|.--|--||.+-++|=|..+-. ++....-
T Consensus        35 ~r~~haylf~G~rG~GKtt~ari~ak~lnc~~~~~~~pcg~c~~c~~i~~g~~~d~~eidaas~~~vd~~re-l~~~~~y  113 (643)
T PRK07994         35 GRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPCGVCDNCREIEQGRFVDLIEIDAASRTKVEDTRD-LLDNVQY  113 (643)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEECCCCCCHHHHHH-HHHHCCC
T ss_conf             986634874589988888999999999679999999978767768988658988758863677788899999-9984466


Q ss_pred             --CCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHHHCCCEEEEE
Q ss_conf             --2788739999331554231177115566554060016813320103523644279999348655-4413117247998
Q gi|254780270|r  430 --AKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLPLMDRMEIIR  506 (820)
Q Consensus       430 --~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~drme~i~  506 (820)
                        +...--|+++||+..+|...    .+|||..|.             -|  -..|.||+.--+.+ ||...+.|---..
T Consensus       114 ~p~~~r~kvyiidEvhmls~~a----fnalLKtlE-------------eP--p~hv~filaTT~~~k~p~TilSRC~~f~  174 (643)
T PRK07994        114 APARGRFKVYLIDEVHMLSRHS----FNALLKTLE-------------EP--PAHVKFLLATTDPQKLPVTILSRCLQFH  174 (643)
T ss_pred             CCCCCCEEEEEEECHHHCCHHH----HHHHHHHHC-------------CC--CHHCEEEEECCCHHHCCHHHHHHHHHEE
T ss_conf             8877853699972210158999----999998623-------------78--6100899860774548478997776500


Q ss_pred             ECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHH
Q ss_conf             25878689998999860898998625781313228999999973177410234788879
Q gi|254780270|r  507 IAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERAL  565 (820)
Q Consensus       507 ~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i  565 (820)
                      +..-+.++-..         .++.. ++.+.+.++++++..|-+.  -+.++|+--..+
T Consensus       175 ~~~~~~~~i~~---------~l~~i-~~~e~i~~~~~al~~ia~~--a~gs~rdalsl~  221 (643)
T PRK07994        175 LKALDVEQIRH---------QLEHI-LNEEHIAHEPRALQLLARA--ADGSLRDALSLT  221 (643)
T ss_pred             CCCCCHHHHHH---------HHHHH-HHHCCCCCCHHHHHHHHHH--CCCCHHHHHHHH
T ss_conf             16699999999---------99999-9975998788999999997--478656688899


No 113
>PRK05648 DNA polymerase III subunits gamma and tau; Reviewed
Probab=98.79  E-value=2.2e-07  Score=74.71  Aligned_cols=197  Identities=18%  Similarity=0.260  Sum_probs=131.3

Q ss_pred             HHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC-------------CEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHH
Q ss_conf             8424446735998605656502799999977088-------------249986188888888356320014567128999
Q gi|254780270|r  359 MRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGR-------------QYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQ  425 (820)
Q Consensus       359 ~~~~~~~g~il~l~gppgvGKts~~~sia~al~r-------------~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~  425 (820)
                      .+..+.-....+|.|+-||||||+||-+||+||-             .+.-|.-|---|--||.+-+||-|..+-- ++.
T Consensus        31 ~~~~~~~~~a~l~~g~rg~gkt~~ar~~ak~lnc~~~~~~~pc~~c~~c~~i~~~~~~d~~e~d~as~~~v~~~r~-~~~  109 (705)
T PRK05648         31 ALDNQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGVSSTPCGECSVCREIDEGRFVDLIEVDAASRTKVEDTRE-LLD  109 (705)
T ss_pred             HHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEECCCCCCCHHHHHH-HHH
T ss_conf             9970986304650078988898999999998677899988978776004666248977634451554478899999-998


Q ss_pred             HHHH--CCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHHHCCCE
Q ss_conf             9983--2788739999331554231177115566554060016813320103523644279999348655-441311724
Q gi|254780270|r  426 SLKR--AKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLPLMDRM  502 (820)
Q Consensus       426 ~l~~--~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~drm  502 (820)
                      ...-  +...--|+++||+.-+|.+.    .+|||..|.             -|=  ..|.||+---+.+ ||...+.|-
T Consensus       110 ~~~~~p~~~~~kv~~idevhmls~~~----fnallktle-------------epp--~~v~f~~att~~~k~p~t~~src  170 (705)
T PRK05648        110 NVQYAPTRGRYKVYLIDEVHMLSSHS----FNALLKTLE-------------EPP--PHVKFLLATTDPQKLPVTILSRC  170 (705)
T ss_pred             HCCCCCCCCCEEEEEEEHHHHCCHHH----HHHHHHHCC-------------CCC--CCEEEEEECCCHHHCCHHHHHHH
T ss_conf             55517767745799984265417999----999987404-------------797--54599984287353758999766


Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             79982587868999899986089899862578131322899999997317741023478887999989876542117852
Q gi|254780270|r  503 EIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDT  582 (820)
Q Consensus       503 e~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~~~~  582 (820)
                      --.++..-+.++-..         .++. =+..+.+.++++++..|-+.  -+.++|+--..+...+.       .+   
T Consensus       171 ~~~~~~~~~~~~~~~---------~l~~-~~~~e~~~~~~~~~~~~~~~--~~g~~rd~ls~~dq~~~-------~~---  228 (705)
T PRK05648        171 LQFSLKNMSPERVVE---------HLSH-VLGAENVPFEEDALWLLGRA--ADGSMRDAMSLTDQAIA-------FG---  228 (705)
T ss_pred             HHCCCCCCCHHHHHH---------HHHH-HHHHCCCCCCHHHHHHHHHH--CCCCHHHHHHHHHHHHH-------CC---
T ss_conf             430236899999999---------9999-99975997789999999997--48967779999999986-------06---


Q ss_pred             EECCCHHHHHHHHCC
Q ss_conf             012796786753052
Q gi|254780270|r  583 TVSINENNLQDYLGV  597 (820)
Q Consensus       583 ~~~i~~~~l~~~lg~  597 (820)
                      .-.|+.+.+.+.||.
T Consensus       229 ~~~~~~~~v~~mlg~  243 (705)
T PRK05648        229 EGKVLAADVRAMLGT  243 (705)
T ss_pred             CCCCCHHHHHHHHCC
T ss_conf             884079999998588


No 114
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]
Probab=98.79  E-value=1.3e-07  Score=76.46  Aligned_cols=211  Identities=25%  Similarity=0.322  Sum_probs=141.2

Q ss_pred             HCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCE-------------EEEECCCCCCHHHH
Q ss_conf             01168999999999999842444673599860565650279999997708824-------------99861888888883
Q gi|254780270|r  342 FGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQY-------------VRMSLGGVYDEADI  408 (820)
Q Consensus       342 yGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f-------------~~islgg~~d~~~i  408 (820)
                      -|-+-|..-+-+-+.     .+.-..-..|.||-||||||+||-+|+||+-.-             .-|.-|.--|.-||
T Consensus        19 vGQe~v~~~L~nal~-----~~ri~hAYlfsG~RGvGKTt~Ari~AkalNC~~~~~~ePC~~C~~Ck~I~~g~~~DviEi   93 (515)
T COG2812          19 VGQEHVVKTLSNALE-----NGRIAHAYLFSGPRGVGKTTIARILAKALNCENGPTAEPCGKCISCKEINEGSLIDVIEI   93 (515)
T ss_pred             CCCHHHHHHHHHHHH-----HCCCHHHHHHCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCHHH
T ss_conf             364899999999998-----084233365137777671049999999956889877772253166686514886410113


Q ss_pred             CCCCCCCCCCCCHHHHHHHHH--CCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEE
Q ss_conf             563200145671289999983--278873999933155423117711556655406001681332010352364427999
Q gi|254780270|r  409 RGHRRTYIGSMPGRIIQSLKR--AKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFI  486 (820)
Q Consensus       409 ~gh~~ty~ga~pg~ii~~l~~--~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi  486 (820)
                      .+-+.|=|.-+- .|++....  +....=|+++||+.=+|..-    .+|||-.|             +-|.  +.|.||
T Consensus        94 DaASn~gVddiR-~i~e~v~y~P~~~ryKVyiIDEvHMLS~~a----fNALLKTL-------------EEPP--~hV~FI  153 (515)
T COG2812          94 DAASNTGVDDIR-EIIEKVNYAPSEGRYKVYIIDEVHMLSKQA----FNALLKTL-------------EEPP--SHVKFI  153 (515)
T ss_pred             HHHHCCCHHHHH-HHHHHHCCCCCCCCCEEEEEECHHHHHHHH----HHHHHCCC-------------CCCC--CCEEEE
T ss_conf             644454867999-999872468866664189983187643788----88875111-------------3686--674899


Q ss_pred             EECCCCC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHH
Q ss_conf             9348655-441311724799825878689998999860898998625781313228999999973177410234788879
Q gi|254780270|r  487 MTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERAL  565 (820)
Q Consensus       487 ~tan~~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i  565 (820)
                      +-.-+.+ ||...+.|--...+.--+.++-..         .++.. +..+.+.++++++..|.+.  -+.+.|+....+
T Consensus       154 lATTe~~Kip~TIlSRcq~f~fkri~~~~I~~---------~L~~i-~~~E~I~~e~~aL~~ia~~--a~Gs~RDalslL  221 (515)
T COG2812         154 LATTEPQKIPNTILSRCQRFDFKRLDLEEIAK---------HLAAI-LDKEGINIEEDALSLIARA--AEGSLRDALSLL  221 (515)
T ss_pred             EECCCCCCCCHHHHHCCCCCCCCCCCHHHHHH---------HHHHH-HHHCCCCCCHHHHHHHHHH--CCCCHHHHHHHH
T ss_conf             85388676840455212202225799999999---------99999-8744875479999999998--289745677789


Q ss_pred             HHHHHHHHHHHHCCCCCEECCCHHHHHHHHCCCC
Q ss_conf             9998987654211785201279678675305200
Q gi|254780270|r  566 MKIARKAVTKIVKNSDTTVSINENNLQDYLGVPR  599 (820)
Q Consensus       566 ~~i~r~~~~~~~~~~~~~~~i~~~~l~~~lg~~~  599 (820)
                      ..+.-..       .   -.||.+.+.+.+|.-.
T Consensus       222 Dq~i~~~-------~---~~It~~~v~~~lG~~~  245 (515)
T COG2812         222 DQAIAFG-------E---GEITLESVRDMLGLTD  245 (515)
T ss_pred             HHHHHCC-------C---CCCCHHHHHHHHCCCC
T ss_conf             9999706-------7---7656999999968877


No 115
>KOG0744 consensus
Probab=98.78  E-value=4.2e-08  Score=80.19  Aligned_cols=164  Identities=28%  Similarity=0.461  Sum_probs=100.2

Q ss_pred             HHCHHHHHHHHHHHHHHHHHC--CCCC------CCEEEEECCCCCCHHHHHHHHHHHHCCCEE-EEECCCCCCHHHHCCC
Q ss_conf             201168999999999999842--4446------735998605656502799999977088249-9861888888883563
Q gi|254780270|r  341 HFGLEKVKERIIEYLAVQMRV--IKNK------GLILCFVGPPGVGKTSLAQSIAKATGRQYV-RMSLGGVYDEADIRGH  411 (820)
Q Consensus       341 hyGl~~vK~rile~lav~~~~--~~~~------g~il~l~gppgvGKts~~~sia~al~r~f~-~islgg~~d~~~i~gh  411 (820)
                      .|+ ..+|+|.+-|.|---+.  +.+.      -.+++|.||||+|||||+|..|.-|-.... |-+-|-   --||.-|
T Consensus       145 iyd-s~lK~~ll~Ya~s~l~fsek~vntnlIt~NRliLlhGPPGTGKTSLCKaLaQkLSIR~~~~y~~~~---liEinsh  220 (423)
T KOG0744         145 IYD-SNLKERLLSYAASALLFSEKKVNTNLITWNRLILLHGPPGTGKTSLCKALAQKLSIRTNDRYYKGQ---LIEINSH  220 (423)
T ss_pred             HHC-CCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEEEEECCCCCCHHHHHHHHHHHHEEEECCCCCCCE---EEEEEHH
T ss_conf             641-328999999999998887617887446641489985799988227999998751465237644406---9997046


Q ss_pred             CCC-CCCCCCHHHHHHHHH-----C-CCCCEEE-EEECHHHHHH-----HCCCCHH------HHHHHHCCCCCCCCEEEE
Q ss_conf             200-145671289999983-----2-7887399-9933155423-----1177115------566554060016813320
Q gi|254780270|r  412 RRT-YIGSMPGRIIQSLKR-----A-KRSNPLL-LLDEIDKMGS-----DLRGDPS------AALLEVLDPAQNSSFVDH  472 (820)
Q Consensus       412 ~~t-y~ga~pg~ii~~l~~-----~-~~~npv~-~ldeidk~~~-----~~~gdp~------~allevldp~qn~~f~d~  472 (820)
                      +-- --=+--|+.|+.|-+     + .-.|-|| |+||+.-++.     +.+..|+      +|||.-+|-=  +.    
T Consensus       221 sLFSKWFsESgKlV~kmF~kI~ELv~d~~~lVfvLIDEVESLa~aR~s~~S~~EpsDaIRvVNalLTQlDrl--K~----  294 (423)
T KOG0744         221 SLFSKWFSESGKLVAKMFQKIQELVEDRGNLVFVLIDEVESLAAARTSASSRNEPSDAIRVVNALLTQLDRL--KR----  294 (423)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHH--CC----
T ss_conf             788988712113899999999999717896899980787888999875413799821899999999989986--04----


Q ss_pred             ECCCCCCCCCEEEEEECCCCC-CCHHHCCCEEEEEECCCCHHH-HHHHHHH
Q ss_conf             103523644279999348655-441311724799825878689-9989998
Q gi|254780270|r  473 YLEVEYDLSDVMFIMTANTLN-IPLPLMDRMEIIRIAGYTEEE-KLQIAKN  521 (820)
Q Consensus       473 y~~~~~dls~v~fi~tan~~~-i~~~l~drme~i~~~~y~~~e-k~~i~~~  521 (820)
                             -++|+..||.|-.+ |+-++-||-.+...-||-..+ -.+|-+.
T Consensus       295 -------~~NvliL~TSNl~~siD~AfVDRADi~~yVG~Pt~~ai~~Ilks  338 (423)
T KOG0744         295 -------YPNVLILATSNLTDSIDVAFVDRADIVFYVGPPTAEAIYEILKS  338 (423)
T ss_pred             -------CCCEEEEECCCHHHHHHHHHHHHHHHEEECCCCCHHHHHHHHHH
T ss_conf             -------79779996262677778886117542110389639999999999


No 116
>KOG0728 consensus
Probab=98.78  E-value=7.6e-08  Score=78.22  Aligned_cols=139  Identities=32%  Similarity=0.547  Sum_probs=96.0

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCE-EEEEECH
Q ss_conf             467359986056565027999999770882499861888888883563200145671289999983278873-9999331
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNP-LLLLDEI  442 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~np-v~~ldei  442 (820)
                      .+..-.+|+||||+|||-||+.+|.-..-.|.|+|      .||+-   ..|+|--.-+.-.-...|..--| +|++|||
T Consensus       179 aQPKGvlLygppgtGktLlaraVahht~c~firvs------gselv---qk~igegsrmvrelfvmarehapsiifmdei  249 (404)
T KOG0728         179 AQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVS------GSELV---QKYIGEGSRMVRELFVMAREHAPSIIFMDEI  249 (404)
T ss_pred             CCCCCEEEECCCCCCHHHHHHHHHHHCCEEEEEEC------HHHHH---HHHHHHHHHHHHHHHHHHHHCCCCEEEEHHC
T ss_conf             88760488469997562999998754140799964------49999---9985013899999999987508826750000


Q ss_pred             HHHHHHC----C-CCH--HHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCCC-CHHHC-----CCEEEEEECC
Q ss_conf             5542311----7-711--55665540600168133201035236442799993486554-41311-----7247998258
Q gi|254780270|r  443 DKMGSDL----R-GDP--SAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLNI-PLPLM-----DRMEIIRIAG  509 (820)
Q Consensus       443 dk~~~~~----~-gdp--~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~i-~~~l~-----drme~i~~~~  509 (820)
                      |-+|++-    . ||-  ...|||+|.  |-+.|.-+        .++-.|...|-++| .++|+     ||-  |++|+
T Consensus       250 dsigs~r~e~~~ggdsevqrtmlelln--qldgfeat--------knikvimatnridild~allrpgridrk--iefp~  317 (404)
T KOG0728         250 DSIGSSRVESGSGGDSEVQRTMLELLN--QLDGFEAT--------KNIKVIMATNRIDILDPALLRPGRIDRK--IEFPP  317 (404)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHH--HCCCCCCC--------CCEEEEEECCCCCCCCHHHCCCCCCCCC--CCCCC
T ss_conf             121234345789863899999999997--40240003--------6626998416422246866387754555--64899


Q ss_pred             CCHHHHHHHHHHHH
Q ss_conf             78689998999860
Q gi|254780270|r  510 YTEEEKLQIAKNHL  523 (820)
Q Consensus       510 y~~~ek~~i~~~~l  523 (820)
                      -..+-...|.+-|-
T Consensus       318 p~e~ar~~ilkihs  331 (404)
T KOG0728         318 PNEEARLDILKIHS  331 (404)
T ss_pred             CCHHHHHHHHHHHH
T ss_conf             87788878998855


No 117
>KOG0730 consensus
Probab=98.78  E-value=9.7e-07  Score=69.86  Aligned_cols=171  Identities=24%  Similarity=0.350  Sum_probs=102.5

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCC--CEEEEEECH
Q ss_conf             673599860565650279999997708824998618888888835632001456712899999832788--739999331
Q gi|254780270|r  365 KGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRS--NPLLLLDEI  442 (820)
Q Consensus       365 ~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~--npv~~ldei  442 (820)
                      -+.-++++||||+|||.+++.||+--+-.|..|+      ..++-   +-|-|..--..-.+...|...  --++++|||
T Consensus       217 ~prg~Ll~gppg~Gkt~l~~aVa~e~~a~~~~i~------~peli---~k~~gEte~~LR~~f~~a~k~~~psii~IdEl  287 (693)
T KOG0730         217 PPRGLLLYGPPGTGKTFLVRAVANEYGAFLFLIN------GPELI---SKFPGETESNLRKAFAEALKFQVPSIIFIDEL  287 (693)
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHCCEEEECC------CHHHH---HHCCCCHHHHHHHHHHHHHCCCCCEEEEHHHH
T ss_conf             9987444389999818999999997372257406------28999---85246317789999999866599807758767


Q ss_pred             HHHHHHCCC-C-----HHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHHHC----CCEEEEEECCCC
Q ss_conf             554231177-1-----15566554060016813320103523644279999348655-441311----724799825878
Q gi|254780270|r  443 DKMGSDLRG-D-----PSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLPLM----DRMEIIRIAGYT  511 (820)
Q Consensus       443 dk~~~~~~g-d-----p~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~----drme~i~~~~y~  511 (820)
                      |-+....-+ +     ..+.|+..+|---             --++|+-|++.|..+ |.+.|+    ||+-.|-+|  +
T Consensus       288 d~l~p~r~~~~~~e~Rv~sqlltL~dg~~-------------~~~~vivl~atnrp~sld~alRRgRfd~ev~IgiP--~  352 (693)
T KOG0730         288 DALCPKREGADDVESRVVSQLLTLLDGLK-------------PDAKVIVLAATNRPDSLDPALRRGRFDREVEIGIP--G  352 (693)
T ss_pred             HHHCCCCCCCCHHHHHHHHHHHHHHHHCC-------------CCCCEEEEEECCCCCCCCHHHHCCCCCCEEEECCC--C
T ss_conf             62377643332488899999999985276-------------76746999715885556856524788531574489--8


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHH---CCCCCCHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             689998999860898998625781313228999999973---1774102347888799998987654211
Q gi|254780270|r  512 EEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIR---LFTHEAGVRSFERALMKIARKAVTKIVK  578 (820)
Q Consensus       512 ~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~---~Yt~EaGvR~l~r~i~~i~r~~~~~~~~  578 (820)
                      ..++..|.+.+     .+.+++.      ++..++.+-.   .|+   |     ..+..+||.++.....
T Consensus       353 ~~~RldIl~~l-----~k~~~~~------~~~~l~~iA~~thGyv---G-----aDL~~l~~ea~~~~~r  403 (693)
T KOG0730         353 SDGRLDILRVL-----TKKMNLL------SDVDLEDIAVSTHGYV---G-----ADLAALCREASLQATR  403 (693)
T ss_pred             CHHHHHHHHHH-----HHHCCCC------CHHHHHHHHHHCCCHH---H-----HHHHHHHHHHHHHHHH
T ss_conf             33588999999-----8616887------2556899998734614---7-----8799999998777665


No 118
>PRK08903 hypothetical protein; Validated
Probab=98.77  E-value=6.6e-07  Score=71.13  Aligned_cols=178  Identities=14%  Similarity=0.246  Sum_probs=118.2

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHC---CCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEE
Q ss_conf             44673599860565650279999997708---824998618888888835632001456712899999832788739999
Q gi|254780270|r  363 KNKGLILCFVGPPGVGKTSLAQSIAKATG---RQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLL  439 (820)
Q Consensus       363 ~~~g~il~l~gppgvGKts~~~sia~al~---r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~l  439 (820)
                      ...++.+.++||+|+|||.|..+++....   .....++....                 +    ..+... ....++++
T Consensus        39 ~~~~~~l~i~G~~G~GKTHLl~a~~~~~~~~~~~~~yl~~~~~-----------------~----~~~~~~-~~~d~l~i   96 (227)
T PRK08903         39 PVADRFFYLWGEAGSGRSHLLQALVAAASEGGKNARYLDPASP-----------------L----LAFDFD-PRAELYAV   96 (227)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCC-----------------H----HHHHHH-HCCCEEEE
T ss_conf             8878669998999998889999999999806997499651104-----------------5----777420-01898999


Q ss_pred             ECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCC----CCCHHHCCCE---EEEEECCCCH
Q ss_conf             33155423117711556655406001681332010352364427999934865----5441311724---7998258786
Q gi|254780270|r  440 DEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTL----NIPLPLMDRM---EIIRIAGYTE  512 (820)
Q Consensus       440 deidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~----~i~~~l~drm---e~i~~~~y~~  512 (820)
                      |.||.+.    ++...+|.++++-             =.+-.+...++|++..    ++.+-|+.|+   -++++..-..
T Consensus        97 DDi~~i~----~~~q~~lF~l~N~-------------~~~~~~~~ll~s~~~~p~~l~~~~DL~SRl~~gl~~~i~~pdd  159 (227)
T PRK08903         97 DDVERLD----DAQQIALFNLFNR-------------VRAHGKTALLVAGPAAPLALDVREDLRTRLGWGLVYEVKPLSD  159 (227)
T ss_pred             ECCCCCC----CHHHHHHHHHHHH-------------HHHCCCCEEEECCCCCHHHCCCCHHHHHHHHCCCEEEEECCCH
T ss_conf             6411489----5699999999999-------------9972994899718997120120089999993897389979799


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHH
Q ss_conf             89998999860898998625781313228999999973177410234788879999898765421178520127967867
Q gi|254780270|r  513 EEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDTTVSINENNLQ  592 (820)
Q Consensus       513 ~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~  592 (820)
                      +++..|-+++     ..+     .++.++++++.||+++++|.  +|.|+..+..+-+.....       .-.||...++
T Consensus       160 e~~~~iL~~~-----a~~-----rgl~l~~~v~~yl~~r~~R~--~~~L~~~l~~Ld~~sl~~-------kr~iTi~lvk  220 (227)
T PRK08903        160 EDKIAALKAA-----AAE-----RGLQLADEVPDYLLTHFRRD--MPSLMALLDALDRYSLEQ-------KRAVTLPLLR  220 (227)
T ss_pred             HHHHHHHHHH-----HHH-----CCCCCCHHHHHHHHHHHCCC--HHHHHHHHHHHHHHHHHC-------CCCCCHHHHH
T ss_conf             9999999999-----996-----29999889999999983478--999999999999999982-------9999999999


Q ss_pred             HHHCCC
Q ss_conf             530520
Q gi|254780270|r  593 DYLGVP  598 (820)
Q Consensus       593 ~~lg~~  598 (820)
                      +.|..+
T Consensus       221 evLa~~  226 (227)
T PRK08903        221 EMLAAP  226 (227)
T ss_pred             HHHCCC
T ss_conf             985599


No 119
>smart00464 LON Found in ATP-dependent protease La (LON). N-terminal domain of the ATP-dependent protease La (LON), present also in other bacterial ORFs.
Probab=98.76  E-value=1.7e-08  Score=83.24  Aligned_cols=91  Identities=33%  Similarity=0.527  Sum_probs=78.7

Q ss_pred             EEEEEEECCCEECCCEEEEEECCCHHHHHHHHHHHHCC-CEEEEEECCCCCCCCCCHHHEECCCEEEEEEEEEECCCCEE
Q ss_conf             67566317825688714306429489999999999729-84999973686777888656025314899999799889809
Q gi|254780270|r   27 IYPLLPLRDIVVFPYMIVPLFVGREKSVRALDEAMNSH-KKIILVTQMNSNDENPIASSVYRIGTIVDIVQILRLPDGTV  105 (820)
Q Consensus        27 ~LPIlPLrn~VLFPG~vlPL~V~eprsi~aIe~al~~d-~~I~vV~qkD~~~e~p~~edLy~VGTlakI~qi~klpDG~~  105 (820)
                      ++|++|+++.++|||+++++.|++++.++++++.+... .+++++..+|...+.                          
T Consensus         1 ~~~~lpi~~~~lfpg~~~~i~v~~~~~v~ai~e~~~~~qp~v~~~l~~d~~~~~--------------------------   54 (92)
T smart00464        1 TLPLLPIRRRPLFPGFVLPIPVKRPKSVAAIKEALRRSQPYVIVFLLQDDPTET--------------------------   54 (92)
T ss_pred             CCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCCCC--------------------------
T ss_conf             975212567766887557788388889999999998169825688853689998--------------------------


Q ss_pred             EEEEEEEEEEEEEEEEECCCEEEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCHHHHHHH
Q ss_conf             99999754799998870798199999980488888478999999999999999985455777888764126886789999
Q gi|254780270|r  106 KILVEGSVRARIVEYIEREDFLEAITQVLPDPTEDPVELEALSRSVIAEFSNYIKLNKKISPEVIGITSQIEGFSKLADV  185 (820)
Q Consensus       106 ~ILVeGl~RvkI~ei~~~~pyl~A~Ve~l~d~~~d~~eleAL~~~L~e~f~eli~l~~~i~~E~~~~l~~iddp~~LAD~  185 (820)
                                                                                               ++.++|+
T Consensus        55 -------------------------------------------------------------------------~~~~s~~   61 (92)
T smart00464       55 -------------------------------------------------------------------------PEPLSDT   61 (92)
T ss_pred             -------------------------------------------------------------------------CCCCCHH
T ss_conf             -------------------------------------------------------------------------8644100


Q ss_pred             HHHHCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             8852358989999987432479999999999
Q gi|254780270|r  186 IAANLSIKVAERQKILEAVSVKERLEMLLVF  216 (820)
Q Consensus       186 IAs~L~l~~eeKQeLLE~~Di~eRLe~Ll~l  216 (820)
                      +++++++...+||++||+.++..|+++++.+
T Consensus        62 ~~~~~~~~~~~~q~lL~~~~~~~R~~~~i~~   92 (92)
T smart00464       62 IAALMPLELHEKQELLELEGTNKRLEKVIKL   92 (92)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCHHHHHHHCC
T ss_conf             6676168898888999861601778887429


No 120
>PRK06872 DNA polymerase III subunits gamma and tau; Provisional
Probab=98.75  E-value=3.3e-07  Score=73.43  Aligned_cols=167  Identities=21%  Similarity=0.263  Sum_probs=115.8

Q ss_pred             HHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC-------------CEEEEECCCCCCHHHHCCCCCCCCCCCCHHHH
Q ss_conf             98424446735998605656502799999977088-------------24998618888888835632001456712899
Q gi|254780270|r  358 QMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGR-------------QYVRMSLGGVYDEADIRGHRRTYIGSMPGRII  424 (820)
Q Consensus       358 ~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r-------------~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii  424 (820)
                      ..+..+.-....+|.||-||||||+|+-+|++||-             .+..|.-|.--|--||.+-+||-|.-+     
T Consensus        30 ~a~~~~r~~haylf~g~rg~gktt~ari~ak~lnc~~~~~~~pcg~c~~c~~i~~g~~~d~~eidaas~~~v~~~-----  104 (696)
T PRK06872         30 NGLKENRLHHAYLFSGTRGVGKTSIARLFAKGLNCVHGVTATPCGECENCKAIEEGNFIDLIEIDAASRTKVEDT-----  104 (696)
T ss_pred             HHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEECCCCCCHHHH-----
T ss_conf             999719863047511789888889999999986789999999788862257674478775467505655788999-----


Q ss_pred             HHHHHC------CCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHH
Q ss_conf             999832------788739999331554231177115566554060016813320103523644279999348655-4413
Q gi|254780270|r  425 QSLKRA------KRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLP  497 (820)
Q Consensus       425 ~~l~~~------~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~  497 (820)
                      ..|...      ...--|+++||+.-+|.+.    .+|||..|.             -|=  ..|.||+---+.+ ||..
T Consensus       105 r~l~~~~~~~p~~~~~kvy~idevhmls~~~----fnallktle-------------epp--~~v~f~latt~~~k~p~t  165 (696)
T PRK06872        105 RELLDNVQYKPVVGRFKVYLIDEVHMLSRHS----FNALLKTLE-------------EPP--EYVKFLLATTDPQKLPIT  165 (696)
T ss_pred             HHHHHHCCCCCCCCCEEEEEEEHHHHCCHHH----HHHHHHHHC-------------CCC--CCEEEEEECCCHHHCCHH
T ss_conf             9999845457767754799970054438999----999987502-------------797--544899843863227488


Q ss_pred             HCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHH
Q ss_conf             117247998258786899989998608989986257813132289999999731774102347
Q gi|254780270|r  498 LMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRS  560 (820)
Q Consensus       498 l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~  560 (820)
                      .+.|---..+..-+.++-..         .++.. +..+.+.|+++++..|-+.  -...+|+
T Consensus       166 ilsrc~~f~~~~~~~~~i~~---------~l~~i-~~~e~~~~~~~al~~~a~~--a~gs~rd  216 (696)
T PRK06872        166 ILSRCMQFHLKALDQTQIAQ---------HLEFI-LTQENIPFESPALEKLAKA--AQGSIRD  216 (696)
T ss_pred             HHHHHHHEECCCCCHHHHHH---------HHHHH-HHHCCCCCCHHHHHHHHHH--CCCCHHH
T ss_conf             98766530026899999999---------99999-9984997799999999997--5895677


No 121
>PRK05642 DNA replication initiation factor; Validated
Probab=98.73  E-value=1e-06  Score=69.70  Aligned_cols=179  Identities=20%  Similarity=0.350  Sum_probs=120.0

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHH---HHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEEC
Q ss_conf             673599860565650279999997---70882499861888888883563200145671289999983278873999933
Q gi|254780270|r  365 KGLILCFVGPPGVGKTSLAQSIAK---ATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDE  441 (820)
Q Consensus       365 ~g~il~l~gppgvGKts~~~sia~---al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~lde  441 (820)
                      ..+.+-+.||+|.|||.|..+++.   ..+.+.+.+++....+..             | .+++.+...    .++++|-
T Consensus        44 ~~~~l~i~G~~G~GKTHLL~A~~~~~~~~~~~~~yl~~~~~~~~~-------------~-~~~~~l~~~----d~l~IDD  105 (234)
T PRK05642         44 TESLIYLWGKDGVGRSHLLQAACLRFEQRGEPAVYLPLAELLDRG-------------P-ELLDNLEQY----ELVCIDD  105 (234)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEHHHHHHHH-------------H-HHHHHHHHC----CEEEEEC
T ss_conf             788389988999988999999999998079967997899987544-------------9-998624227----9898936


Q ss_pred             HHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCC----CCCC-HHHCCCE---EEEEECCCCHH
Q ss_conf             15542311771155665540600168133201035236442799993486----5544-1311724---79982587868
Q gi|254780270|r  442 IDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANT----LNIP-LPLMDRM---EIIRIAGYTEE  513 (820)
Q Consensus       442 idk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~----~~i~-~~l~drm---e~i~~~~y~~~  513 (820)
                      ||.++...  +-.-+|.++..--+..             .+ -.+.|++.    +++- +=|+.|+   .++++..-..+
T Consensus       106 i~~i~g~~--~~e~~lF~l~N~~~~~-------------~~-~llits~~~P~~l~~~l~DL~SRl~~~~~~~i~~l~d~  169 (234)
T PRK05642        106 LDVIAGKA--DWEEALFHLFNRLRDS-------------GR-RLLLAASKSPRELPVKLPDLKSRLTLALVFQMRGLSDE  169 (234)
T ss_pred             HHHHCCCH--HHHHHHHHHHHHHHHC-------------CC-EEEEECCCCHHHHCCCHHHHHHHHHCCCEEEECCCCHH
T ss_conf             45546885--9999999999999983-------------99-59995787955523001679999957812751489989


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHH
Q ss_conf             99989998608989986257813132289999999731774102347888799998987654211785201279678675
Q gi|254780270|r  514 EKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDTTVSINENNLQD  593 (820)
Q Consensus       514 ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~  593 (820)
                      +|+.|-+++.     .     ...+.++++++.||+++++|.  +|.|...+.++-+.....       +..||-..+++
T Consensus       170 ~~~~iL~~~a-----~-----~rgi~l~~~v~~yl~~r~~R~--~~~L~~~l~~Ld~~sl~~-------kr~iTiplvk~  230 (234)
T PRK05642        170 DKLRALQLRA-----S-----RRGLHLTDEVGHFILTRGTRS--MSALFDLLERLDQASLQA-------QRKLTIPFLKE  230 (234)
T ss_pred             HHHHHHHHHH-----H-----HCCCCCCHHHHHHHHHHCCCC--HHHHHHHHHHHHHHHHHH-------CCCCCHHHHHH
T ss_conf             9999999997-----7-----546899989999999973588--999999999999999983-------89999999999


Q ss_pred             HHC
Q ss_conf             305
Q gi|254780270|r  594 YLG  596 (820)
Q Consensus       594 ~lg  596 (820)
                      .||
T Consensus       231 vLg  233 (234)
T PRK05642        231 TLG  233 (234)
T ss_pred             HHC
T ss_conf             838


No 122
>KOG0727 consensus
Probab=98.73  E-value=3.5e-07  Score=73.25  Aligned_cols=216  Identities=24%  Similarity=0.394  Sum_probs=129.8

Q ss_pred             HHHHCHHHHHHHHHHHHHHH-------HHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCC
Q ss_conf             65201168999999999999-------84244467359986056565027999999770882499861888888883563
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQ-------MRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGH  411 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~-------~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh  411 (820)
                      .|.-||+--|+-|-|-.-.-       +..+--...-.+|+||||+|||-|+|.+|....-.|.|+-      .||.-  
T Consensus       155 ~diggld~qkqeireavelplt~~~ly~qigidpprgvllygppg~gktml~kava~~t~a~firvv------gsefv--  226 (408)
T KOG0727         155 ADIGGLDVQKQEIREAVELPLTHADLYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVV------GSEFV--  226 (408)
T ss_pred             CCCCCCHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCCEEEECCCCCCHHHHHHHHHHCCCHHEEEEC------CHHHH--
T ss_conf             3456621128999988836530788999708899862277579997578999998612611144630------18999--


Q ss_pred             CCCCCCCCCHHHHHHHHHCCCCCE-EEEEECHHHHHHH-CC---C---CHHHHHHHHCCCCCCCCEEEEECCCCCCCCCE
Q ss_conf             200145671289999983278873-9999331554231-17---7---11556655406001681332010352364427
Q gi|254780270|r  412 RRTYIGSMPGRIIQSLKRAKRSNP-LLLLDEIDKMGSD-LR---G---DPSAALLEVLDPAQNSSFVDHYLEVEYDLSDV  483 (820)
Q Consensus       412 ~~ty~ga~pg~ii~~l~~~~~~np-v~~ldeidk~~~~-~~---g---dp~~allevldp~qn~~f~d~y~~~~~dls~v  483 (820)
                       ..|.|--|-+.-.-.+-|+.+-| +|++||||-+..- |-   |   .....|+|+|.  |-..|-- -       .+|
T Consensus       227 -qkylgegprmvrdvfrlakenapsiifideidaiatkrfdaqtgadrevqril~elln--qmdgfdq-~-------~nv  295 (408)
T KOG0727         227 -QKYLGEGPRMVRDVFRLAKENAPSIIFIDEIDAIATKRFDAQTGADREVQRILIELLN--QMDGFDQ-T-------TNV  295 (408)
T ss_pred             -HHHHCCCCHHHHHHHHHHHCCCCCEEEEEHHHHHHHHHCCCCCCCCHHHHHHHHHHHH--HCCCCCC-C-------CCE
T ss_conf             -9985548389999999876169837986224567664124444631899999999997--5147676-6-------655


Q ss_pred             EEEEECCCCC-CCHHH-----CCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCH
Q ss_conf             9999348655-44131-----17247998258786899989998608989986257813132289999999731774102
Q gi|254780270|r  484 MFIMTANTLN-IPLPL-----MDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAG  557 (820)
Q Consensus       484 ~fi~tan~~~-i~~~l-----~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaG  557 (820)
                      -.|...|-.+ +.++|     +||-  |++|----..|.-+     +--+..++.|.+ ++.     ++.+|..-..-+|
T Consensus       296 kvimatnradtldpallrpgrldrk--iefplpdrrqkrlv-----f~titskm~ls~-~vd-----le~~v~rpdkis~  362 (408)
T KOG0727         296 KVIMATNRADTLDPALLRPGRLDRK--IEFPLPDRRQKRLV-----FSTITSKMNLSD-EVD-----LEDLVARPDKISG  362 (408)
T ss_pred             EEEEECCCCCCCCHHHCCCCCCCCC--CCCCCCCHHHHHHH-----HHHHHHCCCCCC-CCC-----HHHHHCCCCCCCH
T ss_conf             8998327555668766287643444--35779854665222-----775431026785-448-----8987418543434


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHH
Q ss_conf             347888799998987654211785201279678675
Q gi|254780270|r  558 VRSFERALMKIARKAVTKIVKNSDTTVSINENNLQD  593 (820)
Q Consensus       558 vR~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~  593 (820)
                           -.|++||..+...-+...  .++|..+++++
T Consensus       363 -----adi~aicqeagm~avr~n--ryvvl~kd~e~  391 (408)
T KOG0727         363 -----ADINAICQEAGMLAVREN--RYVVLQKDFEK  391 (408)
T ss_pred             -----HHHHHHHHHHHHHHHHHC--CEEEEHHHHHH
T ss_conf             -----669999999768998762--54652777999


No 123
>PRK07471 DNA polymerase III subunit delta'; Validated
Probab=98.73  E-value=1.5e-07  Score=76.04  Aligned_cols=154  Identities=18%  Similarity=0.301  Sum_probs=96.6

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHH--HC-CC---C
Q ss_conf             652011689999999999998424446735998605656502799999977088249986188888888--35-63---2
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEAD--IR-GH---R  412 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~--i~-gh---~  412 (820)
                      .+.+|.+.+++.....+.-     ..-..-++|.||+|||||++|..+|++|--....-..+...-...  +. .|   |
T Consensus        17 ~~liGqe~~~~~L~~a~~~-----grl~HA~Lf~Gp~GiGK~tlA~~~A~~ll~~~~~~~~~~~~~~~~l~~~~~~p~~r   91 (363)
T PRK07471         17 TALFGHAAAEAALLDAYRS-----GRLHHAWLIGGPQGIGKATLAYRMARFLLATPPPGGDAVFPPPASLAVDPDHPVAR   91 (363)
T ss_pred             CCCCCHHHHHHHHHHHHHC-----CCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCCCHHH
T ss_conf             7316819999999999985-----99764587679998188999999999985799977777678705312587772899


Q ss_pred             CCCCCCCCHH------------------HHHHHHHC---------CCCCEEEEEECHHHHHHHCCCCHHHHHHHHCC-CC
Q ss_conf             0014567128------------------99999832---------78873999933155423117711556655406-00
Q gi|254780270|r  413 RTYIGSMPGR------------------IIQSLKRA---------KRSNPLLLLDEIDKMGSDLRGDPSAALLEVLD-PA  464 (820)
Q Consensus       413 ~ty~ga~pg~------------------ii~~l~~~---------~~~npv~~ldeidk~~~~~~gdp~~allevld-p~  464 (820)
                      +.--|+-|+-                  -|...+..         .-.-=|+++|+.|+|+.+    -++|||-+|. |-
T Consensus        92 ~i~~~~hpdl~~i~r~~d~k~~~~~~~I~Vd~iR~l~~~~~~~p~~g~~kV~IId~ad~mn~~----aaNALLK~LEEPP  167 (363)
T PRK07471         92 RIAAGAHGGLLTLERSWNEKGKRLRTVITVDEVRETIGFFGLTAAEGGWRVVIVDTADEMNAN----AANALLKVLEEPP  167 (363)
T ss_pred             HHHCCCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCEEEEEECHHHHCHH----HHHHHHHHHCCCC
T ss_conf             995269998466762001133321244539999999999724852489669998687873889----9999999721589


Q ss_pred             CCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHHHCCCEEEEEECCCCHHHHHH
Q ss_conf             16813320103523644279999348655-441311724799825878689998
Q gi|254780270|r  465 QNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQ  517 (820)
Q Consensus       465 qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~drme~i~~~~y~~~ek~~  517 (820)
                                      .+++||...+..+ +++.++.|.-.+.+..-+.++-..
T Consensus       168 ----------------~~t~fiLit~~~~~llpTI~SRCq~~~~~~l~~~~~~~  205 (363)
T PRK07471        168 ----------------ARSLLLLVSHAPARLLPTIRSRCRKLRLRPLAPEDVIA  205 (363)
T ss_pred             ----------------CCEEEEEEECCHHHCHHHHHHHCCCCCCCCCCHHHHHH
T ss_conf             ----------------88389986399777779999735242589959999999


No 124
>KOG0739 consensus
Probab=98.73  E-value=1.6e-07  Score=75.84  Aligned_cols=154  Identities=25%  Similarity=0.363  Sum_probs=91.6

Q ss_pred             HHHCHHHHHHHHHHHHHHH----HHC-CCCC-CCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCC
Q ss_conf             5201168999999999999----842-4446-735998605656502799999977088249986188888888356320
Q gi|254780270|r  340 DHFGLEKVKERIIEYLAVQ----MRV-IKNK-GLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRR  413 (820)
Q Consensus       340 ~hyGl~~vK~rile~lav~----~~~-~~~~-g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~  413 (820)
                      |.-|||.+||-+-|-.-.-    ++. ++.+ -.-++|.||||+||.-|||.+|.--+--|+.+|-.-+  .|---|.+ 
T Consensus       134 DVAGLE~AKeALKEAVILPIKFPqlFtGkR~PwrgiLLyGPPGTGKSYLAKAVATEAnSTFFSvSSSDL--vSKWmGES-  210 (439)
T KOG0739         134 DVAGLEGAKEALKEAVILPIKFPQLFTGKRKPWRGILLYGPPGTGKSYLAKAVATEANSTFFSVSSSDL--VSKWMGES-  210 (439)
T ss_pred             HHCCCHHHHHHHHHHEEECCCCHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEHHHH--HHHHHCCH-
T ss_conf             301405689998754350002535415887754257886799975779999987414770687301788--99873217-


Q ss_pred             CCCCCCCHHHHHHHH-HCCCCCE-EEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCC
Q ss_conf             014567128999998-3278873-99993315542311771155665540600168133201035236442799993486
Q gi|254780270|r  414 TYIGSMPGRIIQSLK-RAKRSNP-LLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANT  491 (820)
Q Consensus       414 ty~ga~pg~ii~~l~-~~~~~np-v~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~  491 (820)
                             -+.|..|- -|...-| +|++||||-+..+-.++-+-|---+     -..|-=+.-+|.-|-+.||....-|-
T Consensus       211 -------EkLVknLFemARe~kPSIIFiDEiDslcg~r~enEseasRRI-----KTEfLVQMqGVG~d~~gvLVLgATNi  278 (439)
T KOG0739         211 -------EKLVKNLFEMARENKPSIIFIDEIDSLCGSRSENESEASRRI-----KTEFLVQMQGVGNDNDGVLVLGATNI  278 (439)
T ss_pred             -------HHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCCCHHHHHHH-----HHHHHHHHHCCCCCCCCEEEEECCCC
T ss_conf             -------999999999987349947986344443268877711777777-----77888764066658886489723788


Q ss_pred             C-CCCHHHCCCEE-EEEEC
Q ss_conf             5-54413117247-99825
Q gi|254780270|r  492 L-NIPLPLMDRME-IIRIA  508 (820)
Q Consensus       492 ~-~i~~~l~drme-~i~~~  508 (820)
                      . ....+.+-|.| .|.+|
T Consensus       279 Pw~LDsAIRRRFekRIYIP  297 (439)
T KOG0739         279 PWVLDSAIRRRFEKRIYIP  297 (439)
T ss_pred             CHHHHHHHHHHHHCCEECC
T ss_conf             4367799998765023010


No 125
>smart00350 MCM minichromosome  maintenance proteins.
Probab=98.72  E-value=4.4e-07  Score=72.43  Aligned_cols=170  Identities=24%  Similarity=0.381  Sum_probs=99.4

Q ss_pred             HHHHHHHCHHHHHHHHHHHHH--HHHHCC---CCCCC-EEEEECCCCCCHHHHHHHHHHHHCCCEEEEE----CCCCCCH
Q ss_conf             776652011689999999999--998424---44673-5998605656502799999977088249986----1888888
Q gi|254780270|r  336 ILDQDHFGLEKVKERIIEYLA--VQMRVI---KNKGL-ILCFVGPPGVGKTSLAQSIAKATGRQYVRMS----LGGVYDE  405 (820)
Q Consensus       336 iLd~~hyGl~~vK~rile~la--v~~~~~---~~~g~-il~l~gppgvGKts~~~sia~al~r~f~~is----lgg~~d~  405 (820)
                      .+--+.||++.||.-|+-.|.  +.+..+   +.+|. -++|+|-||+||+.+-+.+++..-|-.+.-.    -.|+.- 
T Consensus       200 SiaP~I~G~~~vK~allL~L~GG~~~~~~~g~~~Rg~ihiLLvGDPGtgKSqlLk~~~~iaprsvytsG~gsS~aGLTa-  278 (509)
T smart00350      200 SLAPSIYGHEDIKKAILLLLFGGVHKNLPDGMKIRGDINILLLGDPGTAKSQLLKYVEKTAPRAVYTTGKGSSAVGLTA-  278 (509)
T ss_pred             HHCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCEECCCEEEEEECCCCCCHHHHHHHHHHHCCCEEEEECCCCCCCCCEE-
T ss_conf             5497323878899999999708876648988504154149984699823629999999858860687344455577068-


Q ss_pred             HHHC---CCCCC-CCCCCCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCC-
Q ss_conf             8835---63200-145671289999983278873999933155423117711556655406001681332010352364-
Q gi|254780270|r  406 ADIR---GHRRT-YIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDL-  480 (820)
Q Consensus       406 ~~i~---gh~~t-y~ga~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dl-  480 (820)
                      |-.|   +..++ =-||+    |      -..+.|..+||.|||+...+    +||+|+..  |..-..-.= ++..-| 
T Consensus       279 av~rd~~~ge~~leaGAL----V------lAD~GiccIDEfdKm~~~dr----~alhEaME--QQtisiaKa-Gi~~tL~  341 (509)
T smart00350      279 AVTRDPETREFTLEGGAL----V------LADNGVCCIDEFDKMDDSDR----TAIHEAME--QQTISIAKA-GITTTLN  341 (509)
T ss_pred             EEEECCCCCCEEECCCCE----E------CCCCCEEEEEEHHHCCHHHH----HHHHHHHH--HCEEEEECC-CEEEEEE
T ss_conf             999817888378725641----2------05675478521320787789----99999997--487787437-5179985


Q ss_pred             CCEEEEEECCC--------------CCCCHHHCCCEEEEEEC--CCCHHHHHHHHHHHH
Q ss_conf             42799993486--------------55441311724799825--878689998999860
Q gi|254780270|r  481 SDVMFIMTANT--------------LNIPLPLMDRMEIIRIA--GYTEEEKLQIAKNHL  523 (820)
Q Consensus       481 s~v~fi~tan~--------------~~i~~~l~drme~i~~~--~y~~~ek~~i~~~~l  523 (820)
                      +++-.+|.||-              +++|+||+.|...|-+=  .-..+.-..||+.-+
T Consensus       342 aR~sVlAAaNP~~g~yd~~~s~~eni~l~~~LLSRFDLIf~l~D~~~~~~D~~ia~hil  400 (509)
T smart00350      342 ARCSVLAAANPIGGRYDPKLTPEENIDLPAPILSRFDLLFVVLDEVDEERDRELAKHVV  400 (509)
T ss_pred             CCCEEEEEECCCCCCCCCCCCHHHHCCCCHHHHHHCCEEEEEECCCCHHHHHHHHHHHH
T ss_conf             57359986556556378889999946898035410238999615898788999999999


No 126
>TIGR02928 TIGR02928 orc1/cdc6 family replication initiation protein; InterPro: IPR014277   This set of DNA binding proteins shows homology to the origin recognition complex subunit 1/cell division control protein 6 family in eukaryotes. The proteins in this entry are found exclusively in the archaea. Several members may be found in a genome and interact with each other..
Probab=98.72  E-value=1.8e-06  Score=67.75  Aligned_cols=212  Identities=21%  Similarity=0.288  Sum_probs=133.3

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHCC-------C-EEEEECCCCCCH----------HHH--CCC--CCCCCCCC-
Q ss_conf             446735998605656502799999977088-------2-499861888888----------883--563--20014567-
Q gi|254780270|r  363 KNKGLILCFVGPPGVGKTSLAQSIAKATGR-------Q-YVRMSLGGVYDE----------ADI--RGH--RRTYIGSM-  419 (820)
Q Consensus       363 ~~~g~il~l~gppgvGKts~~~sia~al~r-------~-f~~islgg~~d~----------~~i--~gh--~~ty~ga~-  419 (820)
                      ...++=+.++||+|||||+.++-+.+.|.+       . |..+.+---.+.          ..+  +++  .--+-|-= 
T Consensus        40 G~~P~Ni~iYGkTGtGKT~vt~~v~~~l~~~~~~~d~~D~~~~~~NC~~~~T~y~~~~~L~~~ln~~~~~~~vP~tG~s~  119 (383)
T TIGR02928        40 GSRPSNIFIYGKTGTGKTAVTKYVMKELEEAAEDRDVRDVSTVYINCQILDTSYQVLVELANQLNRRGSGEEVPTTGLST  119 (383)
T ss_pred             CCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCH
T ss_conf             48987258878889878899999999999986226997158999778546846999999999851577888898877878


Q ss_pred             ---CHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHH-HHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCC--
Q ss_conf             ---12899999832788739999331554231177115-566554060016813320103523644279999348655--
Q gi|254780270|r  420 ---PGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPS-AALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN--  493 (820)
Q Consensus       420 ---pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~-~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~--  493 (820)
                         ..++.+.|....-.-=||.|||||++=.+...||| |-+|=.|==.+++.-        +|=++|=-|.=-|+++  
T Consensus       120 ~~~~~~l~~~l~~~~~~~~~ivLDEiD~Lv~~~~d~PAyS~~LY~L~Ra~~~~~--------~~~~~vgvIgISND~~f~  191 (383)
T TIGR02928       120 SEVFRELYKELNRERGDSLIIVLDEIDKLVRKDDDDPAYSKLLYQLSRARENGD--------LENAKVGVIGISNDLKFR  191 (383)
T ss_pred             HHHHHHHHHHHHHHCCCEEEEEECCCCHHHCCCCCCHHHHHHHHHHHHHHHCCC--------CCCCCEEEEEEECCCHHH
T ss_conf             999999999983201887999862310221588888078788534331000357--------788534899986571436


Q ss_pred             --CCHHHCCC--EEEEEECCCCHHHHHHHHHHHHHHHHHH-HHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHH
Q ss_conf             --44131172--4799825878689998999860898998-625781313228999999973177410234788879999
Q gi|254780270|r  494 --IPLPLMDR--MEIIRIAGYTEEEKLQIAKNHLVKKVLT-EHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKI  568 (820)
Q Consensus       494 --i~~~l~dr--me~i~~~~y~~~ek~~i~~~~l~p~~~~-~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i  568 (820)
                        +.+=-+|.  =|-|.+|+|..+|=..|-+      .+. +.+|.++  .++|++|.....-+.+|-|  +..+-|. +
T Consensus       192 ~~Ld~RVkSsL~~eei~FpPYdA~eL~~IL~------~R~v~~AF~dG--vl~d~VI~lcAA~aAq~hG--DAR~AiD-L  260 (383)
T TIGR02928       192 ENLDPRVKSSLCEEEIVFPPYDAEELRDILE------NRAVEKAFYDG--VLDDGVIPLCAALAAQEHG--DARKAID-L  260 (383)
T ss_pred             HHCCCCEECCCCCCCCEECCCCHHHHHHHHH------HHHHHHCCCCC--CCCHHHHHHHHHHHHCCCC--CHHHHHH-H
T ss_conf             4457530132487400407988699999997------20312033688--5462279999998620678--7899999-9


Q ss_pred             HHHHHHHHHCCCCCEECCCHHHHHHHH
Q ss_conf             898765421178520127967867530
Q gi|254780270|r  569 ARKAVTKIVKNSDTTVSINENNLQDYL  595 (820)
Q Consensus       569 ~r~~~~~~~~~~~~~~~i~~~~l~~~l  595 (820)
                      .| .|-++++.... -.||.+++++.-
T Consensus       261 LR-~AGe~A~~~g~-~~Vt~~HV~~A~  285 (383)
T TIGR02928       261 LR-VAGEIAEREGA-ERVTEDHVEEAQ  285 (383)
T ss_pred             HH-HHHHHHHHCCC-CCCHHHHHHHHH
T ss_conf             99-87687531576-310088899999


No 127
>KOG0478 consensus
Probab=98.71  E-value=2.2e-07  Score=74.69  Aligned_cols=244  Identities=20%  Similarity=0.262  Sum_probs=133.0

Q ss_pred             HHHHHHCHHHHHHHHHHHHHHHHHCCCC-----CCCE-EEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCC
Q ss_conf             7665201168999999999999842444-----6735-998605656502799999977088249986188888888356
Q gi|254780270|r  337 LDQDHFGLEKVKERIIEYLAVQMRVIKN-----KGLI-LCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRG  410 (820)
Q Consensus       337 Ld~~hyGl~~vK~rile~lav~~~~~~~-----~g~i-l~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~g  410 (820)
                      +--..||||+||.-+|=-|-=+.-+...     +|.| |+|||-||+||+.|-+++++.+-|--+.=--|+-.- . +  
T Consensus       427 iAPsIye~edvKkglLLqLfGGt~k~~~~~~~~R~~INILL~GDPGtsKSqlLqyv~~l~pRg~yTSGkGsSav-G-L--  502 (804)
T KOG0478         427 IAPSIYELEDVKKGLLLQLFGGTRKEDEKSGRFRGDINILLVGDPGTSKSQLLQYCHRLLPRGVYTSGKGSSAV-G-L--  502 (804)
T ss_pred             HCHHHHCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHCCCCEEECCCCCCHH-C-C--
T ss_conf             06565344226666778875687632233444245522899469986789999999974775404058763022-0-0--


Q ss_pred             CCCCCCCC--CCHHHHH-HHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEEC-CCCCCCCCEEEE
Q ss_conf             32001456--7128999-9983278873999933155423117711556655406001681332010-352364427999
Q gi|254780270|r  411 HRRTYIGS--MPGRIIQ-SLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYL-EVEYDLSDVMFI  486 (820)
Q Consensus       411 h~~ty~ga--~pg~ii~-~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~-~~~~dls~v~fi  486 (820)
                        -+||--  --++.|+ +=.-+=.-|.+--+||.|||+.+.|    |.|+||+.-+.=+-=.---+ -++   -+.=.+
T Consensus       503 --TayVtrd~dtkqlVLesGALVLSD~GiCCIDEFDKM~dStr----SvLhEvMEQQTvSIAKAGII~sLN---AR~SVL  573 (804)
T KOG0478         503 --TAYVTKDPDTRQLVLESGALVLSDNGICCIDEFDKMSDSTR----SVLHEVMEQQTLSIAKAGIIASLN---ARCSVL  573 (804)
T ss_pred             --EEEEEECCCCCEEEEECCCEEECCCCEEECHHHHHHHHHHH----HHHHHHHHHHHHHHHHCCEEEECC---CCCEEE
T ss_conf             --35677657655466504848972896577112333327788----999999987631174302234216---653034


Q ss_pred             EECC--------------CCCCCHHHCCCEEEEEECCCCHHHH--H----HHHHHHH--------------HHHHHHHHC
Q ss_conf             9348--------------6554413117247998258786899--9----8999860--------------898998625
Q gi|254780270|r  487 MTAN--------------TLNIPLPLMDRMEIIRIAGYTEEEK--L----QIAKNHL--------------VKKVLTEHA  532 (820)
Q Consensus       487 ~tan--------------~~~i~~~l~drme~i~~~~y~~~ek--~----~i~~~~l--------------~p~~~~~~~  532 (820)
                      |.||              .+++|++|+.|+..|.+===-.+|.  .    +|..-|.              +-+..-.+.
T Consensus       574 AaANP~~skynp~k~i~eNI~LpptLLSRFDLIylllD~~DE~~Dr~La~HivsLy~e~~~~~~~~~~d~~~lr~yi~yA  653 (804)
T KOG0478         574 AAANPIRSKYNPNKSIIENINLPPTLLSRFDLIFLLLDKPDERSDRRLADHIVALYPETGEKQGSEAIDMNLLRDYIRYA  653 (804)
T ss_pred             EEECCCCCCCCCCCCHHHCCCCCHHHHHHHCEEEEEECCCCHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             45354324579997623216788056432337899842753267789999999841455521025778689999999997


Q ss_pred             CCCCCCCCCHHHHHHHHHCCC--C----CCH-HHHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHH
Q ss_conf             781313228999999973177--4----102-34788879999898765421178520127967867530
Q gi|254780270|r  533 LKQEECCISDGVLLDIIRLFT--H----EAG-VRSFERALMKIARKAVTKIVKNSDTTVSINENNLQDYL  595 (820)
Q Consensus       533 ~~~~~~~~~~~~i~~ii~~Yt--~----EaG-vR~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~l  595 (820)
                      .+...-.+++++...++..|-  |    ++| .-.--|+++.+.|-....--  ....-.+...++++.+
T Consensus       654 rk~i~p~l~~ea~~~l~~ayvd~rk~~~~~~~itat~rQlesLiRlsEahak--~r~s~~ve~~dV~eA~  721 (804)
T KOG0478         654 RKNIHPALSPEASQALIQAYVDMRKIGEGAGQITATPRQLESLIRLSEAHAK--MRLSNRVEEIDVEEAV  721 (804)
T ss_pred             HCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHH--HHCCCCCCHHHHHHHH
T ss_conf             4257865568999999998665665313456530148889999999998887--6402555445599999


No 128
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR005938    The ATPase Cdc48 is required for membrane fusion and protein degradation. It possesses chaperone-like activities and can functionally interact with Hsc70. Yeast CDC48 plays a role in cell division control whereas eukaryotic homologues are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus.; GO: 0016787 hydrolase activity.
Probab=98.71  E-value=1.7e-07  Score=75.62  Aligned_cols=160  Identities=28%  Similarity=0.475  Sum_probs=111.9

Q ss_pred             HHHCHHHHHHHHHHHHHHHHHCCC-------CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCC
Q ss_conf             520116899999999999984244-------4673599860565650279999997708824998618888888835632
Q gi|254780270|r  340 DHFGLEKVKERIIEYLAVQMRVIK-------NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHR  412 (820)
Q Consensus       340 ~hyGl~~vK~rile~lav~~~~~~-------~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~  412 (820)
                      |.-||++..++|-|++-.-...|.       -.+.-++|+||||+|||-|||++|+-.+-.|..|.  |    -||-.  
T Consensus       207 diG~l~e~~~~~re~~elP~~hPe~f~~lGiePPkG~ll~GPPGtGktllaka~ane~~a~f~~in--G----Peims--  278 (980)
T TIGR01243       207 DIGGLKEAVKKIREMVELPLKHPELFEKLGIEPPKGVLLYGPPGTGKTLLAKAVANEAGAYFIAIN--G----PEIMS--  278 (980)
T ss_pred             HCCCHHHHHHHHHHHHHCCCCCHHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHHHCCCEEEEEC--C----CHHHH--
T ss_conf             203358999999998843575647898618899873587558986178999998753055178850--6----03443--


Q ss_pred             CCCCCCCCHHHHHHHHHCCCCCE-EEEEECHHHHHHH---CCCCH----HHHHHHHCCCCCCCCEEEEECCCCCCCCCEE
Q ss_conf             00145671289999983278873-9999331554231---17711----5566554060016813320103523644279
Q gi|254780270|r  413 RTYIGSMPGRIIQSLKRAKRSNP-LLLLDEIDKMGSD---LRGDP----SAALLEVLDPAQNSSFVDHYLEVEYDLSDVM  484 (820)
Q Consensus       413 ~ty~ga~pg~ii~~l~~~~~~np-v~~ldeidk~~~~---~~gdp----~~allevldp~qn~~f~d~y~~~~~dls~v~  484 (820)
                       -|.|..--++-+..+.|..+.| +|++||||-+..-   ..|..    .+-||.+.|--...             .+|+
T Consensus       279 -ky~Ge~e~~lr~if~eaeenaP~iifideidaiaPkr~e~~Geve~r~v~qlltlmdGlk~r-------------G~v~  344 (980)
T TIGR01243       279 -KYYGESEERLREIFKEAEENAPSIIFIDEIDAIAPKREEVTGEVEKRVVAQLLTLMDGLKGR-------------GKVI  344 (980)
T ss_pred             -HHCCCCHHHHHHHHHHHHHCCCCEEEEECHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHCCC-------------CEEE
T ss_conf             -31363078999999865305870787412110076410000168899999999997400248-------------7289


Q ss_pred             EEEECCCCC-CCHHH-----CCCEEEEEECCCC-HHHHHHHHHH
Q ss_conf             999348655-44131-----1724799825878-6899989998
Q gi|254780270|r  485 FIMTANTLN-IPLPL-----MDRMEIIRIAGYT-EEEKLQIAKN  521 (820)
Q Consensus       485 fi~tan~~~-i~~~l-----~drme~i~~~~y~-~~ek~~i~~~  521 (820)
                      .|-..|-.+ +.++|     .||-=.|..|.-. -.|-++|-.+
T Consensus       345 viGatnrP~a~dPalrrPGrfdrei~~~~Pd~~~r~eil~~htr  388 (980)
T TIGR01243       345 VIGATNRPDALDPALRRPGRFDREIEIGVPDKEGRKEILQIHTR  388 (980)
T ss_pred             EEECCCCCCCCCHHHCCCCCCCCEEEECCCCHHHHHHHHHHHHC
T ss_conf             98146885002622427886443357418854567888876414


No 129
>KOG0735 consensus
Probab=98.71  E-value=3.7e-07  Score=73.01  Aligned_cols=227  Identities=15%  Similarity=0.160  Sum_probs=119.2

Q ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCC----EEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCE-
Q ss_conf             244467359986056565027999999770882----499861888888883563200145671289999983278873-
Q gi|254780270|r  361 VIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQ----YVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNP-  435 (820)
Q Consensus       361 ~~~~~g~il~l~gppgvGKts~~~sia~al~r~----f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~np-  435 (820)
                      .+-...+-|.|.||+|.|||.|+++|++-.-.+    +.++|      -+.++|.+--   ..---+......|--+-| 
T Consensus       426 spv~~~~~Ill~G~~GsGKT~L~kal~~~~~k~~~~hv~~v~------Cs~l~~~~~e---~iQk~l~~vfse~~~~~PS  496 (952)
T KOG0735         426 SPVFRHGNILLNGPKGSGKTNLVKALFDYYSKDLIAHVEIVS------CSTLDGSSLE---KIQKFLNNVFSEALWYAPS  496 (952)
T ss_pred             CCCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEEEE------CHHCCCHHHH---HHHHHHHHHHHHHHHHCCC
T ss_conf             543346618986799877769999999875156506999975------2210420489---9999999999998863780


Q ss_pred             EEEEECHHHHHH--HCCCCH---HHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHHHCCC---EEEEE
Q ss_conf             999933155423--117711---5566554060016813320103523644279999348655-44131172---47998
Q gi|254780270|r  436 LLLLDEIDKMGS--DLRGDP---SAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLPLMDR---MEIIR  506 (820)
Q Consensus       436 v~~ldeidk~~~--~~~gdp---~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~dr---me~i~  506 (820)
                      ||+||.+|-+.+  +..+.+   ++-+|       ++...|+-...--+=+++-||+|-++++ |++-|-+-   -+++.
T Consensus       497 iIvLDdld~l~~~s~~e~~q~~~~~~rl-------a~flnqvi~~y~~~~~~ia~Iat~qe~qtl~~~L~s~~~Fq~~~~  569 (952)
T KOG0735         497 IIVLDDLDCLASASSNENGQDGVVSERL-------AAFLNQVIKIYLKRNRKIAVIATGQELQTLNPLLVSPLLFQIVIA  569 (952)
T ss_pred             EEEECCHHHHHCCCCCCCCCCHHHHHHH-------HHHHHHHHHHHHCCCCEEEEEEECHHHHHCCHHHCCCCCEEEEEE
T ss_conf             8997050354056844477302899999-------999999999987068579999851434203853347631478881


Q ss_pred             ECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHH---HHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCE
Q ss_conf             25878689998999860898998625781313228999999---973177410234788879999898765421178520
Q gi|254780270|r  507 IAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLD---IIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDTT  583 (820)
Q Consensus       507 ~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~---ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~~~~~  583 (820)
                      ++.-...+.-+|-+...-.++          ..++.+-+..   --+.|-    .++|+-....++-.+-++..-+.  +
T Consensus       570 L~ap~~~~R~~IL~~~~s~~~----------~~~~~~dLd~ls~~TEGy~----~~DL~ifVeRai~~a~leris~~--~  633 (952)
T KOG0735         570 LPAPAVTRRKEILTTIFSKNL----------SDITMDDLDFLSVKTEGYL----ATDLVIFVERAIHEAFLERISNG--P  633 (952)
T ss_pred             CCCCCHHHHHHHHHHHHHHHH----------HHHHHHHHHHHHHHCCCCC----CHHHHHHHHHHHHHHHHHHHCCC--C
T ss_conf             589235679999999997553----------4545678998887607844----04479999999999998875167--6


Q ss_pred             ECCCHHHHHHHHCCCCCCC---CCHHCCCCCCCCCEEEECCCCCE
Q ss_conf             1279678675305200033---20002233650000000001680
Q gi|254780270|r  584 VSINENNLQDYLGVPRYKY---GKIEGEDQVGIVTGLAWTEVGGE  625 (820)
Q Consensus       584 ~~i~~~~l~~~lg~~~~~~---~~~~~~~~~G~v~GLa~t~~GG~  625 (820)
                      ..+|.+++.+-|.  .|..   ..+..    -.-+||.|--.||.
T Consensus       634 klltke~f~ksL~--~F~P~aLR~ik~----~k~tgi~w~digg~  672 (952)
T KOG0735         634 KLLTKELFEKSLK--DFVPLALRGIKL----VKSTGIRWEDIGGL  672 (952)
T ss_pred             CCCHHHHHHHHHH--HCCHHHHHHCCC----CCCCCCCCEECCCH
T ss_conf             3101889999987--407677640301----56678771003358


No 130
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional
Probab=98.70  E-value=6.6e-07  Score=71.10  Aligned_cols=167  Identities=19%  Similarity=0.244  Sum_probs=113.3

Q ss_pred             HHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC-----C-------------EEEEECCCCCCHHHHCCCCCCCCCCCC
Q ss_conf             8424446735998605656502799999977088-----2-------------499861888888883563200145671
Q gi|254780270|r  359 MRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGR-----Q-------------YVRMSLGGVYDEADIRGHRRTYIGSMP  420 (820)
Q Consensus       359 ~~~~~~~g~il~l~gppgvGKts~~~sia~al~r-----~-------------f~~islgg~~d~~~i~gh~~ty~ga~p  420 (820)
                      .+..+.-....+|.||-||||||+|+-+|++||-     +             +..|.-|.--|.-||.+-++|-|.-+ 
T Consensus        31 a~~~~r~~haylf~G~rGvGKTt~ari~Ak~lnc~~~~~~~g~~~~pcg~C~~C~~i~~g~~~d~~EiDaas~~~v~~~-  109 (721)
T PRK12323         31 ALEQQRLHHAYLFTGTRGVGKTTLSRILAKSLNCTGPDGEGGITAQPCGQCRACTEIDAGRFVDYIEMDAASNRGVDEM-  109 (721)
T ss_pred             HHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEECCCCCCHHHH-
T ss_conf             9971997544750279988898999999999768998667898788787765468775689876477436767888999-


Q ss_pred             HHHHHHHHHC------CCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCC-
Q ss_conf             2899999832------788739999331554231177115566554060016813320103523644279999348655-
Q gi|254780270|r  421 GRIIQSLKRA------KRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN-  493 (820)
Q Consensus       421 g~ii~~l~~~------~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~-  493 (820)
                          ..|...      ...--|+++||+.-+|..-    .+|||..|.             -|=  ..|.||+---+.+ 
T Consensus       110 ----r~l~~~~~y~P~~~~~KvyiiDevhmls~~a----fnalLKtlE-------------ePP--~hv~FilaTT~~~K  166 (721)
T PRK12323        110 ----AQLLDQAVYAPTAGRFKVYMIDEVHMLTNHA----FNAMLKTLE-------------EPP--PHVKFILATTDPQK  166 (721)
T ss_pred             ----HHHHHHCCCCCCCCCEEEEEEECCCCCCHHH----HHHHHHHHC-------------CCC--CCEEEEEECCCHHH
T ss_conf             ----9999854558876644699985400058999----999998401-------------797--55389994386344


Q ss_pred             CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHH
Q ss_conf             44131172479982587868999899986089899862578131322899999997317741023478
Q gi|254780270|r  494 IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSF  561 (820)
Q Consensus       494 i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l  561 (820)
                      ||...+.|---..+..-+.++-..         .++.. ++.+.+.++++++..|.+.  -+.++|+-
T Consensus       167 ip~TilSRc~~f~~~~~~~~~i~~---------~l~~i-~~~E~i~~~~~al~~ia~~--a~Gs~RDa  222 (721)
T PRK12323        167 IPVTVLSRCLQFNLKQMPPGHIVS---------HLDAI-LGQEGIGHEGNALRLLAQA--AHGSMRDA  222 (721)
T ss_pred             CCHHHHHHHHHCCCCCCCHHHHHH---------HHHHH-HHHCCCCCCHHHHHHHHHH--CCCCHHHH
T ss_conf             858898776542347899999999---------99999-9983997799999999997--58964768


No 131
>KOG0736 consensus
Probab=98.68  E-value=5.6e-07  Score=71.69  Aligned_cols=222  Identities=23%  Similarity=0.380  Sum_probs=125.2

Q ss_pred             HHHHCHHHHHHHHHHHHHHH-----HHCCCC-CCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCC
Q ss_conf             65201168999999999999-----842444-673599860565650279999997708824998618888888835632
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQ-----MRVIKN-KGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHR  412 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~-----~~~~~~-~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~  412 (820)
                      .|.=||++||.-|++-+-.-     -+.... |-+-+.|+||||+|||-+||.+|.-....|  +|+-|   ..-|.   
T Consensus       672 dDVGGLeevK~eIldTIqlPL~hpeLfssglrkRSGILLYGPPGTGKTLlAKAVATEcsL~F--lSVKG---PELLN---  743 (953)
T KOG0736         672 DDVGGLEEVKTEILDTIQLPLKHPELFSSGLRKRSGILLYGPPGTGKTLLAKAVATECSLNF--LSVKG---PELLN---  743 (953)
T ss_pred             HCCCCHHHHHHHHHHHHCCCCCCHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHCEEEE--EEECC---HHHHH---
T ss_conf             01557899999999875475437566512543135058877999855799999875430367--85058---89988---


Q ss_pred             CCCCCCCCHHHHHHHHHCCCCC-EEEEEECHHHHHH--HCCCCH-------HHHHHHHCCCCCCCCEEEEECCCCCCCCC
Q ss_conf             0014567128999998327887-3999933155423--117711-------55665540600168133201035236442
Q gi|254780270|r  413 RTYIGSMPGRIIQSLKRAKRSN-PLLLLDEIDKMGS--DLRGDP-------SAALLEVLDPAQNSSFVDHYLEVEYDLSD  482 (820)
Q Consensus       413 ~ty~ga~pg~ii~~l~~~~~~n-pv~~ldeidk~~~--~~~gdp-------~~allevldp~qn~~f~d~y~~~~~dls~  482 (820)
                       -|||-----.=.-.-+|...- |||+|||||-+..  +..||-       .|-||-=||-=-+.+           .-.
T Consensus       744 -MYVGqSE~NVR~VFerAR~A~PCVIFFDELDSlAP~RG~sGDSGGVMDRVVSQLLAELDgls~~~-----------s~~  811 (953)
T KOG0736         744 -MYVGQSEENVREVFERARSAAPCVIFFDELDSLAPNRGRSGDSGGVMDRVVSQLLAELDGLSDSS-----------SQD  811 (953)
T ss_pred             -HHHCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCC-----------CCC
T ss_conf             -77430188899999985446974998312123275678878865408999999999862666788-----------886


Q ss_pred             EEEEEECCCCC-CCHHHC--CCEEE-EEEC-CCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCH
Q ss_conf             79999348655-441311--72479-9825-8786899989998608989986257813132289999999731774102
Q gi|254780270|r  483 VMFIMTANTLN-IPLPLM--DRMEI-IRIA-GYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAG  557 (820)
Q Consensus       483 v~fi~tan~~~-i~~~l~--drme~-i~~~-~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaG  557 (820)
                      ||.|.--|--| ++++|+  -|..- +.+- +-+.+.|..|-+-     +-.+..|.+ .|.+- ++.+..=.+||   |
T Consensus       812 VFViGATNRPDLLDpALLRPGRFDKLvyvG~~~d~esk~~vL~A-----lTrkFkLde-dVdL~-eiAk~cp~~~T---G  881 (953)
T KOG0736         812 VFVIGATNRPDLLDPALLRPGRFDKLVYVGPNEDAESKLRVLEA-----LTRKFKLDE-DVDLV-EIAKKCPPNMT---G  881 (953)
T ss_pred             EEEEECCCCCCCCCHHHCCCCCCCEEEEECCCCCHHHHHHHHHH-----HHHHCCCCC-CCCHH-HHHHHCCCCCC---H
T ss_conf             59982588855457655388765524885588567889999999-----887702878-76799-99963896775---2


Q ss_pred             HHHHHHHHHHHHHHHHHH--------HH-------CCCCCEECCCHHHHHHHH
Q ss_conf             347888799998987654--------21-------178520127967867530
Q gi|254780270|r  558 VRSFERALMKIARKAVTK--------IV-------KNSDTTVSINENNLQDYL  595 (820)
Q Consensus       558 vR~l~r~i~~i~r~~~~~--------~~-------~~~~~~~~i~~~~l~~~l  595 (820)
                      -     .+++||..+-+.        +-       +.....+.|+.++.-+-.
T Consensus       882 A-----DlYsLCSdA~l~AikR~i~~ie~g~~~~~e~~~~~v~V~~eDflks~  929 (953)
T KOG0736         882 A-----DLYSLCSDAMLAAIKRTIHDIESGTISEEEQESSSVRVTMEDFLKSA  929 (953)
T ss_pred             H-----HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEHHHHHHHH
T ss_conf             4-----79999889999999999777650553300148851788789999999


No 132
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism]
Probab=98.67  E-value=5.2e-07  Score=71.93  Aligned_cols=227  Identities=19%  Similarity=0.299  Sum_probs=141.1

Q ss_pred             HHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC----------------------------
Q ss_conf             2011689999999999998424446735998605656502799999977088----------------------------
Q gi|254780270|r  341 HFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGR----------------------------  392 (820)
Q Consensus       341 hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r----------------------------  392 (820)
                      .-|.+..|.-++    ....++...|-.|.  |+.|+|||+++++||.-|--                            
T Consensus        19 ivGqd~lk~aL~----l~av~P~iggvLI~--G~kGtaKSt~~Rala~LLp~~~~V~gc~f~cdP~~P~~~c~~c~~k~~   92 (423)
T COG1239          19 IVGQDPLKLALG----LNAVDPQIGGALIA--GEKGTAKSTLARALADLLPEIEVVIGCPFNCDPDDPEEMCDECRAKGD   92 (423)
T ss_pred             HCCCHHHHHHHH----HHHCCCCCCEEEEE--CCCCCCHHHHHHHHHHHCCCCCEECCCCCCCCCCCHHHHHHHHHHHCC
T ss_conf             437537778876----53026310426876--688752779999999867963321688788998870555199986202


Q ss_pred             ------------CEEEEECCCCCC--------HHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCC
Q ss_conf             ------------249986188888--------888356320014567128999998327887399993315542311771
Q gi|254780270|r  393 ------------QYVRMSLGGVYD--------EADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGD  452 (820)
Q Consensus       393 ------------~f~~islgg~~d--------~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gd  452 (820)
                                  +|+-..+|-+.|        +.-++++.+++   .||.+-+|      +..|+++||+--+....   
T Consensus        93 e~~~~~~~~r~v~~v~lPl~ateDrvvGslDi~ka~~~g~~af---~PGlLa~A------nRGIlYvDEvnlL~d~l---  160 (423)
T COG1239          93 ELEWLPREKRKVPFVALPLGATEDRLVGSLDIEKALEEGPKAF---QPGLLARA------NRGILYVDEVNLLDDHL---  160 (423)
T ss_pred             CCCCCCCCCEECCEECCCCCCCHHHHCCCCCHHHHHHCCCCCC---CCCCHHHC------CCCEEEEECCCCCCHHH---
T ss_conf             3244542210031223887630433004567999972683002---77511003------58879872334351899---


Q ss_pred             HHHHHHHHCCCCCCCCEEEEEC-CCCCCCCCEEEEEECCCC--CCCHHHCCC-EEEEEECCC-CHHHHHHHHHHHHH---
Q ss_conf             1556655406001681332010-352364427999934865--544131172-479982587-86899989998608---
Q gi|254780270|r  453 PSAALLEVLDPAQNSSFVDHYL-EVEYDLSDVMFIMTANTL--NIPLPLMDR-MEIIRIAGY-TEEEKLQIAKNHLV---  524 (820)
Q Consensus       453 p~~allevldp~qn~~f~d~y~-~~~~dls~v~fi~tan~~--~i~~~l~dr-me~i~~~~y-~~~ek~~i~~~~l~---  524 (820)
                       ..+||.++----|.-=++-|- -.|   +++++|+|+|-.  ++-++|+|| +..|.+.+- ..++.++|.++-+-   
T Consensus       161 -vd~LLd~aaeG~n~vereGisi~hp---a~fvligTmNPEeGeLrpqLlDRfg~~v~~~~~~~~~~rv~Ii~r~~~f~~  236 (423)
T COG1239         161 -VDALLDVAAEGVNDVEREGISIRHP---ARFLLIGTMNPEEGELRPQLLDRFGLEVDTHYPLDLEERVEIIRRRLAFEA  236 (423)
T ss_pred             -HHHHHHHHHHCCCEEEECCEEECCC---CCEEEEEECCCCCCCCCHHHHHHHCCEEECCCCCCHHHHHHHHHHHHHHHC
T ss_conf             -9999999971774033575031367---617999644854466324667541115623478878888999999887500


Q ss_pred             -H----------------HHHH-HHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEECC
Q ss_conf             -9----------------8998-625781313228999999973177410234788879999898765421178520127
Q gi|254780270|r  525 -K----------------KVLT-EHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDTTVSI  586 (820)
Q Consensus       525 -p----------------~~~~-~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~~~~~~~i  586 (820)
                       |                +++. ..++  .++.+++++..+|. .-+++++|+...-.+. +.| ++.-++.- .....+
T Consensus       237 ~Pe~f~~~~~~~~~~lR~~ii~ar~~l--~~V~l~~~~~~~ia-~~~~~~~v~g~radi~-~~r-~a~a~aa~-~Gr~~v  310 (423)
T COG1239         237 VPEAFLEKYADAQRALRARIIAARSLL--SEVELDDDAETKIA-ELCARLAVDGHRADIV-VVR-AAKALAAL-RGRTEV  310 (423)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHCC--CCCCCCHHHHHHHH-HHHHHHCCCCCCHHHH-HHH-HHHHHHHH-CCCEEE
T ss_conf             829999999999999999999998446--66467677999999-9999856578742567-899-99999875-396045


Q ss_pred             CHHHHHHHH
Q ss_conf             967867530
Q gi|254780270|r  587 NENNLQDYL  595 (820)
Q Consensus       587 ~~~~l~~~l  595 (820)
                      +.+++.+.+
T Consensus       311 ~~~Di~~a~  319 (423)
T COG1239         311 EEEDIREAA  319 (423)
T ss_pred             EHHHHHHHH
T ss_conf             201377777


No 133
>PRK08084 DNA replication initiation factor; Provisional
Probab=98.67  E-value=3e-06  Score=66.17  Aligned_cols=186  Identities=16%  Similarity=0.270  Sum_probs=120.2

Q ss_pred             HHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHH---HCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCC
Q ss_conf             9998424446735998605656502799999977---0882499861888888883563200145671289999983278
Q gi|254780270|r  356 AVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKA---TGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKR  432 (820)
Q Consensus       356 av~~~~~~~~g~il~l~gppgvGKts~~~sia~a---l~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~  432 (820)
                      |+.....+..+..+.++||+|+|||.|..+++..   .++....+++.-..              ...-.+.+++..   
T Consensus        35 al~~~~~~~~~~~l~l~G~~G~GKTHLLqA~~~~~~~~~~~~~yl~~~~~~--------------~~~~~~l~~l~~---   97 (235)
T PRK08084         35 ALQNVLRQEHSGYIYLWGREGAGRSHLLHAACAELSQRGDAVGYVPLDKRA--------------WFVPEVLEGMEQ---   97 (235)
T ss_pred             HHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEHHHHH--------------HHHHHHHHHHHH---
T ss_conf             999998578987699989999888999999999997079857998779866--------------517999987641---


Q ss_pred             CCEEEEEECHHHHHHHCCCCH--HHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCC--CCC---HHHCCCE---
Q ss_conf             873999933155423117711--556655406001681332010352364427999934865--544---1311724---
Q gi|254780270|r  433 SNPLLLLDEIDKMGSDLRGDP--SAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTL--NIP---LPLMDRM---  502 (820)
Q Consensus       433 ~npv~~ldeidk~~~~~~gdp--~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~--~i~---~~l~drm---  502 (820)
                       -.++++|.||.++    |++  .-||.++++-             -.+-.+.-.+.|++..  +++   +=|+.|+   
T Consensus        98 -~dll~iDDi~~i~----g~~~~ee~lF~l~N~-------------~~~~g~~~ll~ts~~~P~~l~~~l~DL~SRl~~g  159 (235)
T PRK08084         98 -LSLVCIDNIECIA----GDELWEMAIFDLYNR-------------ILESGKTRLLITGDRPPRQLNLGLPDLASRLDWG  159 (235)
T ss_pred             -CCEEEEECHHHHC----CCHHHHHHHHHHHHH-------------HHHHCCCEEEEECCCCHHHCCCCCHHHHHHHHCC
T ss_conf             -8989982745546----997899999999999-------------9984896699967988243023128899999569


Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             79982587868999899986089899862578131322899999997317741023478887999989876542117852
Q gi|254780270|r  503 EIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDT  582 (820)
Q Consensus       503 e~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~~~~  582 (820)
                      -+.++.....++|+.|.+++     ....     .+.++++++.||++++.|.  +|.|+..+..+-+..-.       .
T Consensus       160 ~~~~i~~~dde~~~~iL~~~-----a~~r-----gl~l~~~V~~yl~~~~~R~--~~~L~~~l~~Ld~~Sl~-------~  220 (235)
T PRK08084        160 QIYKLQPLSDEEKLQALQLR-----ARLR-----GFELPEDVGRFLLKRLDRE--MRTLFMTLDQLDKASIT-------A  220 (235)
T ss_pred             CEEEECCCCHHHHHHHHHHH-----HHHC-----CCCCCHHHHHHHHHHCCCC--HHHHHHHHHHHHHHHHH-------C
T ss_conf             72785599989999999999-----9973-----9999989999999861588--99999999999999998-------1


Q ss_pred             EECCCHHHHHHHH
Q ss_conf             0127967867530
Q gi|254780270|r  583 TVSINENNLQDYL  595 (820)
Q Consensus       583 ~~~i~~~~l~~~l  595 (820)
                      .-.||-..+++.|
T Consensus       221 kr~iTip~vkevL  233 (235)
T PRK08084        221 QRKLTIPFVKEIL  233 (235)
T ss_pred             CCCCCHHHHHHHH
T ss_conf             9999999999996


No 134
>smart00763 AAA_PrkA PrkA AAA domain. This is a family of PrkA bacterial and archaeal serine kinases approximately 630 residues long. This is the N-terminal AAA domain.
Probab=98.67  E-value=1.6e-06  Score=68.13  Aligned_cols=55  Identities=31%  Similarity=0.640  Sum_probs=46.0

Q ss_pred             HHHHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             7665201168999999999999842444673599860565650279999997708
Q gi|254780270|r  337 LDQDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATG  391 (820)
Q Consensus       337 Ld~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~  391 (820)
                      -+.+-|||+++=++|.+|+---......+-.||.|+||||-||+|++..+-+.|-
T Consensus        49 F~d~~fG~e~~i~~~V~~~k~AA~g~~~~k~IllL~GPvGsGKStl~~~Lk~~lE  103 (361)
T smart00763       49 FDHDFFGMEEAIERFVNYFKSAAQGLEERKQILYLLGPVGGGKSSLVECLKRGLE  103 (361)
T ss_pred             HHHHHCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             1013116489999999999999844671256999988998877999999999999


No 135
>PHA02244 ATPase-like protein
Probab=98.66  E-value=2.9e-07  Score=73.86  Aligned_cols=178  Identities=26%  Similarity=0.357  Sum_probs=106.5

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECHHHHHHH
Q ss_conf             99860565650279999997708824998618888888835632001456712899999832788739999331554231
Q gi|254780270|r  369 LCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSD  448 (820)
Q Consensus       369 l~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~ldeidk~~~~  448 (820)
                      ..|+||.|+||||+|++||+||..+|+.  .|-+.+|-++.|    |+.|----.-..+++|=..-.||||||||--   
T Consensus       122 V~L~G~AGsGKt~~A~qIA~aLdl~FYf--~gAI~~ef~L~G----f~DAnG~yh~T~f~kaFk~GGLfLlDEiDAS---  192 (383)
T PHA02244        122 VFLKGGAGSGKNHIAEQIAEALDLDFYF--MNAIMDEFELKG----FIDANGKFHETPFYEAFKKGGLFFIDEIDAS---  192 (383)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCCEE--CHHHHHHHHCCC----EECCCCCEECCHHHHHHHCCCEEEEEHHCCC---
T ss_conf             6997588886348999999985888244--132301343012----5648996726389999861887997320044---


Q ss_pred             CCCCHHHHHHHHCCCCCCCCEEEEECCCCCCC----CCEEEEEECCCC-----------C-CCHHHCCCEEEEEECCCCH
Q ss_conf             17711556655406001681332010352364----427999934865-----------5-4413117247998258786
Q gi|254780270|r  449 LRGDPSAALLEVLDPAQNSSFVDHYLEVEYDL----SDVMFIMTANTL-----------N-IPLPLMDRMEIIRIAGYTE  512 (820)
Q Consensus       449 ~~gdp~~allevldp~qn~~f~d~y~~~~~dl----s~v~fi~tan~~-----------~-i~~~l~drme~i~~~~y~~  512 (820)
                         +| +||+.+     |...-..|+++|.-.    -+..-|+++|+.           + +..+-+||.-.|+++ |  
T Consensus       193 ---nP-~aL~~l-----NaALAN~fm~FPdG~V~~HedFr~IAagNT~G~Gad~~YVGRnqLD~ATLDRFv~ie~~-Y--  260 (383)
T PHA02244        193 ---IP-EALIII-----NSAIANKFFDFADERVTAHEDFRVISAGNTLGKGADHIYVARNKIDGATLDRFAPIEFD-Y--  260 (383)
T ss_pred             ---CH-HHHHHH-----HHHHHCCCCCCCCCHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHEEECCCC-C--
T ss_conf             ---87-999999-----89986476347642110057638997246567788722114454564646203644568-3--


Q ss_pred             HHHHH--HHH--H---HHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             89998--999--8---60898998625781313228999999973177410234788879999898
Q gi|254780270|r  513 EEKLQ--IAK--N---HLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARK  571 (820)
Q Consensus       513 ~ek~~--i~~--~---~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~  571 (820)
                      +||++  |..  +   |.+...+.++.-+...-.|+--|    |.+|..=-||-.-+=.+..|.-|
T Consensus       261 DEkiE~~~s~g~~dlv~fv~~~r~~~~~~~l~~v~s~ra----i~~~~k~d~v~~~~f~ie~iifk  322 (383)
T PHA02244        261 DEKIEHLISNGDEDLVNFVALLRHEMAEKGLDHVFSMRA----IIHGKKFDGVFEADFLIENIIFK  322 (383)
T ss_pred             CHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCEEEEHHH----HHCCCCCCCCCCHHHHHHHHHHH
T ss_conf             167888850685899999999999877408870454154----53343124424213777767750


No 136
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription]
Probab=98.66  E-value=5.3e-07  Score=71.86  Aligned_cols=189  Identities=32%  Similarity=0.467  Sum_probs=118.4

Q ss_pred             HCCCCCCCEEEEECCCCCCHHHHHHHHHHHHC--CCEEEEECCCCCC------HHH-----------HCCCCCCC-----
Q ss_conf             42444673599860565650279999997708--8249986188888------888-----------35632001-----
Q gi|254780270|r  360 RVIKNKGLILCFVGPPGVGKTSLAQSIAKATG--RQYVRMSLGGVYD------EAD-----------IRGHRRTY-----  415 (820)
Q Consensus       360 ~~~~~~g~il~l~gppgvGKts~~~sia~al~--r~f~~islgg~~d------~~~-----------i~gh~~ty-----  415 (820)
                      ..++..|.-++++||||+|||-||-.||+.||  -||+.||=+-+-.      |+-           ||-.|..|     
T Consensus        59 k~gk~aGrgiLi~GppgTGKTAlA~gIa~eLG~dvPF~~isgsEiYS~E~kKTE~L~qa~RraIGvrikE~reV~EGeV~  138 (450)
T COG1224          59 KQGKMAGRGILIVGPPGTGKTALAMGIARELGEDVPFVAISGSEIYSLEVKKTEALTQALRRAIGVRIKETREVYEGEVV  138 (450)
T ss_pred             HHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCEEECCCEEEEECCCHHHHHHHHHHHHHCEEEEEEEEEEEEEEE
T ss_conf             71766661799978999768899999999858999821501332233100088999999998645486466688877899


Q ss_pred             --------------------------------CCCCCHHHHHHHHHCCCCCE-EEEEEC----HHHHHHHCCCCHHHHHH
Q ss_conf             --------------------------------45671289999983278873-999933----15542311771155665
Q gi|254780270|r  416 --------------------------------IGSMPGRIIQSLKRAKRSNP-LLLLDE----IDKMGSDLRGDPSAALL  458 (820)
Q Consensus       416 --------------------------------~ga~pg~ii~~l~~~~~~np-v~~lde----idk~~~~~~gdp~~all  458 (820)
                                                      .=..+..|.+.|.+.|+.+. ||++|.    +-|+|.+...--....|
T Consensus       139 ~l~i~~~~~p~~~y~~~~~~~~i~LkT~d~~k~~~lg~~i~~ql~~~~V~~GDVI~Id~etG~V~klGrs~~~~~~~~dl  218 (450)
T COG1224         139 ELEIRRARNPLNPYGKVPSGAIITLKTKDEEKTLRLGPEIAEQLVKEGVEEGDVIYIDAETGRVKKLGRSKARAREDFDL  218 (450)
T ss_pred             EEEEEECCCCCCCCCCCCCCEEEEEEECCCCEEEECCHHHHHHHHHHCCCCCCEEEEECCCCEEEEEECCCCCCCCCCCC
T ss_conf             99876235799876655453289999636645762598999999983744587899982566799942242335422334


Q ss_pred             H-------------------------HCCCC---C----------------------C-----------------CCEEE
Q ss_conf             5-------------------------40600---1----------------------6-----------------81332
Q gi|254780270|r  459 E-------------------------VLDPA---Q----------------------N-----------------SSFVD  471 (820)
Q Consensus       459 e-------------------------vldp~---q----------------------n-----------------~~f~d  471 (820)
                      +                         =||-.   +                      |                 --|.|
T Consensus       219 ~~~~~V~~P~Gev~K~KEi~~~vTLHDlDv~nar~~G~~sl~~~~~~eI~~evR~~vn~~V~~~ieeGkAElVpGVLFID  298 (450)
T COG1224         219 EDTRFVPLPEGEVQKRKEIVQTVTLHDLDVANARAQGILSLFSGGTGEITDEVREEVNEKVKKWIEEGKAELVPGVLFID  298 (450)
T ss_pred             CCEEEEECCCCCEEEEEEEEEEEEEHHHHHHHCCCCCHHHHHCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEECCEEEEE
T ss_conf             42179877988525667789998700313432041113756527766578899999999999998549578613428973


Q ss_pred             --EECC----------CCCCCCCEEEEEEC---------CC--CC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHH
Q ss_conf             --0103----------52364427999934---------86--55-4413117247998258786899989998608989
Q gi|254780270|r  472 --HYLE----------VEYDLSDVMFIMTA---------NT--LN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKV  527 (820)
Q Consensus       472 --~y~~----------~~~dls~v~fi~ta---------n~--~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~  527 (820)
                        |-||          +.-||+-++..+|-         |.  .. ||.-|+|||=+|..-+|+.+|-.+|.+.-     
T Consensus       299 EvHmLDIE~FsFlnrAlEse~aPIii~AtNRG~~kiRGTd~~sPhGIP~DlLDRllII~t~py~~~EireIi~iR-----  373 (450)
T COG1224         299 EVHMLDIECFSFLNRALESELAPIIILATNRGMTKIRGTDIESPHGIPLDLLDRLLIISTRPYSREEIREIIRIR-----  373 (450)
T ss_pred             CHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCEEEECCCCCCCCCCCCHHHHHHEEEEECCCCCHHHHHHHHHHH-----
T ss_conf             213455789999998763146757999717750012166776888898766622567744779889999999976-----


Q ss_pred             HHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHH
Q ss_conf             98625781313228999999973177410234
Q gi|254780270|r  528 LTEHALKQEECCISDGVLLDIIRLFTHEAGVR  559 (820)
Q Consensus       528 ~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR  559 (820)
                           .+++++.++++|++++..-- -|...|
T Consensus       374 -----a~ee~i~l~~~Ale~L~~ig-~etSLR  399 (450)
T COG1224         374 -----AKEEDIELSDDALEYLTDIG-EETSLR  399 (450)
T ss_pred             -----HHHHCCCCCHHHHHHHHHHC-HHHHHH
T ss_conf             -----43540304888999997515-034489


No 137
>TIGR00368 TIGR00368 Mg chelatase homolog; InterPro: IPR004482   This family of bacterial proteins are variously described as 'hypothetical protein yifB', 'competence protein', 'hypothetical protein' or 'Mg chelatase-related protein'. These proteins are a subset of the magnesium chelatase, ChlI subunit family and either belong to or show significant homology to the non-peptidase homologs of the MEROPS peptidase family S16 (lon protease family, clan SF), IPR001984 from INTERPRO. .
Probab=98.65  E-value=3e-07  Score=73.75  Aligned_cols=153  Identities=26%  Similarity=0.401  Sum_probs=126.9

Q ss_pred             CCC--CEEEEEEEEEECCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHCCCEEECCCCCCCCCCCCHHH
Q ss_conf             016--807999999974899724432568999999999999999988862998557420781474488884788873068
Q gi|254780270|r  621 EVG--GEILTVEGVIMPGKGEITITGNLKEIMKESILAASSYVRSKATTFGIIPSAFNEINIHVHVPEGATPKDGPSAGI  698 (820)
Q Consensus       621 ~~G--G~~l~IE~~~~~g~g~l~lTG~lg~vmkES~~~A~s~~k~~~~~~~~~~~~~~~~diHih~p~Ga~pKDGPSAGi  698 (820)
                      +.|  |..+.||+-...|...+.+-|.-+...|||    -.=|||-...=+   =.|-..-|-|+.-=-..||.||+==.
T Consensus         6 ~lG~~a~~v~vEvdis~G~pg~~~VGLp~~~vkEs----reRVksAl~Ns~---F~fP~~rI~iNLAPAdl~KeG~~FDL   78 (505)
T TIGR00368         6 SLGVEAPLVTVEVDISKGLPGITIVGLPETTVKES----RERVKSALKNSG---FKFPAKRITINLAPADLPKEGGRFDL   78 (505)
T ss_pred             HHCCCCCEEEEEEEECCCCCCCEEECCCCCCHHHH----HHHHHHHHHHCC---CCCCCCEEEEECCCCCCCCCCCCCCH
T ss_conf             10636403479887307787213433886310566----789999986157---66885401665388887667888633


Q ss_pred             HHHHHHHHHHHCCC--CCCCCEEEEEEEECCEEEEECCHHHHHHHHHHCCCCEEECCHHHHHHHHHCCHHHHCCCEEEEC
Q ss_conf             99999999983688--8756106636850302500065689999999709969980367755077614887709799981
Q gi|254780270|r  699 AMATAIVSIMTCIP--VYKNVAMTGELTLRGRVLPIGGLKEKLLAALRAGVTKVLIPEENIKDLMDIPENVKNGLEIIPV  776 (820)
Q Consensus       699 ~i~tal~S~~~~~~--v~~~iAmTGEitl~G~VlpiGGi~eK~laA~raGi~~viiP~~N~~d~~~ip~~~~~~l~~~~v  776 (820)
                      .|+.+|+-+=...-  --.++-+-||+.|+|..-.|-|+=--+..|+..|++-+|+|++|..+..     +-+|..++.+
T Consensus        79 pIAI~ilaaseq~da~~L~~yl~lGEL~LdG~lR~i~gvlP~~~~A~k~~~~~~iVp~~N~~EaS-----lv~G~~~y~~  153 (505)
T TIGR00368        79 PIAIGILAASEQLDAKKLDEYLFLGELALDGKLRGIKGVLPAIALAQKSGRKFIIVPKENAEEAS-----LVDGLNVYGA  153 (505)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEHHHHHHCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCEE-----EECCCCEEHH
T ss_conf             89999999863330431440110011332475110456899999998658767762166755202-----6638740204


Q ss_pred             CCHHHHHHH
Q ss_conf             939998887
Q gi|254780270|r  777 SFMGEVLKH  785 (820)
Q Consensus       777 ~~~~evl~~  785 (820)
                      +|+.||.++
T Consensus       154 ~~L~~vv~f  162 (505)
T TIGR00368       154 DHLKEVVKF  162 (505)
T ss_pred             HHHHHHHHH
T ss_conf             748999999


No 138
>TIGR02881 spore_V_K stage V sporulation protein K; InterPro: IPR014232   Proteins in this entry include the stage V sporulation protein K (SpoVK), a close homologue of the Rubisco expression protein CbbX (IPR000470 from INTERPRO), and are members of an ATPase family associated with various cellular activities. These proteins are strictly limited to bacterial endospore-forming species, but are not found universally among members of this group; they are missing from the Clostridium species..
Probab=98.65  E-value=1.6e-06  Score=68.15  Aligned_cols=200  Identities=27%  Similarity=0.403  Sum_probs=128.9

Q ss_pred             HHCHHHHHHHHHHHHHHHHHC---------CCCCCCEEEEECCCCCCHHHHHHHHHHHHC----------CCEEEEECCC
Q ss_conf             201168999999999999842---------444673599860565650279999997708----------8249986188
Q gi|254780270|r  341 HFGLEKVKERIIEYLAVQMRV---------IKNKGLILCFVGPPGVGKTSLAQSIAKATG----------RQYVRMSLGG  401 (820)
Q Consensus       341 hyGl~~vK~rile~lav~~~~---------~~~~g~il~l~gppgvGKts~~~sia~al~----------r~f~~islgg  401 (820)
                      -=||++||+-|-|.-|.-..+         .+...=...|-|=||||||+.|+-||+-+.          ....|     
T Consensus         8 ~vGL~~vK~~i~EiYA~i~i~~kR~~~GLk~~~~~LHMiFKGNPGTGKTTVAR~~gklf~emnvL~KGH~iE~ER-----   82 (261)
T TIGR02881         8 LVGLDEVKELIKEIYAWIQINEKRKEEGLKTSKQVLHMIFKGNPGTGKTTVARLLGKLFKEMNVLSKGHLIEVER-----   82 (261)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEE-----
T ss_conf             048889999999999999998888751011488447877427866843899999999985337567886788762-----


Q ss_pred             CCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECHHHHHH----HCCCCHHHHHHHHCCCCCCCCEEEEECCCC
Q ss_conf             8888883563200145671289999983278873999933155423----117711556655406001681332010352
Q gi|254780270|r  402 VYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGS----DLRGDPSAALLEVLDPAQNSSFVDHYLEVE  477 (820)
Q Consensus       402 ~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~ldeidk~~~----~~~gdp~~allevldp~qn~~f~d~y~~~~  477 (820)
                          |++-|   =|||-+--|.=..+++|-  -.|.++||===++.    ||-=..-..|----- +|.++|        
T Consensus        83 ----ADLVG---EYIGHTAqkTRe~~kkA~--GGvLFiDEAYSLaRGGEKDFGKEAIDtLVK~mE-d~~~~l--------  144 (261)
T TIGR02881        83 ----ADLVG---EYIGHTAQKTREVIKKAL--GGVLFIDEAYSLARGGEKDFGKEAIDTLVKAME-DQRNEL--------  144 (261)
T ss_pred             ----CCCCC---CCCCCHHHHHHHHHHHHC--CCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHH-HCCCCE--------
T ss_conf             ----22122---320300489999999863--880055777776148888766208889999876-156986--------


Q ss_pred             CCCCCEEEEEECCC-----CCCCHHHCCCEE-EEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHH---
Q ss_conf             36442799993486-----554413117247-998258786899989998608989986257813132289999999---
Q gi|254780270|r  478 YDLSDVMFIMTANT-----LNIPLPLMDRME-IIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDI---  548 (820)
Q Consensus       478 ~dls~v~fi~tan~-----~~i~~~l~drme-~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~i---  548 (820)
                           |+.+|=+.+     |+..|=|..|+- .|+.|.||.+|=++||++.+=-+          +-.||.+|-.++   
T Consensus       145 -----vlILAGY~~EM~yFL~~NPGL~SRFPi~i~FPdY~~eeL~~Ia~~m~~~R----------eY~Lt~~A~~~lr~~  209 (261)
T TIGR02881       145 -----VLILAGYSDEMDYFLSLNPGLRSRFPISIDFPDYTVEELMEIAERMVKER----------EYKLTEEAKWKLREH  209 (261)
T ss_pred             -----EEEEECCHHHHHHHHHCCCCCCCCCCCEEECCCCCHHHHHHHHHHHHHHH----------HHCCCHHHHHHHHHH
T ss_conf             -----89970876899998620779777665054188998889999999998646----------422578899999999


Q ss_pred             HHCCC----CCC----HHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             73177----410----2347888799998987654211785
Q gi|254780270|r  549 IRLFT----HEA----GVRSFERALMKIARKAVTKIVKNSD  581 (820)
Q Consensus       549 i~~Yt----~Ea----GvR~l~r~i~~i~r~~~~~~~~~~~  581 (820)
                      +..-.    ++.    =|||+   |++-+|+-|+.++...+
T Consensus       210 l~~~~~~~~~~~sNaR~vRN~---iE~AIR~QAvRlL~~~~  247 (261)
T TIGR02881       210 LAKVDQLSSREFSNARYVRNI---IEKAIRRQAVRLLKKSD  247 (261)
T ss_pred             HHHHHHHHHCCCCCCCHHHHH---HHHHHHHHHHHHHCCCC
T ss_conf             741244421005762012428---89999999987643464


No 139
>KOG2170 consensus
Probab=98.65  E-value=7.7e-08  Score=78.20  Aligned_cols=159  Identities=26%  Similarity=0.424  Sum_probs=108.0

Q ss_pred             CCCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCCC-CCCCEEEEECCCCCCHHHHHHHHHHHHCC-----CEEEEE
Q ss_conf             322106889987766520116899999999999984244-46735998605656502799999977088-----249986
Q gi|254780270|r  325 KTKKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRVIK-NKGLILCFVGPPGVGKTSLAQSIAKATGR-----QYVRMS  398 (820)
Q Consensus       325 ~~~~dl~~a~~iLd~~hyGl~~vK~rile~lav~~~~~~-~~g~il~l~gppgvGKts~~~sia~al~r-----~f~~is  398 (820)
                      ....|+..-++-|+...||-.=||++|+--+--..-++. .|+-.|.|.|+|||||.-.++-||+.+-|     +||..=
T Consensus        68 ~~~~~~~~Le~dL~~~lfGQHla~~~Vv~alk~~~~n~~p~KPLvLSfHG~tGTGKN~Va~iiA~n~~~~Gl~S~~V~~f  147 (344)
T KOG2170          68 DIRNDLDGLEKDLARALFGQHLAKQLVVNALKSHWANPNPRKPLVLSFHGWTGTGKNYVAEIIAENLYRGGLRSPFVHHF  147 (344)
T ss_pred             CCCCCCHHHHHHHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHH
T ss_conf             66656067899999986320879999999999986289999875898308998756489999999987511256268876


Q ss_pred             CCCCC--CHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCC
Q ss_conf             18888--8888356320014567128999998327887399993315542311771155665540600168133201035
Q gi|254780270|r  399 LGGVY--DEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEV  476 (820)
Q Consensus       399 lgg~~--d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~  476 (820)
                      ++-.+  +++.|.    -|---+--+|.+...  .|.+++|++||.|||-+        -|+++|-|     |-|.|=.+
T Consensus       148 vat~hFP~~~~ie----~Yk~eL~~~v~~~v~--~C~rslFIFDE~DKmp~--------gLld~lkp-----fLdyyp~v  208 (344)
T KOG2170         148 VATLHFPHASKIE----DYKEELKNRVRGTVQ--ACQRSLFIFDEVDKLPP--------GLLDVLKP-----FLDYYPQV  208 (344)
T ss_pred             HHHCCCCCHHHHH----HHHHHHHHHHHHHHH--HCCCCEEEECHHHHCCH--------HHHHHHHH-----HHCCCCCC
T ss_conf             5541599767899----999999999999998--55775487310543587--------69998766-----63046321


Q ss_pred             C-CCCCCEEEEEECCCC-C-CCHHHCCCE
Q ss_conf             2-364427999934865-5-441311724
Q gi|254780270|r  477 E-YDLSDVMFIMTANTL-N-IPLPLMDRM  502 (820)
Q Consensus       477 ~-~dls~v~fi~tan~~-~-i~~~l~drm  502 (820)
                      . .|.-+.+||+-.|-- + |....++-+
T Consensus       209 ~gv~frkaIFIfLSN~gg~eI~~~aL~~~  237 (344)
T KOG2170         209 SGVDFRKAIFIFLSNAGGSEIARIALENA  237 (344)
T ss_pred             CCCCCCCEEEEEECCCCCHHHHHHHHHHH
T ss_conf             35545514899971786147799999999


No 140
>PRK07399 DNA polymerase III subunit delta'; Validated
Probab=98.62  E-value=1.8e-06  Score=67.79  Aligned_cols=161  Identities=20%  Similarity=0.256  Sum_probs=100.3

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCC-------EEEEECCCCC--------
Q ss_conf             6520116899999999999984244467359986056565027999999770882-------4998618888--------
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQ-------YVRMSLGGVY--------  403 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~-------f~~islgg~~--------  403 (820)
                      ++..|.+.+++.+...+     ..+.-++.++|+||.|+||+++|...|++|--.       ..|+.-|.--        
T Consensus         4 ~~iiGq~~~~~~L~~ai-----~~~rl~hAyLF~Gp~G~GK~~~A~~fa~~Ll~~~~~~~~~~~ri~~~nHPDl~~i~P~   78 (314)
T PRK07399          4 ANLIGQPLAIELLTAAI-----EQNRIAPAYLFAGPEGVGRKLAALRFIEGLLSQGSPSKNIRRRLEEGNHPDLLWVEPT   78 (314)
T ss_pred             CCCCCCHHHHHHHHHHH-----HCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHCCCCCCEEEEECC
T ss_conf             31259499999999999-----8599674487789998329999999999985789999766558751899977886056


Q ss_pred             ----------CHHHHCCCCCCCCCCCCHHHHHHHHH------CCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCC
Q ss_conf             ----------88883563200145671289999983------27887399993315542311771155665540600168
Q gi|254780270|r  404 ----------DEADIRGHRRTYIGSMPGRIIQSLKR------AKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNS  467 (820)
Q Consensus       404 ----------d~~~i~gh~~ty~ga~pg~ii~~l~~------~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~  467 (820)
                                ++++-.|-.+.......=-=|+.+++      .....-|+++|+.|+|+..    -++|||-.|.     
T Consensus        79 ~~~~g~~~~~~~~~~~~~~~~~~~~I~idqIR~l~~~l~~~p~~~~~kVvII~~ae~m~~~----AaNaLLKtLE-----  149 (314)
T PRK07399         79 YQHQGKLITASEAEEAGLKRKSPPQIRLEQIREIKRFLSRPPLEAPRKVVVIEDAETMNEA----AANALLKTLE-----  149 (314)
T ss_pred             CCCCCCCCCHHHHHHHHHHCCCCCCCCHHHHHHHHHHHCCCCCCCCCEEEEECCHHHCCHH----HHHHHHHHHC-----
T ss_conf             2003454557789876530268777879999999999731885688479998897871999----9999998614-----


Q ss_pred             CEEEEECCCCCCCCCEEEEEECCCCC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHH
Q ss_conf             13320103523644279999348655-4413117247998258786899989998608
Q gi|254780270|r  468 SFVDHYLEVEYDLSDVMFIMTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLV  524 (820)
Q Consensus       468 ~f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~  524 (820)
                              -|   ++.+||..+++.+ +.+.++.|--.|.+...+.++-.++-+++..
T Consensus       150 --------EP---~~~~fILit~~~~~lLpTI~SRCQ~i~F~~l~~~~i~~~L~~~~~  196 (314)
T PRK07399        150 --------EP---GNGTLILIAPSPESLLPTIVSRCQIIPFYRLSDEQLEQVLKRLGD  196 (314)
T ss_pred             --------CC---CCCEEEEEECCHHHCCHHHHCCCEEEECCCCCHHHHHHHHHHCCC
T ss_conf             --------78---785699997993649146641875633899899999999997166


No 141
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]
Probab=98.62  E-value=3.3e-06  Score=65.84  Aligned_cols=184  Identities=24%  Similarity=0.430  Sum_probs=126.4

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHCC---CEEEEECCCCCC---HHHHCCCCC-CCCCCC---CHHHHHHHHHCCC
Q ss_conf             446735998605656502799999977088---249986188888---888356320-014567---1289999983278
Q gi|254780270|r  363 KNKGLILCFVGPPGVGKTSLAQSIAKATGR---QYVRMSLGGVYD---EADIRGHRR-TYIGSM---PGRIIQSLKRAKR  432 (820)
Q Consensus       363 ~~~g~il~l~gppgvGKts~~~sia~al~r---~f~~islgg~~d---~~~i~gh~~-ty~ga~---pg~ii~~l~~~~~  432 (820)
                      .+..++| +.|.-||||..+|+.|.+.=.|   ||+.+++|.+..   |||+=||-+ -+-||.   .|++-++      
T Consensus       162 ~s~a~VL-I~GESGtGKElvAr~IH~~S~R~~~PFVavNcaAip~~l~ESELFGhekGAFTGA~~~r~G~fE~A------  234 (464)
T COG2204         162 PSDASVL-ITGESGTGKELVARAIHQASPRAKGPFIAVNCAAIPENLLESELFGHEKGAFTGAITRRIGRFEQA------  234 (464)
T ss_pred             CCCCCEE-EECCCCCCHHHHHHHHHHHCCCCCCCCEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCEEEC------
T ss_conf             7799789-977898758999999986074458992563346489888777761456567677643457615773------


Q ss_pred             CCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEE--CCCCCCCCCEEEEEECC-CC-C-CC-----HHHCCCE
Q ss_conf             87399993315542311771155665540600168133201--03523644279999348-65-5-44-----1311724
Q gi|254780270|r  433 SNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHY--LEVEYDLSDVMFIMTAN-TL-N-IP-----LPLMDRM  502 (820)
Q Consensus       433 ~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y--~~~~~dls~v~fi~tan-~~-~-i~-----~~l~drm  502 (820)
                      ....++||||-.|.-+.+    .-||-||-   ...|.--=  =.+++   +|=+||+.| ++ + |.     .-|.-|+
T Consensus       235 ~GGTLfLDEI~~mpl~~Q----~kLLRvLq---e~~~~rvG~~~~i~v---dvRiIaaT~~dL~~~v~~G~FReDLyyRL  304 (464)
T COG2204         235 NGGTLFLDEIGEMPLELQ----VKLLRVLQ---EREFERVGGNKPIKV---DVRIIAATNRDLEEEVAAGRFREDLYYRL  304 (464)
T ss_pred             CCCEEEEECCCCCCHHHH----HHHHHHHH---CCEEEECCCCCEECE---EEEEEEECCCCHHHHHHCCCCHHHHHHHH
T ss_conf             796587323110999999----99999987---070673588860000---16999605778999988197378888652


Q ss_pred             EEEEE--CCCCH-HHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             79982--58786-899989998608989986257813132289999999731774102347888799
Q gi|254780270|r  503 EIIRI--AGYTE-EEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALM  566 (820)
Q Consensus       503 e~i~~--~~y~~-~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~  566 (820)
                      -|+.+  |+.-. .|-+-.--+|++.+..+++|.  ....|+.+++.. ...|.+-.-||+|+-.+.
T Consensus       305 nV~~i~iPpLRER~EDIp~L~~hfl~~~~~~~~~--~~~~~s~~a~~~-L~~y~WPGNVREL~N~ve  368 (464)
T COG2204         305 NVVPLRLPPLRERKEDIPLLAEHFLKRFAAELGR--PPKGFSPEALAA-LLAYDWPGNVRELENVVE  368 (464)
T ss_pred             CCCEECCCCCCCCCHHHHHHHHHHHHHHHHHHCC--CCCCCCHHHHHH-HHHCCCCHHHHHHHHHHH
T ss_conf             3311048762236200799999999999998099--988879999999-973899818999999999


No 142
>PRK07132 DNA polymerase III subunit delta'; Validated
Probab=98.60  E-value=8.2e-07  Score=70.42  Aligned_cols=145  Identities=11%  Similarity=0.163  Sum_probs=89.9

Q ss_pred             HHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEE-EEECCCCC-CHHHHCCCCCCCCCCCCHHHHHH
Q ss_conf             99999999998424446735998605656502799999977088249-98618888-88883563200145671289999
Q gi|254780270|r  349 ERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYV-RMSLGGVY-DEADIRGHRRTYIGSMPGRIIQS  426 (820)
Q Consensus       349 ~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~-~islgg~~-d~~~i~gh~~ty~ga~pg~ii~~  426 (820)
                      |.|+.+| ......+.-+...+|.||+|+|||+.|+.+|+++.-.-. ..+.+... |...+..-.-   .+---.++..
T Consensus         4 e~iv~~L-~nai~~~klsHAYLF~G~~G~Gk~~~a~~~a~~l~~~~~~~~~~~~~~~~~~~id~~~~---~i~~~~i~~~   79 (303)
T PRK07132          4 NNIIKSL-DNLAKQNKISHSFLLKSNYNNDLDESILYFLNKFNNLQSLNLNLEELPYNIFLFDIFDE---DLSKEEFLSA   79 (303)
T ss_pred             HHHHHHH-HHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCC---CHHHHHHHHH
T ss_conf             3899999-99998499761688678998679999999999972998788875456532304133222---0016889999


Q ss_pred             HHHC---C---CCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHHHC
Q ss_conf             9832---7---88739999331554231177115566554060016813320103523644279999348655-441311
Q gi|254780270|r  427 LKRA---K---RSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLPLM  499 (820)
Q Consensus       427 l~~~---~---~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~  499 (820)
                      ++..   .   ...-|+++||+|+|+..    .++|||-.|.             -|-  ++|+||..+++.+ ||+..+
T Consensus        80 i~~~~~~~~~~~~~Kv~IIdea~~lt~~----A~NaLLKtLE-------------EPp--~~~~fil~t~~~~~il~TI~  140 (303)
T PRK07132         80 IEKFSFSSFVSNQKKILIIKNIEKTSNS----SLNALLKTIE-------------EPS--KNTYFLLTTKNINKVIPTIV  140 (303)
T ss_pred             HHHHHHCCCCCCCEEEEEEECHHHCCHH----HHHHHHHHCC-------------CCC--CCEEEEEEECCHHHCCHHHH
T ss_conf             9999736655687069998165533999----9999998703-------------898--68489997288243837786


Q ss_pred             CCEEEEEECCCCHHHHH
Q ss_conf             72479982587868999
Q gi|254780270|r  500 DRMEIIRIAGYTEEEKL  516 (820)
Q Consensus       500 drme~i~~~~y~~~ek~  516 (820)
                      .|--++.+.....++=.
T Consensus       141 SRCq~~~f~~~~~~~i~  157 (303)
T PRK07132        141 SRCQVINVKEPDQQKIL  157 (303)
T ss_pred             HCCEEEECCCCCHHHHH
T ss_conf             36656637889999999


No 143
>PRK08770 DNA polymerase III subunits gamma and tau; Validated
Probab=98.60  E-value=8e-07  Score=70.49  Aligned_cols=197  Identities=18%  Similarity=0.265  Sum_probs=129.1

Q ss_pred             HCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCC-------------EEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHH
Q ss_conf             4244467359986056565027999999770882-------------499861888888883563200145671289999
Q gi|254780270|r  360 RVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQ-------------YVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQS  426 (820)
Q Consensus       360 ~~~~~~g~il~l~gppgvGKts~~~sia~al~r~-------------f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~  426 (820)
                      +..+.-....+|.|+-||||||+||-+||+||-.             +..|.-|---|--||.+-+||-|..|-- ++..
T Consensus        32 ~~~~~~~~a~lf~g~rg~gkt~~ar~~a~~lnc~~~~~~~pc~~c~~c~~i~~~~~~d~~e~daas~~~v~~~r~-~~~~  110 (663)
T PRK08770         32 LDSGRVHHAFLFTGTRGVGKTTIARIFAKSLNCETGTSADPCGQCPACLDIDAGRYIDLLEIDAASNTGVDDVRE-VIEN  110 (663)
T ss_pred             HHCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEECCCCCCHHHHHH-HHHH
T ss_conf             970997404762279988888999999998678999999978778778988548988658864676588899999-9984


Q ss_pred             HHH--CCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHHHCCCEE
Q ss_conf             983--2788739999331554231177115566554060016813320103523644279999348655-4413117247
Q gi|254780270|r  427 LKR--AKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLPLMDRME  503 (820)
Q Consensus       427 l~~--~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~drme  503 (820)
                      ..-  +...--|+++||+.-+|.+.    .+|||..|.             -|=  ..|.||+---+.+ ||...+.|--
T Consensus       111 ~~~~p~~~~~kvy~idevhmls~~~----fna~lktle-------------epp--~~v~f~~att~~~k~p~t~~src~  171 (663)
T PRK08770        111 AQYMPSRGKFKVYLIDEVHMLSKAA----FNALLKTLE-------------EPP--EHVKFLLATTDPQKLPVTVLSRCL  171 (663)
T ss_pred             CCCCCCCCCEEEEEEECHHHCCHHH----HHHHHHHHC-------------CCC--CCEEEEEECCCHHHCCHHHHHHHH
T ss_conf             4358877743699970043328999----999987402-------------786--442899854873337489998887


Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCE
Q ss_conf             99825878689998999860898998625781313228999999973177410234788879999898765421178520
Q gi|254780270|r  504 IIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDTT  583 (820)
Q Consensus       504 ~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~~~~~  583 (820)
                      -..+..-+.++-..         .++. =+..+.+.++++++..|-+.  -+.++|+--..+...+.     +  +   .
T Consensus       172 ~f~~~~~~~~~~~~---------~l~~-~~~~e~~~~~~~~~~~~~~~--~~gs~rd~lsl~~q~~~-----~--~---~  229 (663)
T PRK08770        172 QFNLKRLDEDQIQG---------QMTR-ILAAEQIESDPSAIVQLSKA--ADGSLRDGLSLLDQAIA-----Y--A---G  229 (663)
T ss_pred             HCCCCCCCHHHHHH---------HHHH-HHHHCCCCCCHHHHHHHHHH--CCCCHHHHHHHHHHHHH-----H--C---C
T ss_conf             63437799999999---------9999-99983997699999999997--47856778889999998-----6--6---8


Q ss_pred             ECCCHHHHHHHHCCC
Q ss_conf             127967867530520
Q gi|254780270|r  584 VSINENNLQDYLGVP  598 (820)
Q Consensus       584 ~~i~~~~l~~~lg~~  598 (820)
                      -.|+.+++.+.||.-
T Consensus       230 ~~~~~~~v~~mlg~~  244 (663)
T PRK08770        230 GALREDVVRTMLGTV  244 (663)
T ss_pred             CCCCHHHHHHHHCCC
T ss_conf             976899999984888


No 144
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair]
Probab=98.59  E-value=2.2e-07  Score=74.78  Aligned_cols=197  Identities=24%  Similarity=0.362  Sum_probs=111.5

Q ss_pred             HHHHHHCHHHHHHHHHHHH--HHHHHCCC---CCCCE-EEEECCCCCCHHHHHHHHHHHHCCCEEEE----ECCC-----
Q ss_conf             7665201168999999999--99984244---46735-99860565650279999997708824998----6188-----
Q gi|254780270|r  337 LDQDHFGLEKVKERIIEYL--AVQMRVIK---NKGLI-LCFVGPPGVGKTSLAQSIAKATGRQYVRM----SLGG-----  401 (820)
Q Consensus       337 Ld~~hyGl~~vK~rile~l--av~~~~~~---~~g~i-l~l~gppgvGKts~~~sia~al~r~f~~i----slgg-----  401 (820)
                      +=-..||++.||+-|+=.|  .|.+..++   .+|-| +||+|-|||||+.+-|.+++.+-|--+.-    |-.|     
T Consensus       284 iaPsIyG~e~VKkAilLqLfgGv~k~~~~g~~iRGDInILLvGDPgtaKSqlLk~v~~~aPr~vytsgkgss~~GLTAav  363 (682)
T COG1241         284 IAPSIYGHEDVKKAILLQLFGGVKKNLPDGTRIRGDIHILLVGDPGTAKSQLLKYVAKLAPRGVYTSGKGSSAAGLTAAV  363 (682)
T ss_pred             HCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCEEEE
T ss_conf             41510381999999999960897664799862024226998179825199999998864884079726412545730699


Q ss_pred             CCCHHHHCCCCCC-CCCCCCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCC
Q ss_conf             8888883563200-145671289999983278873999933155423117711556655406001681332010352364
Q gi|254780270|r  402 VYDEADIRGHRRT-YIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDL  480 (820)
Q Consensus       402 ~~d~~~i~gh~~t-y~ga~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dl  480 (820)
                      ++|+-  .| .+| =-||+          +-.-|.|-.+||.|||...-+    +|+.|+..  |+. -+=.=-+|-.-|
T Consensus       364 ~rd~~--tg-e~~LeaGAL----------VlAD~Gv~cIDEfdKm~~~dr----~aihEaME--QQt-IsIaKAGI~atL  423 (682)
T COG1241         364 VRDKV--TG-EWVLEAGAL----------VLADGGVCCIDEFDKMNEEDR----VAIHEAME--QQT-ISIAKAGITATL  423 (682)
T ss_pred             EECCC--CC-EEEEECCEE----------EEECCCEEEEEECCCCCHHHH----HHHHHHHH--HCE-EEECCCCEEEEC
T ss_conf             97067--76-078867779----------992497799970567776789----99999987--527-512055425411


Q ss_pred             -CCEEEEEECCC--------------CCCCHHHCCCEEEEEECCCCHHHH--HHHH----HHHHH---------------
Q ss_conf             -42799993486--------------554413117247998258786899--9899----98608---------------
Q gi|254780270|r  481 -SDVMFIMTANT--------------LNIPLPLMDRMEIIRIAGYTEEEK--LQIA----KNHLV---------------  524 (820)
Q Consensus       481 -s~v~fi~tan~--------------~~i~~~l~drme~i~~~~y~~~ek--~~i~----~~~l~---------------  524 (820)
                       +++=++|.||-              +++|+||+.|..+|.+-.=..+++  ..||    ..|.-               
T Consensus       424 nARcsvLAAaNP~~Gryd~~~~~~enI~l~~~lLSRFDLifvl~D~~d~~~D~~ia~hil~~h~~~~~~~~~~~~~~~~~  503 (682)
T COG1241         424 NARCSVLAAANPKFGRYDPKKTVAENINLPAPLLSRFDLIFVLKDDPDEEKDEEIAEHILDKHRGEEPEETISLDGVDEV  503 (682)
T ss_pred             CHHHHHHHHHCCCCCCCCCCCCHHHHCCCCHHHHHHCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             14444566518877767999997885589835775177547705788853359999999998634565322333322222


Q ss_pred             ----HHHHHHHCC-CC--CCCCCCHHHHHHHHHCCC
Q ss_conf             ----989986257-81--313228999999973177
Q gi|254780270|r  525 ----KKVLTEHAL-KQ--EECCISDGVLLDIIRLFT  553 (820)
Q Consensus       525 ----p~~~~~~~~-~~--~~~~~~~~~i~~ii~~Yt  553 (820)
                          +..+.++.. ..  -.-.++++|.+.|.+.|.
T Consensus       504 ~~~~~~~lrkYI~YAR~~v~P~lt~ea~e~l~~~Yv  539 (682)
T COG1241         504 EERDFELLRKYISYARKNVTPVLTEEAREELEDYYV  539 (682)
T ss_pred             CCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHH
T ss_conf             346589999999987505896128999999999998


No 145
>pfam00158 Sigma54_activat Sigma-54 interaction domain.
Probab=98.58  E-value=3.3e-07  Score=73.37  Aligned_cols=130  Identities=25%  Similarity=0.409  Sum_probs=88.8

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHH---CCCEEEEECCCCCCH---HHHCCCCC-CCCCC---CCHHHHHHHHHCCC
Q ss_conf             4467359986056565027999999770---882499861888888---88356320-01456---71289999983278
Q gi|254780270|r  363 KNKGLILCFVGPPGVGKTSLAQSIAKAT---GRQYVRMSLGGVYDE---ADIRGHRR-TYIGS---MPGRIIQSLKRAKR  432 (820)
Q Consensus       363 ~~~g~il~l~gppgvGKts~~~sia~al---~r~f~~islgg~~d~---~~i~gh~~-ty~ga---~pg~ii~~l~~~~~  432 (820)
                      ....||| +.|++||||+.+|+.|...-   +.||+.+.++++.++   +++-||.+ .|.||   .+|.+-      ..
T Consensus        20 ~~~~pVL-I~GE~GtGK~~lAr~IH~~S~r~~~pfi~vnc~~~~~~~le~~LFG~~~g~f~ga~~~~~G~le------~A   92 (168)
T pfam00158        20 PTDATVL-ITGESGTGKELFARAIHQLSPRADGPFVAVNCAAIPEELLESELFGHEKGAFTGAVSDRKGLFE------LA   92 (168)
T ss_pred             CCCCCEE-EECCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCEE------EC
T ss_conf             8899889-9899988889999999985243568831256789987799998758766766898757899642------26


Q ss_pred             CCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCC-CC-------CCHHHCCCEEE
Q ss_conf             87399993315542311771155665540600168133201035236442799993486-55-------44131172479
Q gi|254780270|r  433 SNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANT-LN-------IPLPLMDRMEI  504 (820)
Q Consensus       433 ~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~-~~-------i~~~l~drme~  504 (820)
                      .+..++|||||.++.+.+.    .||.+|+   +..|.-.==.-+++ ++|-+|||.+. +.       .-+-|..|+-|
T Consensus        93 ~gGTL~LdeI~~L~~~~Q~----~Ll~~L~---~~~~~~~g~~~~~~-~~vRiIast~~~L~~~v~~G~Fr~DLyyrLnv  164 (168)
T pfam00158        93 DGGTLFLDEIGELPLELQA----KLLRVLQ---EGEFERVGGTKPIK-VDVRIIAATNRDLEEAVAEGRFREDLYYRLNV  164 (168)
T ss_pred             CCCEEECCCHHHCCHHHHH----HHHHHHH---CCEEEECCCCCEEE-EEEEEEEECCCCHHHHHHCCCCHHHHHHHHCE
T ss_conf             9987880244139999999----9999985---79699779984588-85499996598899998839963998888652


Q ss_pred             EEE
Q ss_conf             982
Q gi|254780270|r  505 IRI  507 (820)
Q Consensus       505 i~~  507 (820)
                      +.+
T Consensus       165 ~~i  167 (168)
T pfam00158       165 VPI  167 (168)
T ss_pred             EEC
T ss_conf             326


No 146
>smart00382 AAA ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.
Probab=98.58  E-value=2.2e-07  Score=74.66  Aligned_cols=127  Identities=25%  Similarity=0.311  Sum_probs=74.3

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHCCC---EEEEECCCCCCHHHHC----CCCCCCCCCCCHHHHH-HHHHCCCCC-E
Q ss_conf             67359986056565027999999770882---4998618888888835----6320014567128999-998327887-3
Q gi|254780270|r  365 KGLILCFVGPPGVGKTSLAQSIAKATGRQ---YVRMSLGGVYDEADIR----GHRRTYIGSMPGRIIQ-SLKRAKRSN-P  435 (820)
Q Consensus       365 ~g~il~l~gppgvGKts~~~sia~al~r~---f~~islgg~~d~~~i~----gh~~ty~ga~pg~ii~-~l~~~~~~n-p  435 (820)
                      ++..+.++||||+|||++++.+|..++..   ++.++.....+.....    .....+...+..+.+. .+..+.... -
T Consensus         1 ~~~~ill~G~~GsGKTtl~~~la~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (148)
T smart00382        1 PGEVILIVGPPGSGKTTLARALARELGPPGGGVIYIDGEDILEEVLDQLLLIIVGGKKASGSGELRLRLALALARKLKPD   80 (148)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHCCCCCCEEEEEHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             99789999999702999999999872668996899875998988898765300011221051999999999999844998


Q ss_pred             EEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCC--CCCCHHHCCCE
Q ss_conf             99993315542311771155665540600168133201035236442799993486--55441311724
Q gi|254780270|r  436 LLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANT--LNIPLPLMDRM  502 (820)
Q Consensus       436 v~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~--~~i~~~l~drm  502 (820)
                      |+++||++.+.....    +.++.....       .+............+||++|.  ..++..++.|.
T Consensus        81 viiiDei~~~~~~~~----~~~~~~~~~-------~~~~~~~~~~~~~~vi~~~n~~~~~~~~~~~~~~  138 (148)
T smart00382       81 VLILDEITSLLDAEQ----EALLLLLEE-------LRLLLLLKSEKNLTVILTTNDEKDLGPALLRRRF  138 (148)
T ss_pred             EEEEECCHHHCCCCC----HHHHHHHHH-------HHHHCCCCCCCCEEEEEEECCCCCCCHHHHCCCC
T ss_conf             999827502147620----799999999-------9985176578998999956995224987707447


No 147
>PRK08058 DNA polymerase III subunit delta'; Validated
Probab=98.57  E-value=2.9e-07  Score=73.79  Aligned_cols=133  Identities=20%  Similarity=0.279  Sum_probs=86.5

Q ss_pred             HHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEE--EEECCCCCCHHHHCCCCCCCCCCCC--------H---HH--
Q ss_conf             8424446735998605656502799999977088249--9861888888883563200145671--------2---89--
Q gi|254780270|r  359 MRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYV--RMSLGGVYDEADIRGHRRTYIGSMP--------G---RI--  423 (820)
Q Consensus       359 ~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~--~islgg~~d~~~i~gh~~ty~ga~p--------g---~i--  423 (820)
                      .+..+.-+.-+.|+||+|+||+++|+.+|++|.=.--  --+.|-...      +++..-|.-|        |   +|  
T Consensus        21 ~i~~~rl~HA~Lf~Gp~G~GK~~~A~~~A~~LlC~~~~~~~~Cg~C~~------C~~~~~~~HPD~~~i~p~~~~i~idq   94 (329)
T PRK08058         21 SIAKNRLAHAYLFEGAKGTGKKATALWLAKSLFCLERNGVEPCGTCTN------CKRIESGNHPDVHLVAPDGQSIKKDQ   94 (329)
T ss_pred             HHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHH------HHHHHCCCCCCEEEECCCCCCCCHHH
T ss_conf             998599661565578999889999999999973999999998878889------99987699997677456614077999


Q ss_pred             HHHHHHC------CCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCC-CCH
Q ss_conf             9999832------788739999331554231177115566554060016813320103523644279999348655-441
Q gi|254780270|r  424 IQSLKRA------KRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPL  496 (820)
Q Consensus       424 i~~l~~~------~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~  496 (820)
                      |+.|++.      ....=|+++|+.|+|+..    -++|||-.|-             -|=  .+++||.++++.+ +++
T Consensus        95 iR~L~~~~~~~p~~g~~KV~II~~Ae~m~~~----AaNALLKtLE-------------EPp--~~t~fIL~t~~~~~lLp  155 (329)
T PRK08058         95 IRYLKEEFSKSGVESNKKVYIIEHADKMTAS----AANSLLKFLE-------------EPS--GDTTAILLTENKHQILP  155 (329)
T ss_pred             HHHHHHHHCCCCCCCCCEEEEEECHHHHCHH----HHHHHHHHHH-------------CCC--CCCEEEEEECCHHHHHH
T ss_conf             9999999643875788679997347762999----9999999864-------------689--78679987299666436


Q ss_pred             HHCCCEEEEEECCCCHHHHH
Q ss_conf             31172479982587868999
Q gi|254780270|r  497 PLMDRMEIIRIAGYTEEEKL  516 (820)
Q Consensus       497 ~l~drme~i~~~~y~~~ek~  516 (820)
                      ..+.|--.+.++..+.++=.
T Consensus       156 TI~SRCq~i~f~~~~~~~i~  175 (329)
T PRK08058        156 TILSRCQVVEFRPLPPESLI  175 (329)
T ss_pred             HHHHCCEEEECCCCCHHHHH
T ss_conf             88631425658899999999


No 148
>KOG0652 consensus
Probab=98.56  E-value=6.6e-07  Score=71.13  Aligned_cols=161  Identities=29%  Similarity=0.446  Sum_probs=105.8

Q ss_pred             HHHCHHHHHHHHHHHHHHHHHCCC-------C-CCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCC
Q ss_conf             520116899999999999984244-------4-67359986056565027999999770882499861888888883563
Q gi|254780270|r  340 DHFGLEKVKERIIEYLAVQMRVIK-------N-KGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGH  411 (820)
Q Consensus       340 ~hyGl~~vK~rile~lav~~~~~~-------~-~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh  411 (820)
                      |.-||++--+-.+|-+ |.-++..       . ...-.+++||||+|||-+|+..|...+--|.  -|.|-.=.      
T Consensus       172 DiGGldkQIqELvEAi-VLpmth~ekF~~lgi~pPKGvLmYGPPGTGKTlmARAcAaqT~aTFL--KLAgPQLV------  242 (424)
T KOG0652         172 DIGGLDKQIQELVEAI-VLPMTHKEKFENLGIRPPKGVLMYGPPGTGKTLMARACAAQTNATFL--KLAGPQLV------  242 (424)
T ss_pred             CCCCHHHHHHHHHHHH-CCCCCCHHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHHHCCCHHH--HHCCHHHH------
T ss_conf             0325789999999886-14565687887468889972276579997577999999874010688--73264777------


Q ss_pred             CCCCCCCCCHHHHHHHHHCCCCCE-EEEEECHHHHHHH-----CCCCH--HHHHHHHCCCCCCCCEEEEECCCCCCCCCE
Q ss_conf             200145671289999983278873-9999331554231-----17711--556655406001681332010352364427
Q gi|254780270|r  412 RRTYIGSMPGRIIQSLKRAKRSNP-LLLLDEIDKMGSD-----LRGDP--SAALLEVLDPAQNSSFVDHYLEVEYDLSDV  483 (820)
Q Consensus       412 ~~ty~ga~pg~ii~~l~~~~~~np-v~~ldeidk~~~~-----~~gdp--~~allevldp~qn~~f~d~y~~~~~dls~v  483 (820)
                       .-|+|--.-..-.+..-|+..-| +|++||+|-+|.-     ..||-  ...|||+|.  |-..|.-.        -+|
T Consensus       243 -QMfIGdGAkLVRDAFaLAKEkaP~IIFIDElDAIGtKRfDSek~GDREVQRTMLELLN--QLDGFss~--------~~v  311 (424)
T KOG0652         243 -QMFIGDGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLN--QLDGFSSD--------DRV  311 (424)
T ss_pred             -HHHHCCHHHHHHHHHHHHHCCCCEEEEEECHHHHCCCCCCCCCCCCHHHHHHHHHHHH--HCCCCCCC--------CCE
T ss_conf             -6653341889999998753349838997300232334365312343899999999998--60489975--------626


Q ss_pred             EEEEECCCCCC-CHHH-----CCCEEEEEECCCCHHHHHHHHHHH
Q ss_conf             99993486554-4131-----172479982587868999899986
Q gi|254780270|r  484 MFIMTANTLNI-PLPL-----MDRMEIIRIAGYTEEEKLQIAKNH  522 (820)
Q Consensus       484 ~fi~tan~~~i-~~~l-----~drme~i~~~~y~~~ek~~i~~~~  522 (820)
                      -.|+..|-.+| .++|     +||-  |++|--+.+-...|-+-|
T Consensus       312 KviAATNRvDiLDPALlRSGRLDRK--IEfP~Pne~aRarIlQIH  354 (424)
T KOG0652         312 KVIAATNRVDILDPALLRSGRLDRK--IEFPHPNEEARARILQIH  354 (424)
T ss_pred             EEEEECCCCCCCCHHHHHCCCCCCC--CCCCCCCHHHHHHHHHHH
T ss_conf             7885216434348888644664444--348899778988999886


No 149
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional
Probab=98.56  E-value=1.9e-06  Score=67.62  Aligned_cols=178  Identities=26%  Similarity=0.370  Sum_probs=112.5

Q ss_pred             HHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH----------CCCEEEEECCCCCCHHHHCC
Q ss_conf             20116899999999999984244467359986056565027999999770----------88249986188888888356
Q gi|254780270|r  341 HFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKAT----------GRQYVRMSLGGVYDEADIRG  410 (820)
Q Consensus       341 hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al----------~r~f~~islgg~~d~~~i~g  410 (820)
                      ..|=++==+|+++.|+=+.-| +     -||+|.||||||.|+..+|...          +...+.+.+|.+     +-|
T Consensus       188 viGR~~Ei~r~i~iL~Rr~KN-N-----piLvGepGVGKTAIvEGLA~rI~~g~VP~~L~~~~i~~Ldl~~L-----iAG  256 (758)
T PRK11034        188 LIGREKELERAIQVLCRRRKN-N-----PLLVGESGVGKTAIAEGLAWRIVQGDVPEVMADCTIYSLDIGSL-----LAG  256 (758)
T ss_pred             CCCCHHHHHHHHHHHHHHCCC-C-----CEEECCCCCCHHHHHHHHHHHHHCCCCCHHHCCCEEEEEEHHHH-----HCC
T ss_conf             738489999999999763258-9-----60216999869999999999997389976558988998458778-----616


Q ss_pred             CCCCCCCCCCHHHHHHHHHC-CCCCEEEEEECHHHH-H--HHCCC--CHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEE
Q ss_conf             32001456712899999832-788739999331554-2--31177--115566554060016813320103523644279
Q gi|254780270|r  411 HRRTYIGSMPGRIIQSLKRA-KRSNPLLLLDEIDKM-G--SDLRG--DPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVM  484 (820)
Q Consensus       411 h~~ty~ga~pg~ii~~l~~~-~~~npv~~ldeidk~-~--~~~~g--dp~~allevldp~qn~~f~d~y~~~~~dls~v~  484 (820)
                      .  .|-|..-.|+-.-+... ...|.++++|||--+ |  +...|  |.++.|--.|.-   -.+            +++
T Consensus       257 t--kyRGefEeRlk~vi~e~~~~~~~ILFIDEiH~ivGaG~~~gg~~DaaNlLKP~Lar---G~l------------~~I  319 (758)
T PRK11034        257 T--KYRGDFEKRFKALLKQLEQDTNSILFIDEIHTIIGAGAASGGQVDAANLIKPLLSS---GKI------------RVI  319 (758)
T ss_pred             C--CCCHHHHHHHHHHHHHHHHCCCEEEEEECHHHHCCCCCCCCCCCCHHHHHHHHHHC---CCC------------EEE
T ss_conf             8--64154999999999999857985999804344226887677764678874578746---972------------399


Q ss_pred             EEEECCCC----CCCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCC
Q ss_conf             99934865----544131172479982587868999899986089899862578131322899999997317
Q gi|254780270|r  485 FIMTANTL----NIPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLF  552 (820)
Q Consensus       485 fi~tan~~----~i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Y  552 (820)
                      --+|.+..    .-.++|--|++.|.+.--+.+|-+.|-+. +.++--+-|     .|.++|+||...++-.
T Consensus       320 gaTT~~EYrk~iekD~AL~RRFq~V~V~EPs~e~t~~IL~g-l~~~yE~~H-----~v~~~d~al~~av~Ls  385 (758)
T PRK11034        320 GSTTYQEFSNIFEKDRALARRFQKIDITEPSIEETVQIING-LKPKYEAHH-----DVRYTAKAVRAAVELA  385 (758)
T ss_pred             EECCHHHHHHCCCCCHHHHHCCCEEECCCCCHHHHHHHHHH-HHHHHHHCC-----CCEECCHHHHHHHHHH
T ss_conf             94377998750321478884282653189998999999998-999873236-----9577438999999999


No 150
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]
Probab=98.56  E-value=1.5e-06  Score=68.40  Aligned_cols=146  Identities=25%  Similarity=0.483  Sum_probs=98.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCC-----CCCCHHHHHHHHHCCCCCEEEEEECH
Q ss_conf             5998605656502799999977088249986188888888356320014-----56712899999832788739999331
Q gi|254780270|r  368 ILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYI-----GSMPGRIIQSLKRAKRSNPLLLLDEI  442 (820)
Q Consensus       368 il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~-----ga~pg~ii~~l~~~~~~npv~~ldei  442 (820)
                      -+.|.|.||||||||-...|+-+|.+.+||.|.-..|--++-|..---.     -=|-.-+..+|++.+    -+||||+
T Consensus      1545 pilLEGsPGVGKTSlItaLAr~tG~kliRINLSeQTdL~DLfGsd~Pve~~Gef~w~dapfL~amr~G~----WVlLDEi 1620 (4600)
T COG5271        1545 PILLEGSPGVGKTSLITALARKTGKKLIRINLSEQTDLCDLFGSDLPVEEGGEFRWMDAPFLHAMRDGG----WVLLDEI 1620 (4600)
T ss_pred             CEEECCCCCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCCCCCCCEEEECCCHHHHHHHCCC----EEEEEHH
T ss_conf             546227998667899999999745724786320110289873778875567616742468999853498----7996241


Q ss_pred             HHHHHHC-CCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEE-EEEECCCC-------CCCHHHCCCEEEEEECCCCHH
Q ss_conf             5542311-77115566554060016813320103523644279-99934865-------544131172479982587868
Q gi|254780270|r  443 DKMGSDL-RGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVM-FIMTANTL-------NIPLPLMDRMEIIRIAGYTEE  513 (820)
Q Consensus       443 dk~~~~~-~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~-fi~tan~~-------~i~~~l~drme~i~~~~y~~~  513 (820)
                      .-.|++- -|     |=-+||. .|..|.- -+|..||----+ ..|+-|.-       ..|.-.++|.-+|.+.+||.+
T Consensus      1621 NLaSQSVlEG-----LNacLDh-R~eayIP-Eld~~f~~HpnfrVFAaqNPq~qggGRKgLPkSF~nRFsvV~~d~lt~d 1693 (4600)
T COG5271        1621 NLASQSVLEG-----LNACLDH-RREAYIP-ELDKTFDVHPNFRVFAAQNPQDQGGGRKGLPKSFLNRFSVVKMDGLTTD 1693 (4600)
T ss_pred             HHHHHHHHHH-----HHHHHHH-CCCCCCC-CCCCEEECCCCEEEEEECCCHHCCCCCCCCCHHHHHHHHEEEECCCCCC
T ss_conf             0327889988-----8998850-1442563-1133252168705542048110279856687888622115775034530


Q ss_pred             HHHHHHHHHHHH
Q ss_conf             999899986089
Q gi|254780270|r  514 EKLQIAKNHLVK  525 (820)
Q Consensus       514 ek~~i~~~~l~p  525 (820)
                      +-++||+. +.|
T Consensus      1694 Di~~Ia~~-~yp 1704 (4600)
T COG5271        1694 DITHIANK-MYP 1704 (4600)
T ss_pred             HHHHHHHH-HCC
T ss_conf             09999985-177


No 151
>KOG0991 consensus
Probab=98.54  E-value=2.8e-07  Score=73.96  Aligned_cols=218  Identities=26%  Similarity=0.352  Sum_probs=122.3

Q ss_pred             HCCCCC-CCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH-CCC
Q ss_conf             404158-766322106889987766520116899999999999984244467359986056565027999999770-882
Q gi|254780270|r  316 LGVPWD-KKSKTKKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKAT-GRQ  393 (820)
Q Consensus       316 ~~lPW~-~~t~~~~dl~~a~~iLd~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al-~r~  393 (820)
                      .++||- ||-+..+          .|.-|-|+.-+|    |.|  ...+.+-|-|.+.||||+|||+-....|++| |+.
T Consensus        13 ~~l~wVeKYrP~~l----------~dIVGNe~tv~r----l~v--ia~~gnmP~liisGpPG~GKTTsi~~LAr~LLG~~   76 (333)
T KOG0991          13 YQLPWVEKYRPSVL----------QDIVGNEDTVER----LSV--IAKEGNMPNLIISGPPGTGKTTSILCLARELLGDS   76 (333)
T ss_pred             CCCHHHHHHCCHHH----------HHHHCCHHHHHH----HHH--HHHCCCCCCEEEECCCCCCHHHHHHHHHHHHHCHH
T ss_conf             11357886085299----------882177989999----999--99728998667527999861648999999983806


Q ss_pred             EEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCC-----EEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCC
Q ss_conf             49986188888888356320014567128999998327887-----3999933155423117711556655406001681
Q gi|254780270|r  394 YVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSN-----PLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSS  468 (820)
Q Consensus       394 f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~n-----pv~~ldeidk~~~~~~gdp~~allevldp~qn~~  468 (820)
                      +- =.+=-++ .|+=||-.     -.-- -|.....-++.-     -+++|||-|-|..+.+-    ||--...-     
T Consensus        77 ~k-e~vLELN-ASdeRGID-----vVRn-~IK~FAQ~kv~lp~grhKIiILDEADSMT~gAQQ----AlRRtMEi-----  139 (333)
T KOG0991          77 YK-EAVLELN-ASDERGID-----VVRN-KIKMFAQKKVTLPPGRHKIIILDEADSMTAGAQQ----ALRRTMEI-----  139 (333)
T ss_pred             HH-HHHHHCC-CCCCCCCH-----HHHH-HHHHHHHHHCCCCCCCEEEEEEECCCHHHHHHHH----HHHHHHHH-----
T ss_conf             66-5763205-76554608-----9999-9999987203489985248996152202068999----99999999-----


Q ss_pred             EEEEECCCCCCCCCEEEEEECCCCC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHH
Q ss_conf             3320103523644279999348655-441311724799825878689998999860898998625781313228999999
Q gi|254780270|r  469 FVDHYLEVEYDLSDVMFIMTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLD  547 (820)
Q Consensus       469 f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~  547 (820)
                                --|..-|..-.|..+ |-+|+-.|--+...+-.+..   +|     +.+.++-.  +.+.+.++++.++.
T Consensus       140 ----------yS~ttRFalaCN~s~KIiEPIQSRCAiLRysklsd~---qi-----L~Rl~~v~--k~Ekv~yt~dgLea  199 (333)
T KOG0991         140 ----------YSNTTRFALACNQSEKIIEPIQSRCAILRYSKLSDQ---QI-----LKRLLEVA--KAEKVNYTDDGLEA  199 (333)
T ss_pred             ----------HCCCCHHHHHHCCHHHHHHHHHHHHHHHHHCCCCHH---HH-----HHHHHHHH--HHHCCCCCCCHHHH
T ss_conf             ----------706320000015421322267734576532226789---99-----99999999--87078877114778


Q ss_pred             HHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHCCCC
Q ss_conf             9731774102347888799998987654211785201279678675305200
Q gi|254780270|r  548 IIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDTTVSINENNLQDYLGVPR  599 (820)
Q Consensus       548 ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~lg~~~  599 (820)
                      ||-  |-+.-+|+---.+.   .-+        ...-.|+.+++.+..+.|.
T Consensus       200 iif--ta~GDMRQalNnLQ---st~--------~g~g~Vn~enVfKv~d~Ph  238 (333)
T KOG0991         200 IIF--TAQGDMRQALNNLQ---STV--------NGFGLVNQENVFKVCDEPH  238 (333)
T ss_pred             HHH--HCCCHHHHHHHHHH---HHH--------CCCCCCCHHHHHHCCCCCC
T ss_conf             554--41661999999999---874--------0545246323100069998


No 152
>KOG1969 consensus
Probab=98.53  E-value=2.6e-06  Score=66.65  Aligned_cols=161  Identities=25%  Similarity=0.321  Sum_probs=103.2

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCC----C--CEEEE
Q ss_conf             67359986056565027999999770882499861888888883563200145671289999983278----8--73999
Q gi|254780270|r  365 KGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKR----S--NPLLL  438 (820)
Q Consensus       365 ~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~----~--npv~~  438 (820)
                      .-.||+|+||||.|||+||.-||+--|-..+.|.-.--|-.+.++           -||-.++...-+    .  +|+ +
T Consensus       325 ~kKilLL~GppGlGKTTLAHViAkqaGYsVvEINASDeRt~~~v~-----------~kI~~avq~~s~l~adsrP~CL-V  392 (877)
T KOG1969         325 PKKILLLCGPPGLGKTTLAHVIAKQAGYSVVEINASDERTAPMVK-----------EKIENAVQNHSVLDADSRPVCL-V  392 (877)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHCCCEEEEECCCCCCCHHHHH-----------HHHHHHHHHCCCCCCCCCCCEE-E
T ss_conf             400687536887872479999998628548873255543478899-----------9999988641122568886359-9


Q ss_pred             EECHHHHHHHCCCCHH--HHHHHHCCC-------CCCCCE---EEEECCCCCC-CCCEEEEEECCCC-C-CCHHHCCCEE
Q ss_conf             9331554231177115--566554060-------016813---3201035236-4427999934865-5-4413117247
Q gi|254780270|r  439 LDEIDKMGSDLRGDPS--AALLEVLDP-------AQNSSF---VDHYLEVEYD-LSDVMFIMTANTL-N-IPLPLMDRME  503 (820)
Q Consensus       439 ldeidk~~~~~~gdp~--~allevldp-------~qn~~f---~d~y~~~~~d-ls~v~fi~tan~~-~-i~~~l~drme  503 (820)
                      +||||--      +++  .+||.++--       .|+.+-   .+.-    +- |++ =.||-+|++ . --+||+---+
T Consensus       393 iDEIDGa------~~~~Vdvilslv~a~~k~~~Gkq~~~~~~rkkkr----~~~L~R-PIICICNdLYaPaLR~Lr~~A~  461 (877)
T KOG1969         393 IDEIDGA------PRAAVDVILSLVKATNKQATGKQAKKDKKRKKKR----SKLLTR-PIICICNDLYAPALRPLRPFAE  461 (877)
T ss_pred             EECCCCC------CHHHHHHHHHHHHHHCCHHHCCCCCCHHHHHHHC----CCCCCC-CEEEEECCCCCHHHHHCCCCEE
T ss_conf             8424687------2899999999997416142168663203455530----465458-7789864755533331021048


Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHH
Q ss_conf             998258786899989998608989986257813132289999999731774102347
Q gi|254780270|r  504 IIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRS  560 (820)
Q Consensus       504 ~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~  560 (820)
                      +|.+..-+..-=+         +-+++.+.. +.+..+-.+|..+++.|..  -+|.
T Consensus       462 ii~f~~p~~s~Lv---------~RL~~IC~r-E~mr~d~~aL~~L~el~~~--DIRs  506 (877)
T KOG1969         462 IIAFVPPSQSRLV---------ERLNEICHR-ENMRADSKALNALCELTQN--DIRS  506 (877)
T ss_pred             EEEECCCCHHHHH---------HHHHHHHHH-HCCCCCHHHHHHHHHHHCC--HHHH
T ss_conf             9995699766899---------999999764-1577887899999998613--0988


No 153
>PRK08727 hypothetical protein; Validated
Probab=98.53  E-value=1.2e-05  Score=61.71  Aligned_cols=181  Identities=19%  Similarity=0.309  Sum_probs=114.6

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHH---HHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEE
Q ss_conf             4467359986056565027999999---7708824998618888888835632001456712899999832788739999
Q gi|254780270|r  363 KNKGLILCFVGPPGVGKTSLAQSIA---KATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLL  439 (820)
Q Consensus       363 ~~~g~il~l~gppgvGKts~~~sia---~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~l  439 (820)
                      ...+..+.|+||+|.|||.|+.+++   ...|+....+++....+             ..|. +++++    ....++.+
T Consensus        38 ~~~~~~lyl~G~~GsGKTHLl~a~~~~~~~~~~~~~yl~l~~~~~-------------~~~~-~l~~l----e~~~ll~i   99 (233)
T PRK08727         38 GQSSDWLYLSGPAGTGKTHLALSLCAAAEQAGRSSAYLPLQAAAG-------------RLRD-ALEAL----EGRSLVAL   99 (233)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEHHHHHH-------------HHHH-HHHHH----CCCCEEEE
T ss_conf             888898999899999889999999999982799728844788532-------------0256-77531----03897898


Q ss_pred             ECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCC----CCCHH-HCCC---EEEEEECCCC
Q ss_conf             33155423117711556655406001681332010352364427999934865----54413-1172---4799825878
Q gi|254780270|r  440 DEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTL----NIPLP-LMDR---MEIIRIAGYT  511 (820)
Q Consensus       440 deidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~----~i~~~-l~dr---me~i~~~~y~  511 (820)
                      |-||.++...  +-.-||.++..--             .+ ++.-.+.|++..    ++--| |+.|   +.++++...+
T Consensus       100 DDid~i~g~~--~~e~aLFhL~N~~-------------~~-~~~~ll~ts~~~P~~l~~~l~DL~SRL~~~~~~~l~~~d  163 (233)
T PRK08727        100 DGVDSIAGQR--EDEVALFDFHNRA-------------RA-AGITLLYTARQMPDGLALVLPDLRSRLSQCIRIGLPVLD  163 (233)
T ss_pred             ECCHHCCCCH--HHHHHHHHHHHHH-------------HH-CCCEEEEECCCCHHHHCCCHHHHHHHHHCCCEEEECCCC
T ss_conf             5501126982--7999999999999-------------86-198389977989566231002199999669228857889


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHH
Q ss_conf             68999899986089899862578131322899999997317741023478887999989876542117852012796786
Q gi|254780270|r  512 EEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDTTVSINENNL  591 (820)
Q Consensus       512 ~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l  591 (820)
                      .++|..|.+++.     .     ...+.++++++.||+++..|.  .+.|.+.+..+-+..-..       +-.||.-.+
T Consensus       164 D~~~~~iL~~~a-----~-----~rgl~l~~~V~~Yll~r~~R~--~~~l~~~l~~LD~~SL~~-------kr~iTip~v  224 (233)
T PRK08727        164 DVARAAVLRDRA-----Q-----RRGLALDEAAIDWLLTHGERE--LAGLVALLDRLDRESLAA-------KRRITVPFL  224 (233)
T ss_pred             HHHHHHHHHHHH-----H-----HCCCCCCHHHHHHHHHHCCCC--HHHHHHHHHHHHHHHHHC-------CCCCCHHHH
T ss_conf             799999999999-----9-----869999989999999856889--999999999999999980-------898889999


Q ss_pred             HHHHC
Q ss_conf             75305
Q gi|254780270|r  592 QDYLG  596 (820)
Q Consensus       592 ~~~lg  596 (820)
                      ++.|.
T Consensus       225 k~vL~  229 (233)
T PRK08727        225 RRVLE  229 (233)
T ss_pred             HHHHH
T ss_conf             99997


No 154
>PRK07940 DNA polymerase III subunit delta'; Validated
Probab=98.52  E-value=5.2e-07  Score=71.93  Aligned_cols=159  Identities=15%  Similarity=0.229  Sum_probs=95.8

Q ss_pred             HHHCHHHHHHHHHHHHHHHH-------HCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEE-EECCCCCCHHHH-CC
Q ss_conf             52011689999999999998-------4244467359986056565027999999770882499-861888888883-56
Q gi|254780270|r  340 DHFGLEKVKERIIEYLAVQM-------RVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVR-MSLGGVYDEADI-RG  410 (820)
Q Consensus       340 ~hyGl~~vK~rile~lav~~-------~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~-islgg~~d~~~i-~g  410 (820)
                      +.-|-+.|.+..-.-++-..       .+++.-..-..|+||+|+|||++|+..|++|+=+-.- -+.|....--.| .|
T Consensus         6 ~ivGQe~v~~~L~~A~~~~R~~~~~~~~~~~~~~HAyLF~Gp~G~Gk~~~A~~~A~~l~C~~~~~~~cg~C~~C~~i~~g   85 (395)
T PRK07940          6 RLVGQDAVVAELRAAARAARADSAHSAAAGSGMTHAWLFTGPPGSGRSNAARAFAAALQCTDPGVPGCGECRACRTVLAG   85 (395)
T ss_pred             HHCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHCC
T ss_conf             31592999999999998363434433334687660376368998788999999999966999999999878789998768


Q ss_pred             -C-CCCCC---CCCCH-HHHHHHHH------CCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCC
Q ss_conf             -3-20014---56712-89999983------2788739999331554231177115566554060016813320103523
Q gi|254780270|r  411 -H-RRTYI---GSMPG-RIIQSLKR------AKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEY  478 (820)
Q Consensus       411 -h-~~ty~---ga~pg-~ii~~l~~------~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~  478 (820)
                       | ...++   |+.=| -=|..|..      ....--|+++|+.|+|+..    .++|||-.|             +-|=
T Consensus        86 ~hpDv~~i~p~~~~i~id~iR~l~~~~~~~p~~~~~kv~ii~~a~~m~~~----a~NalLKtL-------------EEPp  148 (395)
T PRK07940         86 THPDVRVVVPEGLSIGVDEVREIVQIAARRPTTGRWRIVVIEDADRLTER----AANALLKAV-------------EEPP  148 (395)
T ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEEECHHHHCHH----HHHHHHHHH-------------CCCC
T ss_conf             99871898268776889999999999852730379559998077874899----999999852-------------1788


Q ss_pred             CCCCEEEEEECCCCC-CCHHHCCCEEEEEECCCCHHHHHH
Q ss_conf             644279999348655-441311724799825878689998
Q gi|254780270|r  479 DLSDVMFIMTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQ  517 (820)
Q Consensus       479 dls~v~fi~tan~~~-i~~~l~drme~i~~~~y~~~ek~~  517 (820)
                        .+++||..+++.+ +++..+.|-..+.+..-+.++=..
T Consensus       149 --~~~~fiL~t~~~~~llpTI~SRcq~~~f~~~~~~~i~~  186 (395)
T PRK07940        149 --PRTVWLLCAPSVEDVLPTIRSRCRHVALRTPSVEAVAD  186 (395)
T ss_pred             --CCEEEEEEECCHHHHHHHHHHHHEECCCCCCCHHHHHH
T ss_conf             --88699987399787446887440002379999999999


No 155
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms]
Probab=98.51  E-value=3.4e-06  Score=65.77  Aligned_cols=199  Identities=22%  Similarity=0.348  Sum_probs=129.6

Q ss_pred             HHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC---CEEEEECCCCCC---HHHHCCCCC-CCCCCCC----HHHHHH
Q ss_conf             98424446735998605656502799999977088---249986188888---888356320-0145671----289999
Q gi|254780270|r  358 QMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGR---QYVRMSLGGVYD---EADIRGHRR-TYIGSMP----GRIIQS  426 (820)
Q Consensus       358 ~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r---~f~~islgg~~d---~~~i~gh~~-ty~ga~p----g~ii~~  426 (820)
                      -+.-.....+|| +.|--||||--+|++|.++-.|   ||++|.+|-+-+   |||+=|+-+ -|-||-.    |++=.|
T Consensus       261 akr~A~tdstVL-i~GESGTGKElfA~~IH~~S~R~~~PFIaiNCaAiPe~LlESELFGye~GAFTGA~~~GK~GlfE~A  339 (560)
T COG3829         261 AKRIAKTDSTVL-ILGESGTGKELFARAIHNLSPRANGPFIAINCAAIPETLLESELFGYEKGAFTGASKGGKPGLFELA  339 (560)
T ss_pred             HHHHCCCCCCEE-EECCCCCCHHHHHHHHHHCCCCCCCCEEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEC
T ss_conf             986338998289-9537886689999998744843479807876433888888888727677642464457997605441


Q ss_pred             HHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEE--CCCCCCCCCEEEEEECCC-------------
Q ss_conf             98327887399993315542311771155665540600168133201--035236442799993486-------------
Q gi|254780270|r  427 LKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHY--LEVEYDLSDVMFIMTANT-------------  491 (820)
Q Consensus       427 l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y--~~~~~dls~v~fi~tan~-------------  491 (820)
                            .+.-++||||.-|....++    -||-||   |-++|.--=  -.+|.   +|=.|++-|-             
T Consensus       340 ------~gGTLFLDEIgempl~LQa----KLLRVL---QEkei~rvG~t~~~~v---DVRIIAATN~nL~~~i~~G~FRe  403 (560)
T COG3829         340 ------NGGTLFLDEIGEMPLPLQA----KLLRVL---QEKEIERVGGTKPIPV---DVRIIAATNRNLEKMIAEGTFRE  403 (560)
T ss_pred             ------CCCEEEEHHHCCCCHHHHH----HHHHHH---HHCEEEECCCCCCEEE---EEEEEECCCCCHHHHHHCCCCHH
T ss_conf             ------6983771232039989999----999987---5353785378875356---78999425758999986396165


Q ss_pred             --------CC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHH
Q ss_conf             --------55-441311724799825878689998999860898998625781313228999999973177410234788
Q gi|254780270|r  492 --------LN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFE  562 (820)
Q Consensus       492 --------~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~  562 (820)
                              +. --||||+|-           |-+..--.|++-+.-..+|-  .--.++++++.. ...|.+-.-||+|+
T Consensus       404 DLYYRLNV~~i~iPPLReR~-----------eDI~~L~~~Fl~k~s~~~~~--~v~~ls~~a~~~-L~~y~WPGNVRELe  469 (560)
T COG3829         404 DLYYRLNVIPITIPPLRERK-----------EDIPLLAEYFLDKFSRRYGR--NVKGLSPDALAL-LLRYDWPGNVRELE  469 (560)
T ss_pred             HHEEEECEEEECCCCCCCCC-----------CHHHHHHHHHHHHHHHHCCC--CCCCCCHHHHHH-HHHCCCCCHHHHHH
T ss_conf             53003040111477723382-----------01899999999999987288--766689999999-98689996099999


Q ss_pred             HHHHHHHHHHHHHHHCCCCCEECCCHHHHH-HHH
Q ss_conf             879999898765421178520127967867-530
Q gi|254780270|r  563 RALMKIARKAVTKIVKNSDTTVSINENNLQ-DYL  595 (820)
Q Consensus       563 r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~-~~l  595 (820)
                      -.|+.+     +.++.+...   |+..++. .++
T Consensus       470 NviER~-----v~~~~~~~~---I~~~~lp~~~l  495 (560)
T COG3829         470 NVIERA-----VNLVESDGL---IDADDLPAFAL  495 (560)
T ss_pred             HHHHHH-----HHCCCCCCE---EEHHHCCHHHH
T ss_conf             999999-----810688662---22522620231


No 156
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones]
Probab=98.50  E-value=6.7e-07  Score=71.10  Aligned_cols=142  Identities=29%  Similarity=0.445  Sum_probs=73.3

Q ss_pred             HHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHH---------HHHC-------------------
Q ss_conf             520116899999999999984244467359986056565027999999---------7708-------------------
Q gi|254780270|r  340 DHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIA---------KATG-------------------  391 (820)
Q Consensus       340 ~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia---------~al~-------------------  391 (820)
                      |.-|.+.+|.- +|.-|       ..|--|.|+||||+|||-||+-+.         ++|-                   
T Consensus       180 DV~GQ~~AKrA-leiAA-------AGgHnLl~~GpPGtGKTmla~Rl~~lLPpls~~E~lE~s~I~s~~~~~~~~~~~~~  251 (490)
T COG0606         180 DVKGQEQAKRA-LEIAA-------AGGHNLLLVGPPGTGKTMLASRLPGLLPPLSIPEALEVSAIHSLAGDLHEGCPLKI  251 (490)
T ss_pred             HHCCCHHHHHH-HHHHH-------HCCCCEEEECCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCE
T ss_conf             64384999999-99998-------43886787569988656764231025999870888999888763543246786411


Q ss_pred             -CCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHC-CCCCCCCE
Q ss_conf             -8249986188888888356320014567128999998327887399993315542311771155665540-60016813
Q gi|254780270|r  392 -RQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVL-DPAQNSSF  469 (820)
Q Consensus       392 -r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevl-dp~qn~~f  469 (820)
                       |||.  +=+--...+.+-|   .|--+.||-|.-|      .|.|++|||+-....        ..||.| -|=.|..-
T Consensus       252 ~rPFr--~PHHsaS~~aLvG---GG~~p~PGeIsLA------H~GVLFLDElpef~~--------~iLe~LR~PLE~g~i  312 (490)
T COG0606         252 HRPFR--APHHSASLAALVG---GGGVPRPGEISLA------HNGVLFLDELPEFKR--------SILEALREPLENGKI  312 (490)
T ss_pred             ECCCC--CCCCCCHHHHHHC---CCCCCCCCCEEEE------CCCEEEEECCCHHHH--------HHHHHHHCCCCCCCE
T ss_conf             07876--8874022889737---8998898735430------387788614421059--------999997374125817


Q ss_pred             EE----EECCCCCCCCCEEEEEECC-----------------------CCC-CCHHHCCCEEE-EEECCCC
Q ss_conf             32----0103523644279999348-----------------------655-44131172479-9825878
Q gi|254780270|r  470 VD----HYLEVEYDLSDVMFIMTAN-----------------------TLN-IPLPLMDRMEI-IRIAGYT  511 (820)
Q Consensus       470 ~d----~y~~~~~dls~v~fi~tan-----------------------~~~-i~~~l~drme~-i~~~~y~  511 (820)
                      +=    +-+.+|-   +..+|+++|                       +.+ +..||+||+.. ++++.-+
T Consensus       313 ~IsRa~~~v~ypa---~Fqlv~AmNpcpcG~~~~~~~~C~c~~~~~~~Y~~klSgp~lDRiDl~vev~~~~  380 (490)
T COG0606         313 IISRAGSKVTYPA---RFQLVAAMNPCPCGNLGAPLRRCPCSPRQIKRYLNKLSGPFLDRIDLMVEVPRLS  380 (490)
T ss_pred             EEEECCCEEEEEE---EEEEHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHEECCCCCC
T ss_conf             9997587168721---2677522399976478887777578878877889874378775524110046789


No 157
>pfam00308 Bac_DnaA Bacterial dnaA protein.
Probab=98.49  E-value=4.7e-07  Score=72.23  Aligned_cols=172  Identities=23%  Similarity=0.324  Sum_probs=107.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCC-----CEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECH
Q ss_conf             5998605656502799999977088-----24998618888888835632001456712899999832788739999331
Q gi|254780270|r  368 ILCFVGPPGVGKTSLAQSIAKATGR-----QYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEI  442 (820)
Q Consensus       368 il~l~gppgvGKts~~~sia~al~r-----~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~ldei  442 (820)
                      .+.++||+|+|||.|..+++....+     +...++.      .++-   .+|+.+.-..-+..++.-=+.-.++++|.|
T Consensus        36 pl~i~G~~G~GKTHLLqA~~~~~~~~~~~~~v~yl~~------~~~~---~~~~~~l~~~~~~~f~~~l~~~d~l~iDDi  106 (219)
T pfam00308        36 PLFIYGGVGLGKTHLLHAIGNYALRNFPNLRVVYLTS------EEFL---NDFVDALRDNKIEAFKKSYRNVDLLLIDDI  106 (219)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEH------HHHH---HHHHHHHHCCCHHHHHHHHHHCCHHHHCCH
T ss_conf             2699889999888999999999998499982888439------9999---988999981888899999763233652236


Q ss_pred             HHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCC--CC-CCHHHCCCE---EEEEECCCCHHHHH
Q ss_conf             5542311771155665540600168133201035236442799993486--55-441311724---79982587868999
Q gi|254780270|r  443 DKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANT--LN-IPLPLMDRM---EIIRIAGYTEEEKL  516 (820)
Q Consensus       443 dk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~--~~-i~~~l~drm---e~i~~~~y~~~ek~  516 (820)
                      |-+....  +-.-+|.++++--++..            -++++-++...  +. ..+-|..|+   -++++...+.+++.
T Consensus       107 ~~l~~~~--~~ee~lf~l~N~~~~~~------------~~lllts~~~p~~l~~~~~dL~SRL~~g~~~~i~~pdd~~~~  172 (219)
T pfam00308       107 QFLAGKE--KTQEEFFHTFNALHENN------------KQIVLTSDRPPKELEGFEDRLRSRFEWGLIIAIEPPDLETRL  172 (219)
T ss_pred             HHHCCCH--HHHHHHHHHHHHHHHCC------------CEEEEECCCCCCCCCCCCHHHHHHHHCCEEEECCCCCHHHHH
T ss_conf             7656864--78999999999999729------------869997799810024532779999868756611699999999


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             8999860898998625781313228999999973177410234788879999898765
Q gi|254780270|r  517 QIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVT  574 (820)
Q Consensus       517 ~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~  574 (820)
                      .|.+++.     +     ..++.++++++.+|++++.|-  +|.|.-.|.+++++...
T Consensus       173 ~iL~~~a-----~-----~r~l~l~~~v~~yl~~r~~R~--~r~L~~~L~~L~~~~~~  218 (219)
T pfam00308       173 AILRKKA-----E-----EENINIPNEVLNFIAQRITDN--VRELEGALNRLLAFASF  218 (219)
T ss_pred             HHHHHHH-----H-----HCCCCCCHHHHHHHHHHCCCC--HHHHHHHHHHHHHHHCC
T ss_conf             9999999-----9-----849999999999999842798--99999999999985507


No 158
>PRK09862 putative ATP-dependent protease; Provisional
Probab=98.47  E-value=3.2e-06  Score=65.88  Aligned_cols=162  Identities=23%  Similarity=0.308  Sum_probs=133.5

Q ss_pred             CCCCEEEECCCCCEEEEEEEEEECCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHCCCEEECCCCCCCC
Q ss_conf             50000000001680799999997489972443256899999999999999998886299855742078147448888478
Q gi|254780270|r  612 GIVTGLAWTEVGGEILTVEGVIMPGKGEITITGNLKEIMKESILAASSYVRSKATTFGIIPSAFNEINIHVHVPEGATPK  691 (820)
Q Consensus       612 G~v~GLa~t~~GG~~l~IE~~~~~g~g~l~lTG~lg~vmkES~~~A~s~~k~~~~~~~~~~~~~~~~diHih~p~Ga~pK  691 (820)
                      ++|..-|...+-|.+..||+...+|-..+.+.|....-.|||-    .=||+-...-+..   |...-|-|++--..+||
T Consensus         4 a~v~s~al~Gi~~~~V~VEv~i~~GlP~f~iVGLpd~av~Esr----eRVrsAl~nsg~~---~P~~rItVNLaPAdl~K   76 (506)
T PRK09862          4 SIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEAR----DRVRSAIINSGYE---YPAKKITINLAPADLPK   76 (506)
T ss_pred             EEEEEEEEECCEEEEEEEEEEECCCCCCEEEECCCHHHHHHHH----HHHHHHHHHCCCC---CCCCCEEEECCCCCCCC
T ss_conf             5676642307501699999982599862278378469999999----9999999838999---99880899707878888


Q ss_pred             CCCCHHHHHHHHHHHHHHCCCCC--CCCEEEEEEEECCEEEEECCHHHHHHHHHHCCCCEEECCHHHHHHHHHCCHHHHC
Q ss_conf             88730689999999998368887--5610663685030250006568999999970996998036775507761488770
Q gi|254780270|r  692 DGPSAGIAMATAIVSIMTCIPVY--KNVAMTGELTLRGRVLPIGGLKEKLLAALRAGVTKVLIPEENIKDLMDIPENVKN  769 (820)
Q Consensus       692 DGPSAGi~i~tal~S~~~~~~v~--~~iAmTGEitl~G~VlpiGGi~eK~laA~raGi~~viiP~~N~~d~~~ip~~~~~  769 (820)
                      .|++=-.+|+.+++.+--..+..  .+..+-||++|.|.|.||.|+---+++|+++| +++|+|.+|..+..-+     .
T Consensus        77 ~Gs~fDLpIA~~iL~a~~qi~~~~l~~~~~~GEL~LdG~lr~v~G~lp~~l~a~~~g-~~~ivp~~n~~ea~~v-----~  150 (506)
T PRK09862         77 EGGRYDLPIAIALLAASEQLTANKLDEYELVGELALTGALRGVPGAISSATEAIKSG-RKIIVAKDNEDEVGLI-----N  150 (506)
T ss_pred             CCCCCHHHHHHHHHHHCCCCCHHHHCCEEEEEECCCCCEEECCCCHHHHHHHHHHCC-CEEEECCCCHHHHCCC-----C
T ss_conf             876431999999999769998244302488851255860430653689999999759-9899534645665056-----9


Q ss_pred             CCEEEECCCHHHHHHHH
Q ss_conf             97999819399988876
Q gi|254780270|r  770 GLEIIPVSFMGEVLKHA  786 (820)
Q Consensus       770 ~l~~~~v~~~~evl~~a  786 (820)
                      ++++++|+++.||+.+-
T Consensus       151 ~~~v~~~~~L~e~~~~l  167 (506)
T PRK09862        151 GEGCLIADHLQAVCAFL  167 (506)
T ss_pred             CCCEECCCCHHHHHHHH
T ss_conf             98287032599999986


No 159
>PTZ00111 DNA replication licensing factor MCM4; Provisional
Probab=98.43  E-value=1.5e-06  Score=68.38  Aligned_cols=164  Identities=21%  Similarity=0.288  Sum_probs=98.8

Q ss_pred             HHHHHHCHHHHHHHHHHHHH--HHHH---CC---------CCCCCE-EEEECCCCCCHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             76652011689999999999--9984---24---------446735-998605656502799999977088249986188
Q gi|254780270|r  337 LDQDHFGLEKVKERIIEYLA--VQMR---VI---------KNKGLI-LCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGG  401 (820)
Q Consensus       337 Ld~~hyGl~~vK~rile~la--v~~~---~~---------~~~g~i-l~l~gppgvGKts~~~sia~al~r~f~~islgg  401 (820)
                      +--..||+++||+-|+=.|-  +.+.   ++         ..+|.| ++|+|-|||+|..|-+.+++.--|-.+. |=.|
T Consensus       449 iAPSI~~~~dvKkgillqLFGg~~k~~~~~~~~~~~~~~~~~RgdIniLl~GDPgtaKSQlL~yv~~iaPRgvyt-sGkg  527 (916)
T PTZ00111        449 FAPSIKARNNVKIGLLCQLFSCNANSSDNNKSPDACYKVDNFRGIINVLLCGDPGTAKSQLLHYTHLLSPRSIYT-SGKS  527 (916)
T ss_pred             HCCHHCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHCCCEEEE-CCCC
T ss_conf             086211522699999999848875456778776544444443454059995799601899999999728742674-5986


Q ss_pred             CCCH---HHH--C--CCCCCC--CCCCCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEE
Q ss_conf             8888---883--5--632001--456712899999832788739999331554231177115566554060016813320
Q gi|254780270|r  402 VYDE---ADI--R--GHRRTY--IGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDH  472 (820)
Q Consensus       402 ~~d~---~~i--~--gh~~ty--~ga~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~  472 (820)
                      ..-.   |-+  +  +.++.+  -||+          +=.-+.|-.+||.|||+.+.|    |+|.|+..-  -      
T Consensus       528 sSavGLTA~v~~~d~~tg~~~LEaGAL----------VLaD~GvccIDEFDKM~~~~r----s~lhEaMEQ--Q------  585 (916)
T PTZ00111        528 SSSVGLTASIKFNESDNGRAMIQPGAV----------VLANGGVCCIDELDKCHNESR----LSLYEVMEQ--Q------  585 (916)
T ss_pred             CCCCCCEEEEEECCCCCCCEEEECCCE----------EECCCCEEEEEHHHCCCHHHH----HHHHHHHHH--H------
T ss_conf             542264689983268878689854808----------972798799622203685678----899998866--3------


Q ss_pred             ECCCCCCCCCEEEEEECC------------------------CCCCCHHHCCCEEEEEECCCCHHHH------HHHHHHH
Q ss_conf             103523644279999348------------------------6554413117247998258786899------9899986
Q gi|254780270|r  473 YLEVEYDLSDVMFIMTAN------------------------TLNIPLPLMDRMEIIRIAGYTEEEK------LQIAKNH  522 (820)
Q Consensus       473 y~~~~~dls~v~fi~tan------------------------~~~i~~~l~drme~i~~~~y~~~ek------~~i~~~~  522 (820)
                          .+-.+|.=.+||-|                        .+++|+||+.|..+|.+--=...|+      .+||+.|
T Consensus       586 ----tvSIAKAGI~~tLnARtSvLAaANP~~gry~~~~~v~enI~lpp~LLSRFDLIfl~lD~~de~~Dr~IA~hIa~~~  661 (916)
T PTZ00111        586 ----TVTIAKAGIVATLKAETAILASCNPINSRYNKNKAVIENINISPSLFTRFDLIYLVLDHIDQDTDQLISLSIAKDF  661 (916)
T ss_pred             ----HHHHHHCCEEEEECHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCHHHHHHHEEEEEECCCCHHHHHHHHHHHHHHH
T ss_conf             ----1235323504541203456553286556578786767645799403312204677505786566689999998766


Q ss_pred             HHHHH
Q ss_conf             08989
Q gi|254780270|r  523 LVKKV  527 (820)
Q Consensus       523 l~p~~  527 (820)
                      |.+..
T Consensus       662 L~~hl  666 (916)
T PTZ00111        662 LLPHM  666 (916)
T ss_pred             HHHHC
T ss_conf             54310


No 160
>PRK08769 DNA polymerase III subunit delta'; Validated
Probab=98.41  E-value=2.6e-06  Score=66.66  Aligned_cols=147  Identities=17%  Similarity=0.268  Sum_probs=90.1

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCC-CCHHHH-CC-CC-CCCCCCC
Q ss_conf             16899999999999984244467359986056565027999999770882499861888-888883-56-32-0014567
Q gi|254780270|r  344 LEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGV-YDEADI-RG-HR-RTYIGSM  419 (820)
Q Consensus       344 l~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~-~d~~~i-~g-h~-~ty~ga~  419 (820)
                      ++++-+++...     +..+.-+..+.|.||+|+||+++|..+|++|--.-  -.-++. +...-+ .| |. .+++-..
T Consensus         9 q~~~~~~L~~~-----i~~~rl~HA~Lf~Gp~G~GK~~~A~~~A~~llc~~--~~~~~~~~~~~~i~~g~HPD~~~i~~~   81 (319)
T PRK08769          9 QQRAFDQTVAA-----LDAGRLGHGLLICGPEGLGKRAVALALAEHVLASG--PDPALAQRTRQLIAAGTHPDLQLVSFI   81 (319)
T ss_pred             CHHHHHHHHHH-----HHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCC--CCCCCCCHHHHHHHCCCCCCEEEEECC
T ss_conf             68999999999-----97699420687589998789999999999983799--797654338899966899896877534


Q ss_pred             CH----H-----HHHHHHH-------C--CCCCEEEEEECHHHHHHHCCCCHHHHHHHHCC-CCCCCCEEEEECCCCCCC
Q ss_conf             12----8-----9999983-------2--78873999933155423117711556655406-001681332010352364
Q gi|254780270|r  420 PG----R-----IIQSLKR-------A--KRSNPLLLLDEIDKMGSDLRGDPSAALLEVLD-PAQNSSFVDHYLEVEYDL  480 (820)
Q Consensus       420 pg----~-----ii~~l~~-------~--~~~npv~~ldeidk~~~~~~gdp~~allevld-p~qn~~f~d~y~~~~~dl  480 (820)
                      |.    +     -|+.++.       .  ....=|+++|+.|+|+..    -++|||-.|. |.                
T Consensus        82 ~~~~~~k~k~~I~IdqiR~l~~~~~~~p~~g~~KV~IId~Ad~mn~~----AaNalLK~LEEPp----------------  141 (319)
T PRK08769         82 PNRTGDKLRTEIVIEQVREISQKLALTPQYGIAQVVIVDPADAINRS----ACNALLKTLEEPS----------------  141 (319)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEECCHHHCCHH----HHHHHHHHHCCCC----------------
T ss_conf             44454311234869999999999613720279569998066752899----9999999822799----------------


Q ss_pred             CCEEEEEECCCCC-CCHHHCCCEEEEEECCCCHHHHHH
Q ss_conf             4279999348655-441311724799825878689998
Q gi|254780270|r  481 SDVMFIMTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQ  517 (820)
Q Consensus       481 s~v~fi~tan~~~-i~~~l~drme~i~~~~y~~~ek~~  517 (820)
                      .+++||.++++.+ +++.++.|--.|.++.-..+|-..
T Consensus       142 ~~~~~iL~~~~~~~ll~TI~SRCq~~~~~~p~~~~~~~  179 (319)
T PRK08769        142 PGRYLWLISAQPARLPATIRSRCQRLEFKLPPAHEALA  179 (319)
T ss_pred             CCEEEEEEECCHHHCCHHHHHCCEEECCCCCCHHHHHH
T ss_conf             88489998699365824776485011189969999999


No 161
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.
Probab=98.40  E-value=0.00011  Score=54.25  Aligned_cols=199  Identities=17%  Similarity=0.248  Sum_probs=112.9

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHCCC---EEEEECCCCCCHHH-HC------CCCCCCC--CCCCHHHHHHHHH--C
Q ss_conf             67359986056565027999999770882---49986188888888-35------6320014--5671289999983--2
Q gi|254780270|r  365 KGLILCFVGPPGVGKTSLAQSIAKATGRQ---YVRMSLGGVYDEAD-IR------GHRRTYI--GSMPGRIIQSLKR--A  430 (820)
Q Consensus       365 ~g~il~l~gppgvGKts~~~sia~al~r~---f~~islgg~~d~~~-i~------gh~~ty~--ga~pg~ii~~l~~--~  430 (820)
                      +..+..++|+||+|||++.+..++.|+..   ++.+.-..+. ..+ ++      |......  .++-..|-+-|..  .
T Consensus        42 ~~g~~lltGe~GtGKTtllr~l~~~l~~~~~~~~~i~~~~l~-~~~ll~~i~~~lg~~~~~~~~~~~~~~l~~~L~~~~~  120 (269)
T TIGR03015        42 REGFILITGEVGAGKTTLIRNLLKRLDQERVVAAKLVNTRVD-AEDLLRMVAADFGLETEGRDKAALLRELEDFLIEQFA  120 (269)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHCCCCCEEEEEECCCCCC-HHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             896599972998988999999998459345489997699999-9999999999859898898999999999999999996


Q ss_pred             CCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEE--EECCCC----C--CCHHHCCCE
Q ss_conf             78873999933155423117711556655406001681332010352364427999--934865----5--441311724
Q gi|254780270|r  431 KRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFI--MTANTL----N--IPLPLMDRM  502 (820)
Q Consensus       431 ~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi--~tan~~----~--i~~~l~drm  502 (820)
                      .-..||+++||-..++.+        .||.|--         ..|+..|=.+.+.|  +--+.+    .  --++|.+|.
T Consensus       121 ~g~~~vliIDEAq~L~~~--------~Le~Lr~---------L~n~e~~~~~ll~iiL~GqpeL~~~L~~~~~~~l~qRI  183 (269)
T TIGR03015       121 AGKRALLVVDEAQNLTPE--------LLEELRM---------LSNFQTDNAKLLQIFLVGQPEFRETLQSPQLQQLRQRI  183 (269)
T ss_pred             CCCCEEEEEECHHHCCHH--------HHHHHHH---------HHCCCCCCCCCEEEEEECCHHHHHHHCCCCHHHHHHCE
T ss_conf             699469997242219999--------9999999---------97013588870489995786799987274025455507


Q ss_pred             E-EEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             7-998258786899989998608989986257813132289999999731774102347888799998987654211785
Q gi|254780270|r  503 E-IIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSD  581 (820)
Q Consensus       503 e-~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~~~  581 (820)
                      - ..++.+++.+|-.    .|+--+ ++..|... ...|+++|+.. |..+|.     ..=|.|+.+|..+-..-.....
T Consensus       184 ~~~~~L~pl~~eet~----~YI~~R-L~~AG~~~-~~~Ft~~A~~~-I~~~S~-----G~PR~IN~Lc~~aLl~a~~~~~  251 (269)
T TIGR03015       184 IASCHLGPLDREETR----EYIEHR-LERAGNRD-APVFSEGAFDA-IHRFSR-----GIPRLINILCDRLLLSAFLEEK  251 (269)
T ss_pred             EEEEEECCCCHHHHH----HHHHHH-HHHCCCCC-CCCCCHHHHHH-HHHHCC-----CCHHHHHHHHHHHHHHHHHHCC
T ss_conf             679984799989999----999999-98669999-99859999999-999869-----9008999999999999999488


Q ss_pred             CEECCCHHHHHHHH
Q ss_conf             20127967867530
Q gi|254780270|r  582 TTVSINENNLQDYL  595 (820)
Q Consensus       582 ~~~~i~~~~l~~~l  595 (820)
                        -.|+.+.+.+.+
T Consensus       252 --~~I~~~~v~~~~  263 (269)
T TIGR03015       252 --REIGGEEVREVI  263 (269)
T ss_pred             --CCCCHHHHHHHH
T ss_conf             --867999999999


No 162
>CHL00095 clpC Clp protease ATP binding subunit
Probab=98.39  E-value=9.5e-06  Score=62.34  Aligned_cols=174  Identities=25%  Similarity=0.411  Sum_probs=108.0

Q ss_pred             HHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH----------CCCEEEEECCCCCCHHHHCC
Q ss_conf             20116899999999999984244467359986056565027999999770----------88249986188888888356
Q gi|254780270|r  341 HFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKAT----------GRQYVRMSLGGVYDEADIRG  410 (820)
Q Consensus       341 hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al----------~r~f~~islgg~~d~~~i~g  410 (820)
                      ..|=++==+|+++.|+=+.-|+      -||+|.||||||+|+..+|...          |+..+.+.+|.+--.+    
T Consensus       181 vIGRd~EI~r~i~IL~RR~KNN------piLvGepGVGKTAIvEGLA~rI~~g~VP~~L~~~~i~sLDl~~L~AGt----  250 (823)
T CHL00095        181 VIGRDKEIERVIQILGRRTKNN------PILIGEPGVGKTAIAEGLAQRIANRDVPDILEDKLVLTLDIGLLLAGT----  250 (823)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCC------CEEECCCCCCHHHHHHHHHHHHHCCCCCHHHCCCCEEEEEHHHHHHCC----
T ss_conf             7595699999999997732488------502379998799999999997608899868759936884288775334----


Q ss_pred             CCCCCCCCCCHH---HHHHHHHCCCCCEEEEEECHHHH-HHHC-CC--CHHHHHHHHCCCCCCCCEEEEECCCCCCCCCE
Q ss_conf             320014567128---99999832788739999331554-2311-77--11556655406001681332010352364427
Q gi|254780270|r  411 HRRTYIGSMPGR---IIQSLKRAKRSNPLLLLDEIDKM-GSDL-RG--DPSAALLEVLDPAQNSSFVDHYLEVEYDLSDV  483 (820)
Q Consensus       411 h~~ty~ga~pg~---ii~~l~~~~~~npv~~ldeidk~-~~~~-~g--dp~~allevldp~qn~~f~d~y~~~~~dls~v  483 (820)
                         .|-|..--|   |+..+++.  .|-+.++|||--+ |.+. .|  |.++-|--.|-   .-.+            ++
T Consensus       251 ---kyRGeFEeRlk~il~ei~~~--~~iILFIDEiHtlvGaG~~~g~~DaaNlLKPaLa---rGel------------~~  310 (823)
T CHL00095        251 ---KYRGEFEERIKKIMDEIKKA--NNIILVIDEIHTLIGAGAAEGAIDAANILKPALA---RGKL------------QC  310 (823)
T ss_pred             ---CCCHHHHHHHHHHHHHHHHC--CCEEEEECCHHHHCCCCCCCCCHHHHHHHHHHHH---CCCC------------EE
T ss_conf             ---22267999999999999857--9869997351653288976664317887657864---8986------------69


Q ss_pred             EEEEECCC----CCCCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHH
Q ss_conf             99993486----55441311724799825878689998999860898998625781313228999999973
Q gi|254780270|r  484 MFIMTANT----LNIPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIR  550 (820)
Q Consensus       484 ~fi~tan~----~~i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~  550 (820)
                      +--+|.+.    ..-.++|--|++.|.+.--+.+|-+.|-+. +.++.-+-|+     |.|+|+||...+.
T Consensus       311 IGATT~~EYrk~iEkD~AL~RRFq~V~V~EPs~e~t~~IL~g-l~~~yE~~H~-----V~i~d~Ai~aav~  375 (823)
T CHL00095        311 IGATTLEEYRKHIEKDPALERRFQPVYVGEPSVEETIEILLG-LRDRYEKHHN-----LSISDKALEAAAK  375 (823)
T ss_pred             EEECCHHHHHHHHHCCHHHHHHCCCCCCCCCCHHHHHHHHHH-HHHHHHHHCC-----CCCCHHHHHHHHH
T ss_conf             970788999998530588996268410289987999999999-9999987508-----8504789999999


No 163
>PRK10865 protein disaggregation chaperone; Provisional
Probab=98.39  E-value=1.1e-05  Score=61.88  Aligned_cols=178  Identities=22%  Similarity=0.368  Sum_probs=113.6

Q ss_pred             HHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHC----------CCEEEEECCCCCCHHHHC
Q ss_conf             5201168999999999999842444673599860565650279999997708----------824998618888888835
Q gi|254780270|r  340 DHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATG----------RQYVRMSLGGVYDEADIR  409 (820)
Q Consensus       340 ~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~----------r~f~~islgg~~d~~~i~  409 (820)
                      -..|=++-=+|+++.|+=+. +   +-|  ||+|.||||||.|+..+|...-          ...+.+.+|.+     +-
T Consensus       179 pvIGRd~EI~r~i~IL~RR~-K---NNp--iLvGepGVGKTAIvEGLA~rI~~g~VP~~L~~~~I~~LDlg~L-----~A  247 (857)
T PRK10865        179 PVIGRDEEIRRTIQVLQRRT-K---NNP--VLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRVLALDMGAL-----VA  247 (857)
T ss_pred             CCCCCHHHHHHHHHHHHCCC-C---CCC--EEECCCCCCHHHHHHHHHHHHHCCCCCHHHCCCCEEEEEHHHH-----HH
T ss_conf             88582999999999970257-8---997--5878999889999999999998389997881690247338878-----61


Q ss_pred             CCCCCCCCCCCHHHHHHHHHC-CCC-CEEEEEECHHHH---HHHC-CCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCE
Q ss_conf             632001456712899999832-788-739999331554---2311-7711556655406001681332010352364427
Q gi|254780270|r  410 GHRRTYIGSMPGRIIQSLKRA-KRS-NPLLLLDEIDKM---GSDL-RGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDV  483 (820)
Q Consensus       410 gh~~ty~ga~pg~ii~~l~~~-~~~-npv~~ldeidk~---~~~~-~gdp~~allevldp~qn~~f~d~y~~~~~dls~v  483 (820)
                      |-  .|-|-.-.|+-.-|... +.. |.+.++|||--+   |++- ..|.++-|--.|-   .-.+            ++
T Consensus       248 Ga--kyRGeFEeRLk~il~ev~~~~~~iILFIDEiHtlvGaG~~~G~~DaaNlLKPaLa---RGel------------r~  310 (857)
T PRK10865        248 GA--KYRGEFEERLKGVLNDLAKQEGNVILFIDELHTMVGAGKADGAMDAGNMLKPALA---RGEL------------HC  310 (857)
T ss_pred             CC--CCCHHHHHHHHHHHHHHHHCCCCEEEEECCHHHHCCCCCCCCCCCHHHHHHHHHH---CCCC------------EE
T ss_conf             47--6521179999999999984789869997343543368877775347888678873---7985------------49


Q ss_pred             EEEEECCC----CCCCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHC
Q ss_conf             99993486----554413117247998258786899989998608989986257813132289999999731
Q gi|254780270|r  484 MFIMTANT----LNIPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRL  551 (820)
Q Consensus       484 ~fi~tan~----~~i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~  551 (820)
                      +--+|...    ..-.++|--|++.|.+.--|.++-+.|-+. +.++--+-||     |.|+|+||...+.-
T Consensus       311 IGATT~~EYrk~iEkD~AL~RRFq~V~V~EPs~e~ti~ILrg-l~~~yE~hH~-----V~itdeAl~aAV~L  376 (857)
T PRK10865        311 VGATTLDEYRQYIEKDAALERRFQKVFVAEPSVEDTIAILRG-LKERYELHHH-----VQITDPAIVAAATL  376 (857)
T ss_pred             EEECCHHHHHHHCCCCHHHHHHCCCCCCCCCCHHHHHHHHHH-HHHHHHHCCC-----CEECHHHHHHHHHH
T ss_conf             994589999987134588998537100689987999999998-8889987379-----15879999999998


No 164
>KOG0726 consensus
Probab=98.38  E-value=1.7e-07  Score=75.55  Aligned_cols=168  Identities=30%  Similarity=0.485  Sum_probs=104.1

Q ss_pred             HHHHHHHHHHHCHHHHHHHHHHHHHHHHH---------CCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             89987766520116899999999999984---------244467359986056565027999999770882499861888
Q gi|254780270|r  332 FAIRILDQDHFGLEKVKERIIEYLAVQMR---------VIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGV  402 (820)
Q Consensus       332 ~a~~iLd~~hyGl~~vK~rile~lav~~~---------~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~  402 (820)
                      +|-.---.|.=||+.--+-|-|-+-.---         .+-.||-||  +|+||+|||-|||.+|+...--|.|+-    
T Consensus       178 KaP~Ety~diGGle~QiQEiKEsvELPLthPE~YeemGikpPKGVIl--yG~PGTGKTLLAKAVANqTSATFlRvv----  251 (440)
T KOG0726         178 KAPQETYADIGGLESQIQEIKESVELPLTHPEYYEEMGIKPPKGVIL--YGEPGTGKTLLAKAVANQTSATFLRVV----  251 (440)
T ss_pred             CCCHHHHCCCCCHHHHHHHHHHHHCCCCCCHHHHHHCCCCCCCEEEE--ECCCCCCHHHHHHHHHCCCCHHHHHHH----
T ss_conf             48501113442578999999986338889878999728899970588--679997536888877245521245565----


Q ss_pred             CCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCE-EEEEECHHHHHHH-C----CC--CHHHHHHHHCCCCCCCCEEEEEC
Q ss_conf             888883563200145671289999983278873-9999331554231-1----77--11556655406001681332010
Q gi|254780270|r  403 YDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNP-LLLLDEIDKMGSD-L----RG--DPSAALLEVLDPAQNSSFVDHYL  474 (820)
Q Consensus       403 ~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~np-v~~ldeidk~~~~-~----~g--dp~~allevldp~qn~~f~d~y~  474 (820)
                        .+|+.   .-|.|--|-..-|-.+-|+..-| ++++||||-+|.- |    .|  ...-.|||+|.  |-..|-+.  
T Consensus       252 --GseLi---QkylGdGpklvRqlF~vA~e~apSIvFiDEIdAiGtKRyds~SggerEiQrtmLELLN--QldGFdsr--  322 (440)
T KOG0726         252 --GSELI---QKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLN--QLDGFDSR--  322 (440)
T ss_pred             --HHHHH---HHHHCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCCCCCHHHHHHHHHHHHHH--HCCCCCCC--
T ss_conf             --08999---9873655199999998887529826986400110452134788507899999999987--42686656--


Q ss_pred             CCCCCCCCEEEEEECCCCC-CCHHH-----CCCEEEEEECCCCHHHHHHHHHHH
Q ss_conf             3523644279999348655-44131-----172479982587868999899986
Q gi|254780270|r  475 EVEYDLSDVMFIMTANTLN-IPLPL-----MDRMEIIRIAGYTEEEKLQIAKNH  522 (820)
Q Consensus       475 ~~~~dls~v~fi~tan~~~-i~~~l-----~drme~i~~~~y~~~ek~~i~~~~  522 (820)
                            .+|-.|..-|-++ ..++|     .||-  |+++---..-|..|+.-|
T Consensus       323 ------gDvKvimATnrie~LDPaLiRPGrIDrK--Ief~~pDe~TkkkIf~IH  368 (440)
T KOG0726         323 ------GDVKVIMATNRIETLDPALIRPGRIDRK--IEFPLPDEKTKKKIFQIH  368 (440)
T ss_pred             ------CCEEEEEECCCCCCCCHHHCCCCCCCCC--CCCCCCCHHHHCEEEEEE
T ss_conf             ------7758997416534467755278754311--125797556323156875


No 165
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB. Members of this protein family are the bacterial ATP-dependent chaperone ClpB. This protein belongs to the AAA family, ATPases associated with various cellular activities (pfam00004). This molecular chaperone does not act as a protease, but rather serves to disaggregate misfolded and aggregated proteins.
Probab=98.36  E-value=1.2e-05  Score=61.46  Aligned_cols=180  Identities=22%  Similarity=0.387  Sum_probs=112.7

Q ss_pred             HHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH----------CCCEEEEECCCCCCHHHHC
Q ss_conf             520116899999999999984244467359986056565027999999770----------8824998618888888835
Q gi|254780270|r  340 DHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKAT----------GRQYVRMSLGGVYDEADIR  409 (820)
Q Consensus       340 ~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al----------~r~f~~islgg~~d~~~i~  409 (820)
                      -..|-++-=+|+++.|+=+. +++   |  ||+|.||||||.|+..+|.-.          |...+.+.+|.+--.+   
T Consensus       174 pviGRd~Ei~r~i~IL~Rr~-KNN---p--iLVGepGVGKTAIvEGLA~rI~~g~VP~~L~~~~i~~LDlg~LvAGt---  244 (852)
T TIGR03346       174 PVIGRDEEIRRTIQVLSRRT-KNN---P--VLIGEPGVGKTAIVEGLAQRIVNGDVPESLKNKRLLALDMGALIAGA---  244 (852)
T ss_pred             CCCCCHHHHHHHHHHHHHHC-CCC---C--CEECCCCCCHHHHHHHHHHHHHCCCCCHHHHHCCCEEEEHHHHHCCC---
T ss_conf             77383699999999998732-489---7--21279998799999999999866999978851851275288775215---


Q ss_pred             CCCCCCCCCCCHHHHHHHHHCCC-C-CEEEEEECHHHH-HHHC-CC--CHHHHHHHHCCCCCCCCEEEEECCCCCCCCCE
Q ss_conf             63200145671289999983278-8-739999331554-2311-77--11556655406001681332010352364427
Q gi|254780270|r  410 GHRRTYIGSMPGRIIQSLKRAKR-S-NPLLLLDEIDKM-GSDL-RG--DPSAALLEVLDPAQNSSFVDHYLEVEYDLSDV  483 (820)
Q Consensus       410 gh~~ty~ga~pg~ii~~l~~~~~-~-npv~~ldeidk~-~~~~-~g--dp~~allevldp~qn~~f~d~y~~~~~dls~v  483 (820)
                          .|-|-.-.|+-.-+..... . |-++++|||--+ |.+. .|  |.++    +|.|.--..        .+   ++
T Consensus       245 ----kyRGeFEeRlk~ii~ev~~~~~~iILFIDEiHtliGaG~~~G~~DAaN----lLKPaLarG--------el---r~  305 (852)
T TIGR03346       245 ----KYRGEFEERLKAVLNEVTKSEGQIILFIDELHTLVGAGKAEGAMDAGN----MLKPALARG--------EL---HC  305 (852)
T ss_pred             ----CCCHHHHHHHHHHHHHHHHCCCCEEEEEHHHHHHCCCCCCCCCCCHHH----HHHHHHHCC--------CC---EE
T ss_conf             ----300789999999999998589987999612555326887666410677----743787479--------85---59


Q ss_pred             EEEEECCC----CCCCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCC
Q ss_conf             99993486----55441311724799825878689998999860898998625781313228999999973177
Q gi|254780270|r  484 MFIMTANT----LNIPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFT  553 (820)
Q Consensus       484 ~fi~tan~----~~i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt  553 (820)
                      +-.+|...    ..-.++|--|++.|.+.--+.++-+.|-+. +.|+--.-|     .|.++|+||...++-..
T Consensus       306 IgATT~~EYrk~iEkD~AL~RRFq~I~V~EPs~e~t~~IL~g-l~~~yE~hH-----~V~i~d~Ai~aav~LS~  373 (852)
T TIGR03346       306 IGATTLDEYRKYIEKDAALERRFQPVFVDEPTVEDTISILRG-LKERYEVHH-----GVRITDPAIVAAATLSH  373 (852)
T ss_pred             EEECCHHHHHHHHHCCHHHHHHCCCCCCCCCCHHHHHHHHHH-HHHHHHHCC-----CCEECHHHHHHHHHHHC
T ss_conf             982789999988322688997377120479986899999997-699997627-----92673999999999713


No 166
>KOG0735 consensus
Probab=98.34  E-value=1.2e-05  Score=61.71  Aligned_cols=205  Identities=28%  Similarity=0.412  Sum_probs=120.9

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHH-------CCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCC
Q ss_conf             6520116899999999999984-------244467359986056565027999999770882499861888888883563
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQMR-------VIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGH  411 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~~~-------~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh  411 (820)
                      +|.-||.++|+-+.|.+---..       .+-....-++|+||||+|||-||..||..-+-.|  ||+-|-    |+-  
T Consensus       667 ~digg~~~~k~~l~~~i~~P~kyp~if~~~plr~~~giLLyGppGcGKT~la~a~a~~~~~~f--isvKGP----ElL--  738 (952)
T KOG0735         667 EDIGGLFEAKKVLEEVIEWPSKYPQIFANCPLRLRTGILLYGPPGCGKTLLASAIASNSNLRF--ISVKGP----ELL--  738 (952)
T ss_pred             EECCCHHHHHHHHHHHHHCCCCCHHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHHHCCEEE--EEECCH----HHH--
T ss_conf             003358999999999985541036788608866655458877999857888888885378059--982588----999--


Q ss_pred             CCCCCCCCCHHHHHHHHHCCCCC-EEEEEECHHHHHH----HCCC--C-HHHHHHHHCCCCCCCCEEEEECCCCCCCCCE
Q ss_conf             20014567128999998327887-3999933155423----1177--1-1556655406001681332010352364427
Q gi|254780270|r  412 RRTYIGSMPGRIIQSLKRAKRSN-PLLLLDEIDKMGS----DLRG--D-PSAALLEVLDPAQNSSFVDHYLEVEYDLSDV  483 (820)
Q Consensus       412 ~~ty~ga~pg~ii~~l~~~~~~n-pv~~ldeidk~~~----~~~g--d-p~~allevldp~qn~~f~d~y~~~~~dls~v  483 (820)
                       --|+||----+-.-..+|...- ++.++||.|-+..    |..|  | ..+-||.-||-            +.- |-.|
T Consensus       739 -~KyIGaSEq~vR~lF~rA~~a~PCiLFFDEfdSiAPkRGhDsTGVTDRVVNQlLTelDG------------~Eg-l~GV  804 (952)
T KOG0735         739 -SKYIGASEQNVRDLFERAQSAKPCILFFDEFDSIAPKRGHDSTGVTDRVVNQLLTELDG------------AEG-LDGV  804 (952)
T ss_pred             -HHHHCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHCC------------CCC-CCEE
T ss_conf             -98745007889999998651497489712102437666877777429999999876036------------334-4538


Q ss_pred             EEEEECCCC-C-CCHHH-----CCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCC
Q ss_conf             999934865-5-44131-----1724799825878689998999860898998625781313228999999973177410
Q gi|254780270|r  484 MFIMTANTL-N-IPLPL-----MDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEA  556 (820)
Q Consensus       484 ~fi~tan~~-~-i~~~l-----~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~Ea  556 (820)
                       ||..|-+- + |+++|     +||.  +.-+--+..|.++|.+.      +...-+.+..+.+  +-+...-..||   
T Consensus       805 -~i~aaTsRpdliDpALLRpGRlD~~--v~C~~P~~~eRl~il~~------ls~s~~~~~~vdl--~~~a~~T~g~t---  870 (952)
T KOG0735         805 -YILAATSRPDLIDPALLRPGRLDKL--VYCPLPDEPERLEILQV------LSNSLLKDTDVDL--ECLAQKTDGFT---  870 (952)
T ss_pred             -EEEEECCCCCCCCHHHCCCCCCCEE--EECCCCCCHHHHHHHHH------HHHCCCCCCCCCH--HHHHHHCCCCC---
T ss_conf             -9997337834367766288765401--56799892899999999------8534577521016--88765217873---


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             234788879999898765421178
Q gi|254780270|r  557 GVRSFERALMKIARKAVTKIVKNS  580 (820)
Q Consensus       557 GvR~l~r~i~~i~r~~~~~~~~~~  580 (820)
                      | -+|+-.+..-.-+++.+++...
T Consensus       871 g-ADlq~ll~~A~l~avh~~l~~~  893 (952)
T KOG0735         871 G-ADLQSLLYNAQLAAVHEILKRE  893 (952)
T ss_pred             H-HHHHHHHHHHHHHHHHHHHHHC
T ss_conf             6-6599898777999999999863


No 167
>PRK05917 DNA polymerase III subunit delta'; Validated
Probab=98.33  E-value=3e-06  Score=66.09  Aligned_cols=125  Identities=17%  Similarity=0.158  Sum_probs=80.0

Q ss_pred             HCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHH--HHCCCCCCCCC--CCCH-----HHHHHHHHC
Q ss_conf             42444673599860565650279999997708824998618888888--83563200145--6712-----899999832
Q gi|254780270|r  360 RVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEA--DIRGHRRTYIG--SMPG-----RIIQSLKRA  430 (820)
Q Consensus       360 ~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~--~i~gh~~ty~g--a~pg-----~ii~~l~~~  430 (820)
                      .+.+.-+.-++|.||+|+||+++|..+|++|--.      +.-....  .=+-|--.|.-  .--|     ..++.+++.
T Consensus        13 i~~~Rl~HAyLf~Gp~G~GK~~~A~~~A~~LLc~------~~p~~~~~i~~~~HPD~~~i~pe~k~~~~~Id~iR~l~~~   86 (290)
T PRK05917         13 VRDQKVPSAILLHGQDLSNLSQYAYELASLILLE------SSPEAQYKISQKIHPDIHEFFPEGKGRLHSIETPRAIKKQ   86 (290)
T ss_pred             HHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHCC------CCCCHHHHHHHCCCCCEEEECCCCCCCCCCHHHHHHHHHH
T ss_conf             9839966068768999865999999999998578------9961688987468998599615777887867899999999


Q ss_pred             ------CCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHHHCCCEE
Q ss_conf             ------788739999331554231177115566554060016813320103523644279999348655-4413117247
Q gi|254780270|r  431 ------KRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLPLMDRME  503 (820)
Q Consensus       431 ------~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~drme  503 (820)
                            ....=|+++|+.|+|+.    .-++|||-.|.             -|-  ++++||.++++.+ +++.++.|--
T Consensus        87 i~~~p~~g~~KV~IId~Ad~Mn~----~AaNALLKtLE-------------EPP--~~tvfILit~~~~~lLpTI~SRCQ  147 (290)
T PRK05917         87 IWIHPYEANYKIYIIHEADRMTL----DAISAFLKVLE-------------DPP--KHSVIILTSAKPQRLPPTIRSRSL  147 (290)
T ss_pred             HCCCCCCCCCEEEEECCHHHHCH----HHHHHHHHHHC-------------CCC--CCEEEEEEECCHHHCCHHHHHCCC
T ss_conf             64186468826999756776389----99999999734-------------798--785999986992548237763351


Q ss_pred             EEEECC
Q ss_conf             998258
Q gi|254780270|r  504 IIRIAG  509 (820)
Q Consensus       504 ~i~~~~  509 (820)
                      .|+++.
T Consensus       148 ~I~i~~  153 (290)
T PRK05917        148 SIHIPG  153 (290)
T ss_pred             EEECCC
T ss_conf             167776


No 168
>PRK04132 replication factor C small subunit; Provisional
Probab=98.27  E-value=1.1e-06  Score=69.30  Aligned_cols=98  Identities=17%  Similarity=0.215  Sum_probs=69.0

Q ss_pred             CCCEEEEEECCCCC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHH
Q ss_conf             44279999348655-44131172479982587868999899986089899862578131322899999997317741023
Q gi|254780270|r  480 LSDVMFIMTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGV  558 (820)
Q Consensus       480 ls~v~fi~tan~~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGv  558 (820)
                      .+++.||.++|+.+ |-+|+..|.-+...++-+.++-..        ++ +.. .+.+.+.+++++++.|+.  +-+.-+
T Consensus       673 ~~~~~~~~SCNYsSKIIePIQSRCavFRF~PL~~e~v~~--------RL-~~I-a~~Egv~itedGleAI~~--~aeGDM  740 (863)
T PRK04132        673 IANGFVSHNCNYSSKIIEPIQSRCAIFRFRPLRDEDIAK--------RL-RYI-AENEGLELTEEGLQAILY--VAEGDM  740 (863)
T ss_pred             HCCCEEEEECCCCCCCCCHHHCCEEEEEECCCCHHHHHH--------HH-HHH-HHHCCCCCCHHHHHHHHH--HCCCCH
T ss_conf             205617986676040741665562478836899999999--------99-999-997499767789999999--756748


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHCCCCC
Q ss_conf             478887999989876542117852012796786753052000
Q gi|254780270|r  559 RSFERALMKIARKAVTKIVKNSDTTVSINENNLQDYLGVPRY  600 (820)
Q Consensus       559 R~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~lg~~~~  600 (820)
                      |+   .|+.+-...+        ..-.||.+++.+..|.|+-
T Consensus       741 Rk---AIN~LQsaa~--------~~~~Vt~d~Vy~v~~~p~P  771 (863)
T PRK04132        741 RR---AINVLQAAAA--------LDTKITDENVFKVASRARP  771 (863)
T ss_pred             HH---HHHHHHHHHH--------CCCCCCHHHHHHHCCCCCH
T ss_conf             99---9999999986--------1698788899997089998


No 169
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Members of this protein family are homologs of ClpB, an ATPase associated with chaperone-related functions. These ClpB homologs, designated ClpV1, are a key component of the bacterial pathogenicity-associated type VI secretion system.
Probab=98.24  E-value=2.1e-05  Score=59.79  Aligned_cols=179  Identities=20%  Similarity=0.350  Sum_probs=111.3

Q ss_pred             HHHHHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH----------CCCEEEEECCCCCCH
Q ss_conf             7766520116899999999999984244467359986056565027999999770----------882499861888888
Q gi|254780270|r  336 ILDQDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKAT----------GRQYVRMSLGGVYDE  405 (820)
Q Consensus       336 iLd~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al----------~r~f~~islgg~~d~  405 (820)
                      .|| -..|=++-=+|+++.|+=+.-|+    |  ||+|.||||||.|+..+|.-.          |...+.+.||.+--.
T Consensus       185 klD-PvIGRd~EI~r~iqIL~Rr~KNN----P--iLVGepGVGKTAIvEGLA~rI~~g~VP~~L~~~~i~sLDlg~LvAG  257 (852)
T TIGR03345       185 KID-PVLGRDDEIRQMIDILLRRRQNN----P--ILTGEAGVGKTAVVEGLALRIAAGDVPPALRNVRLLSLDLGLLQAG  257 (852)
T ss_pred             CCC-CCCCCHHHHHHHHHHHHHHCCCC----C--EEECCCCCCHHHHHHHHHHHHHCCCCCHHHHCCEEEEEEHHHHHHC
T ss_conf             999-88694999999999998624799----7--4657999879999999999997699986774385678678888640


Q ss_pred             HHHCCCCCCCCCCCCHHHHHHHHHC-CCCCEE-EEEECHHHH-HH--HCC-CCHHHHHHHHCCCCCC-CCEEEEECCCCC
Q ss_conf             8835632001456712899999832-788739-999331554-23--117-7115566554060016-813320103523
Q gi|254780270|r  406 ADIRGHRRTYIGSMPGRIIQSLKRA-KRSNPL-LLLDEIDKM-GS--DLR-GDPSAALLEVLDPAQN-SSFVDHYLEVEY  478 (820)
Q Consensus       406 ~~i~gh~~ty~ga~pg~ii~~l~~~-~~~npv-~~ldeidk~-~~--~~~-gdp~~allevldp~qn-~~f~d~y~~~~~  478 (820)
                      +       .|-|..--|+-..|... ...|++ .++|||--+ |.  +-. +|.++-    |-|.-- -.+         
T Consensus       258 t-------kyRGeFEeRlk~ii~ei~~~~~~iILFIDEiHtlvGAG~~~G~~DaaNi----LKPaLarGel---------  317 (852)
T TIGR03345       258 A-------SVKGEFENRLKSVIDEVKASPQPIILFIDEAHTLIGAGGQAGQGDAANL----LKPALARGEL---------  317 (852)
T ss_pred             C-------CCCCHHHHHHHHHHHHHHHCCCCEEEEEEHHHHHCCCCCCCCCCCHHHH----HHHHHHCCCC---------
T ss_conf             3-------5763599999999999984899769996348775289988886227887----5178737873---------


Q ss_pred             CCCCEEEEEECCC----CCCCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHH
Q ss_conf             6442799993486----55441311724799825878689998999860898998625781313228999999973
Q gi|254780270|r  479 DLSDVMFIMTANT----LNIPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIR  550 (820)
Q Consensus       479 dls~v~fi~tan~----~~i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~  550 (820)
                         +++--+|...    ..-+++|--|++.|.+.--|.+|-+.|-+. |-++--.-|     .|.|+|+||...+.
T Consensus       318 ---r~IGATT~~EYrk~iEkD~AL~RRFq~V~V~EPs~eeti~IL~g-lk~~yE~hH-----~V~i~d~Ai~aAv~  384 (852)
T TIGR03345       318 ---RTIAATTWAEYKKYFEKDPALTRRFQVVKVEEPDEETAIRMLRG-LAPVLEKHH-----GVLILDEAVVAAVE  384 (852)
T ss_pred             ---EEEEECCHHHHHHHHHCCHHHHHHCCCCCCCCCCHHHHHHHHHH-HHHHHHHCC-----CEEEEHHHHHHHHH
T ss_conf             ---49983578999888642688996247552799987999999998-799985547-----96870899999999


No 170
>PRK09087 hypothetical protein; Validated
Probab=98.22  E-value=0.00012  Score=54.10  Aligned_cols=173  Identities=17%  Similarity=0.278  Sum_probs=104.2

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEEC
Q ss_conf             44467359986056565027999999770882499861888888883563200145671289999983278873999933
Q gi|254780270|r  362 IKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDE  441 (820)
Q Consensus       362 ~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~lde  441 (820)
                      ++-..+.++|+||+|.|||.|+...++.-+-.+.  .      .+.+           ...+...     ..+..+++|.
T Consensus        40 ~~w~~~~~~L~Gp~gsGKTHL~~~~~~~~~a~~~--~------~~~~-----------~~~~~~~-----~~~~~~~idd   95 (226)
T PRK09087         40 PNWPSPVVVLAGPVGSGKTHLASIWREKADALLV--H------PNEI-----------GSDAANA-----AAERPVLIED   95 (226)
T ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHCCEEE--C------HHHC-----------CHHHHHH-----HCCCCEEEEC
T ss_conf             2677775899899999886999999998099683--6------6874-----------7466765-----3279889974


Q ss_pred             HHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCC----CCCCHH-HCCC---EEEEEECCCCHH
Q ss_conf             15542311771155665540600168133201035236442799993486----554413-1172---479982587868
Q gi|254780270|r  442 IDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANT----LNIPLP-LMDR---MEIIRIAGYTEE  513 (820)
Q Consensus       442 idk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~----~~i~~~-l~dr---me~i~~~~y~~~  513 (820)
                      +|+.+-+     .-+|.++..--+.              ++.-.+.|++.    +++--| |+.|   +-++++..-..+
T Consensus        96 ~d~~~~d-----Ee~LFhl~N~~~~--------------~~~~LLlts~~~p~~l~~~L~DL~SRL~~~~~~~I~~pdD~  156 (226)
T PRK09087         96 IDAGGFD-----ETGLFHLINSVRQ--------------AGTSLLMTSRLWPSAWNVKLPDLKSRLKAATVVEIGEPDDA  156 (226)
T ss_pred             CCCCCCC-----HHHHHHHHHHHHH--------------CCCEEEEECCCCHHHCCCCCHHHHHHHHCCEEEEECCCCHH
T ss_conf             8777747-----8999999999985--------------39879998898956667624689999857857983599989


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHH
Q ss_conf             99989998608989986257813132289999999731774102347888799998987654211785201279678675
Q gi|254780270|r  514 EKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDTTVSINENNLQD  593 (820)
Q Consensus       514 ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~  593 (820)
                      .+..+..++          +..-++.++++++.||+.+..|.  ...+...+.++=+..-.       .+-.||...+.+
T Consensus       157 ll~~~L~k~----------~~~r~l~l~~~v~~yll~r~~Rs--~~~l~~~l~~LD~~SL~-------~kr~ITiplike  217 (226)
T PRK09087        157 LLSGVIFKL----------FADRQLYVEPHVVYYLVSRMERS--LFAAQTIVERLDRLALE-------RKSRITRALAAE  217 (226)
T ss_pred             HHHHHHHHH----------HHHCCCCCCHHHHHHHHHHCCCC--HHHHHHHHHHHHHHHHH-------CCCCCCHHHHHH
T ss_conf             999999999----------87576578888999999845889--99999999999999998-------189998999999


Q ss_pred             HHC
Q ss_conf             305
Q gi|254780270|r  594 YLG  596 (820)
Q Consensus       594 ~lg  596 (820)
                      .|.
T Consensus       218 vL~  220 (226)
T PRK09087        218 VLN  220 (226)
T ss_pred             HHH
T ss_conf             998


No 171
>PRK05707 DNA polymerase III subunit delta'; Validated
Probab=98.22  E-value=4.7e-05  Score=57.07  Aligned_cols=133  Identities=15%  Similarity=0.222  Sum_probs=81.3

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHCCCEE--EEECCCCCCHHHHCC--CC-CCCCCCCC-H---------HHHHHHHHC
Q ss_conf             735998605656502799999977088249--986188888888356--32-00145671-2---------899999832
Q gi|254780270|r  366 GLILCFVGPPGVGKTSLAQSIAKATGRQYV--RMSLGGVYDEADIRG--HR-RTYIGSMP-G---------RIIQSLKRA  430 (820)
Q Consensus       366 g~il~l~gppgvGKts~~~sia~al~r~f~--~islgg~~d~~~i~g--h~-~ty~ga~p-g---------~ii~~l~~~  430 (820)
                      +-.+.|+||+|+||+++|+..|++|.=.--  --+.|-.+.---+..  |- ..++-... |         .+++.+...
T Consensus        22 ~HA~Lf~G~~G~GK~~lA~~~A~~LlC~~~~~~~~Cg~C~sC~~~~~~~HPD~~~i~pe~~~~~I~IdqIR~l~~~~~~~  101 (328)
T PRK05707         22 AHAYLLHGPAGIGKRALAERLAAFLLCEAPQGGGACGSCKGCQLLAAGSHPDNFVLEPEEADKPIKVDQVRELVSFVVQT  101 (328)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHC
T ss_conf             20464479998679999999999984899999899988889999875899987998426667769799999999998317


Q ss_pred             --CCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHHHCCCEEEEEE
Q ss_conf             --788739999331554231177115566554060016813320103523644279999348655-44131172479982
Q gi|254780270|r  431 --KRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLPLMDRMEIIRI  507 (820)
Q Consensus       431 --~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~drme~i~~  507 (820)
                        ...+=|+++|+.|+|+..    -++|||-.|.             -|=  .+++||..+++.+ +++.++.|--.+.+
T Consensus       102 ~~~g~~KV~iI~~Ae~m~~~----AaNALLKtLE-------------EPp--~~t~fiL~t~~~~~lLpTI~SRCq~~~~  162 (328)
T PRK05707        102 AQLGGRKVVLIEPAEAMNRN----AANALLKSLE-------------EPS--GQTVLLLISHQPSRLLPTIKSRCQQLAC  162 (328)
T ss_pred             CCCCCCEEEEEEHHHHHCHH----HHHHHHHHHH-------------CCC--CCEEEEEEECCHHHCHHHHHHCCEEEEC
T ss_conf             66789579995028773899----9999999850-------------789--8759998609934482588741413348


Q ss_pred             CCCCHHHHHH
Q ss_conf             5878689998
Q gi|254780270|r  508 AGYTEEEKLQ  517 (820)
Q Consensus       508 ~~y~~~ek~~  517 (820)
                      +.-..++-..
T Consensus       163 ~~p~~e~~~~  172 (328)
T PRK05707        163 PLPSNEPSLQ  172 (328)
T ss_pred             CCCCHHHHHH
T ss_conf             9989999999


No 172
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms]
Probab=98.22  E-value=1.7e-05  Score=60.52  Aligned_cols=173  Identities=24%  Similarity=0.381  Sum_probs=118.6

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCC---CEEEEECCCCCC---HHHHCCCCCC-CCC---CCCHHHHHHHHHCCCC
Q ss_conf             46735998605656502799999977088---249986188888---8883563200-145---6712899999832788
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGR---QYVRMSLGGVYD---EADIRGHRRT-YIG---SMPGRIIQSLKRAKRS  433 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r---~f~~islgg~~d---~~~i~gh~~t-y~g---a~pg~ii~~l~~~~~~  433 (820)
                      +..++ ++.|--||||--+|+.|.+--.|   ||+.+.++-+-.   |||+=||.+- +-|   .-+||+=-      ..
T Consensus       245 Sd~tV-Li~GETGtGKElvAraIH~~S~R~~kPfV~~NCAAlPesLlESELFGHeKGAFTGA~~~r~GrFEl------Ad  317 (550)
T COG3604         245 SDSTV-LIRGETGTGKELVARAIHQLSPRRDKPFVKLNCAALPESLLESELFGHEKGAFTGAINTRRGRFEL------AD  317 (550)
T ss_pred             CCCEE-EEECCCCCCHHHHHHHHHHHCCCCCCCCEEEECCCCCHHHHHHHHHCCCCCCCCCCHHCCCCCEEE------CC
T ss_conf             89807-984588853899999998737555798666312225378888887453322333510146763565------57


Q ss_pred             CEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEE----EEECCCCCCCCCEEEEEECC-CC----------------
Q ss_conf             7399993315542311771155665540600168133----20103523644279999348-65----------------
Q gi|254780270|r  434 NPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFV----DHYLEVEYDLSDVMFIMTAN-TL----------------  492 (820)
Q Consensus       434 npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~----d~y~~~~~dls~v~fi~tan-~~----------------  492 (820)
                      +.-.+||||.-|.-.++    +.||-||   |+..|.    |+-  +.+   +|=.||--| |+                
T Consensus       318 GGTLFLDEIGelPL~lQ----aKLLRvL---QegEieRvG~~r~--ikV---DVRiIAATNRDL~~~V~~G~FRaDLYyR  385 (550)
T COG3604         318 GGTLFLDEIGELPLALQ----AKLLRVL---QEGEIERVGGDRT--IKV---DVRVIAATNRDLEEMVRDGEFRADLYYR  385 (550)
T ss_pred             CCEEECHHHCCCCHHHH----HHHHHHH---HHCCEEECCCCCE--EEE---EEEEEECCCHHHHHHHHCCCCHHHHHHC
T ss_conf             97576022036787788----9999998---6365253479963--677---7899821353099998749515545321


Q ss_pred             ----C-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             ----5-44131172479982587868999899986089899862578131322899999997317741023478887999
Q gi|254780270|r  493 ----N-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMK  567 (820)
Q Consensus       493 ----~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~  567 (820)
                          . .-+||+.|=           |-+-.--.|.+-+..+++|.  ..+.|+.+|++. +.+|..-.-||+||-.+..
T Consensus       386 LsV~Pl~lPPLRER~-----------~DIplLA~~Fle~~~~~~gr--~~l~ls~~Al~~-L~~y~wPGNVRELen~veR  451 (550)
T COG3604         386 LSVFPLELPPLRERP-----------EDIPLLAGYFLEKFRRRLGR--AILSLSAEALEL-LSSYEWPGNVRELENVVER  451 (550)
T ss_pred             CCCCCCCCCCCCCCC-----------CCHHHHHHHHHHHHHHHCCC--CCCCCCHHHHHH-HHCCCCCCCHHHHHHHHHH
T ss_conf             020013789834588-----------66799999999999886397--640339899999-9739999719999989999


Q ss_pred             HH
Q ss_conf             98
Q gi|254780270|r  568 IA  569 (820)
Q Consensus       568 i~  569 (820)
                      -+
T Consensus       452 av  453 (550)
T COG3604         452 AV  453 (550)
T ss_pred             HH
T ss_conf             99


No 173
>KOG0741 consensus
Probab=98.21  E-value=2e-05  Score=59.91  Aligned_cols=164  Identities=27%  Similarity=0.433  Sum_probs=102.1

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHC---------CCC
Q ss_conf             44673599860565650279999997708824998618888888835632001456712899999832---------788
Q gi|254780270|r  363 KNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRA---------KRS  433 (820)
Q Consensus       363 ~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~---------~~~  433 (820)
                      .+||  |+|+||||+|||-+|+-|.+-||-+=-+|-=     .-||--   -|||.----|=.-...|         .+.
T Consensus       255 HVKG--iLLyGPPGTGKTLiARqIGkMLNArePKIVN-----GPeIL~---KYVGeSE~NvR~LFaDAEeE~r~~g~~Sg  324 (744)
T KOG0741         255 HVKG--ILLYGPPGTGKTLIARQIGKMLNAREPKIVN-----GPEILN---KYVGESEENVRKLFADAEEEQRRLGANSG  324 (744)
T ss_pred             CEEE--EEEECCCCCCHHHHHHHHHHHHCCCCCCCCC-----CHHHHH---HHHCCCHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             1235--7887799987018999987874579986347-----578898---76063078899998757999984376677


Q ss_pred             CEEEEEECHHHHHHH--C-CC-----C-HHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHHHC--CC
Q ss_conf             739999331554231--1-77-----1-15566554060016813320103523644279999348655-441311--72
Q gi|254780270|r  434 NPLLLLDEIDKMGSD--L-RG-----D-PSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLPLM--DR  501 (820)
Q Consensus       434 npv~~ldeidk~~~~--~-~g-----d-p~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~--dr  501 (820)
                      =-+|++||||-+-..  . .|     | ..+-||--.|-            | =-|.++|.|---|-.+ |+.+|+  -|
T Consensus       325 LHIIIFDEiDAICKqRGS~~g~TGVhD~VVNQLLsKmDG------------V-eqLNNILVIGMTNR~DlIDEALLRPGR  391 (744)
T KOG0741         325 LHIIIFDEIDAICKQRGSMAGSTGVHDTVVNQLLSKMDG------------V-EQLNNILVIGMTNRKDLIDEALLRPGR  391 (744)
T ss_pred             CEEEEEHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCC------------H-HHHHCEEEEECCCCHHHHHHHHCCCCC
T ss_conf             259996346799974488789886318999999985322------------8-766167899404736667887558871


Q ss_pred             EEE-EEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCC
Q ss_conf             479-9825878689998999860898998625781313228999999973177
Q gi|254780270|r  502 MEI-IRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFT  553 (820)
Q Consensus       502 me~-i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt  553 (820)
                      +|| .|++=--.+-.++|.+-|  .+-+++|++-..+|.+.+  |..+-++|+
T Consensus       392 lEVqmEIsLPDE~gRlQIl~IH--T~rMre~~~l~~dVdl~e--lA~lTKNfS  440 (744)
T KOG0741         392 LEVQMEISLPDEKGRLQILKIH--TKRMRENNKLSADVDLKE--LAALTKNFS  440 (744)
T ss_pred             EEEEEEEECCCCCCCEEEEEHH--HHHHHHCCCCCCCCCHHH--HHHHHCCCC
T ss_conf             6999998468876727888714--455665178777769899--999855786


No 174
>KOG0732 consensus
Probab=98.21  E-value=1.1e-05  Score=61.83  Aligned_cols=356  Identities=20%  Similarity=0.251  Sum_probs=174.7

Q ss_pred             HHHCHHHHHHHHHHHHHHHHHCCCCC-------CCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCC
Q ss_conf             52011689999999999998424446-------73599860565650279999997708824998618888888835632
Q gi|254780270|r  340 DHFGLEKVKERIIEYLAVQMRVIKNK-------GLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHR  412 (820)
Q Consensus       340 ~hyGl~~vK~rile~lav~~~~~~~~-------g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~  412 (820)
                      +.=||+.++...=|+...--+-|...       .--.+|.||||+|||+.|+..|.+.-+...+||.= +++.|+.-+  
T Consensus       266 ~vggl~~~i~~LKEmVl~PLlyPE~f~~~~itpPrgvL~~GppGTGkTl~araLa~~~s~~~~kisff-mrkgaD~ls--  342 (1080)
T KOG0732         266 SVGGLENYINQLKEMVLLPLLYPEFFDNFNITPPRGVLFHGPPGTGKTLMARALAAACSRGNRKISFF-MRKGADCLS--  342 (1080)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCCHHHHHHHHHHHHCCCCCCCCHH-HHCCCHHHC--
T ss_conf             33457888999999887676405676412668986323028998725688886665405411020244-314844332--


Q ss_pred             CCCCCCCCHHHHHHHHHCCCCCE-EEEEECHHHHHH---H----CCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEE
Q ss_conf             00145671289999983278873-999933155423---1----177115566554060016813320103523644279
Q gi|254780270|r  413 RTYIGSMPGRIIQSLKRAKRSNP-LLLLDEIDKMGS---D----LRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVM  484 (820)
Q Consensus       413 ~ty~ga~pg~ii~~l~~~~~~np-v~~ldeidk~~~---~----~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~  484 (820)
                       -|||----..-.....|.-+-| +|++||||-+..   +    .+--..|.||-++|---            - -++|.
T Consensus       343 -kwvgEaERqlrllFeeA~k~qPSIIffdeIdGlapvrSskqEqih~SIvSTLLaLmdGld------------s-RgqVv  408 (1080)
T KOG0732         343 -KWVGEAERQLRLLFEEAQKTQPSIIFFDEIDGLAPVRSSKQEQIHASIVSTLLALMDGLD------------S-RGQVV  408 (1080)
T ss_pred             -CCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCC------------C-CCCEE
T ss_conf             -544757788998898874448517730555664656536677744567777887604777------------7-78658


Q ss_pred             EEEECCCCC-CCHHHC-----CCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHH
Q ss_conf             999348655-441311-----72479982587868999899986089899862578131322899999997317741023
Q gi|254780270|r  485 FIMTANTLN-IPLPLM-----DRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGV  558 (820)
Q Consensus       485 fi~tan~~~-i~~~l~-----drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGv  558 (820)
                      -|..-|..+ +.++|+     ||-.-.-+++--.  ..+         ++.-+..+.. =.++...+..+-+. |-.-|=
T Consensus       409 vigATnRpda~dpaLRRPgrfdref~f~lp~~~a--r~~---------Il~Ihtrkw~-~~i~~~l~~~la~~-t~gy~g  475 (1080)
T KOG0732         409 VIGATNRPDAIDPALRRPGRFDREFYFPLPDVDA--RAK---------ILDIHTRKWE-PPISRELLLWLAEE-TSGYGG  475 (1080)
T ss_pred             EECCCCCCCCCCHHHCCCCCCCEEEEEECCCHHH--HHH---------HHHHHCCCCC-CCCCHHHHHHHHHH-CCCCCH
T ss_conf             9715678332465442886665257503786678--889---------9987515777-88777899999886-234005


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCC-------CEECCCHHHH----HHHHCC-CCC-----CCCCHHCCCCC-CCCCEEEEC
Q ss_conf             47888799998987654211785-------2012796786----753052-000-----33200022336-500000000
Q gi|254780270|r  559 RSFERALMKIARKAVTKIVKNSD-------TTVSINENNL----QDYLGV-PRY-----KYGKIEGEDQV-GIVTGLAWT  620 (820)
Q Consensus       559 R~l~r~i~~i~r~~~~~~~~~~~-------~~~~i~~~~l----~~~lg~-~~~-----~~~~~~~~~~~-G~v~GLa~t  620 (820)
                          ..|..+|-.+|+..+...-       ....+....+    .+++-. ++.     ....+...|.. ++.- |.  
T Consensus       476 ----aDlkaLCTeAal~~~~r~~Pq~y~s~~kl~~d~~~ikV~~~~f~~A~~~i~ps~~R~~~~~s~Pl~~~~~~-ll--  548 (1080)
T KOG0732         476 ----ADLKALCTEAALIALRRSFPQIYSSSDKLLIDVALIKVEVRDFVEAMSRITPSSRRSSVIFSRPLSTYLKP-LL--  548 (1080)
T ss_pred             ----HHHHHHHHHHHHHHHCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCEEC-CC--
T ss_conf             ----78998888875543045658142224321345011100267666543003777775556778888843010-31--


Q ss_pred             CCCCEEEEEEEEEECCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHCCCEEECCCCCCCCCCCCHHHHH
Q ss_conf             01680799999997489972443256899999999999999998886299855742078147448888478887306899
Q gi|254780270|r  621 EVGGEILTVEGVIMPGKGEITITGNLKEIMKESILAASSYVRSKATTFGIIPSAFNEINIHVHVPEGATPKDGPSAGIAM  700 (820)
Q Consensus       621 ~~GG~~l~IE~~~~~g~g~l~lTG~lg~vmkES~~~A~s~~k~~~~~~~~~~~~~~~~diHih~p~Ga~pKDGPSAGi~i  700 (820)
                             .+.-....-+|-+    .+--+|......-+-++|++...+.+  ......-+-|. |.   ++-|-..+   
T Consensus       549 -------~~~~~~~~iq~~~----~va~~~~k~~e~~~~~v~~~e~~~~i--~lic~~~lli~-~~---~~~g~~~l---  608 (1080)
T KOG0732         549 -------PFQDALEDIQGLM----DVASSMAKIEEHLKLLVRSFESNFAI--RLICRPRLLIN-GG---KGSGQDYL---  608 (1080)
T ss_pred             -------CHHHHHHHHHCCH----HHHHHHHHHHHHHHHHHHHHHCCCCH--HHHCCCHHHCC-CC---CCCCCCCC---
T ss_conf             -------1288888752112----37764011777767778754111012--34327087607-98---66565755---


Q ss_pred             HHHHHHHHHCCCCCCCCEEEEEEEECCEEEEECCHHHHHHHHHHCCCCEEECC
Q ss_conf             99999998368887561066368503025000656899999997099699803
Q gi|254780270|r  701 ATAIVSIMTCIPVYKNVAMTGELTLRGRVLPIGGLKEKLLAALRAGVTKVLIP  753 (820)
Q Consensus       701 ~tal~S~~~~~~v~~~iAmTGEitl~G~VlpiGGi~eK~laA~raGi~~viiP  753 (820)
                      .-||+..+-+.+| +..+|+-.++..|.=-+.++|..=.+-|++-+=--|+||
T Consensus       609 g~aIlh~~~~~~v-~s~~issll~d~~~~~~~~~iv~i~~eaR~~~psi~~ip  660 (1080)
T KOG0732         609 GPAILHRLEGLPV-QSLDISSLLSDEGTEDLEEEIVHIFMEARKTTPSIVFIP  660 (1080)
T ss_pred             CHHHHHHHHCCCH-HHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCEEECC
T ss_conf             0899998851405-777788987556652478999999998731588334235


No 175
>PRK12422 chromosomal replication initiation protein; Provisional
Probab=98.21  E-value=8.2e-06  Score=62.83  Aligned_cols=179  Identities=18%  Similarity=0.237  Sum_probs=107.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECHHHHHH
Q ss_conf             59986056565027999999770882499861888888883563200145671289999983278873999933155423
Q gi|254780270|r  368 ILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGS  447 (820)
Q Consensus       368 il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~ldeidk~~~  447 (820)
                      =|-++|++|.|||.|..+|+..+..+-.++-.  +..|.+..    -|+.|+-..=++..++-=-.--|+|+|.|.-++.
T Consensus       143 PLfIyG~~GlGKTHLL~AIgn~i~~~~~kV~Y--vtae~F~~----~~v~ai~~~~~~~Fr~~yr~~DvLLIDDIQfl~g  216 (455)
T PRK12422        143 PIYLFGPEGSGKTHLMQAAVSALRESGGKILY--VSSELFTE----HLVSAIRSGEMQRFRSFYRNVDALFIEDIEVFSG  216 (455)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHCCCCEEEE--ECHHHHHH----HHHHHHHCCCHHHHHHHHHCCCEEEEEHHHHHHC
T ss_conf             75887899997899999999985379986999--74999999----9999997588999999996388776314788728


Q ss_pred             HCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECC---CCC-CCHHHCCCEE---EEEECCCCHHHHHHHHH
Q ss_conf             1177115566554060016813320103523644279999348---655-4413117247---99825878689998999
Q gi|254780270|r  448 DLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTAN---TLN-IPLPLMDRME---IIRIAGYTEEEKLQIAK  520 (820)
Q Consensus       448 ~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan---~~~-i~~~l~drme---~i~~~~y~~~ek~~i~~  520 (820)
                      --  ...--+.++++             -=++-.|-+.+++--   +++ +..-|+.|++   ++++..-..+..+.|.+
T Consensus       217 K~--~tqeEff~tfN-------------~L~~~~KQIVitsDr~P~el~~l~~RL~SRf~~GL~v~I~~Pd~etr~~Il~  281 (455)
T PRK12422        217 KG--ATQEEFFHTFN-------------SLHTEGKLIVISSSYAPGDLKAMEERLISRFEWGIAIPIHPLTREGLRSFLM  281 (455)
T ss_pred             CH--HHHHHHHHHHH-------------HHHHCCCEEEEECCCCHHHHHHHHHHHHHHHHCCEEECCCCCCHHHHHHHHH
T ss_conf             48--89999999999-------------9998599699968989576512689999886376132168999899999999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             86089899862578131322899999997317741023478887999989876542117
Q gi|254780270|r  521 NHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKN  579 (820)
Q Consensus       521 ~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~  579 (820)
                      +     ..+..     .+.++++++++|.++.+.  -||+|+..+..+...++..-+.+
T Consensus       282 ~-----k~~~~-----~~~l~~ev~~~iA~~i~~--niReLeGal~~l~~~~~~~~~~~  328 (455)
T PRK12422        282 R-----QAEQL-----SIRIEETALDFLIQALSS--NVKTLLHALTLLAKRVAYKKLSH  328 (455)
T ss_pred             H-----HHHHC-----CCCCCHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             9-----99871-----888844689999999755--17999999999999999871568


No 176
>TIGR02880 cbbX_cfxQ CbbX protein; InterPro: IPR000470 Proteins in this family are now designated CbbX. Some previously were CfxQ (carbon fixation Q). Its gene is often found immmediately downstream of the Rubisco large and small chain genes, and it is suggested to be necessary for Rubisco expression. CbbX has been shown to be necessary for photoautotrophic growth. The Cfx genes in Alcaligenes eutrophus encode a number of Calvin cycle enzymes . The observed sizes of two of the gene products, CfxX and CfxY, are 35 kDa and 27 kDa respectively . No functions could be assigned to CfxX and CfxY. These proteins show a high degree of similarity to the Bacillus subtilis stage V sporulation protein K . ; GO: 0005524 ATP binding.
Probab=98.18  E-value=2.9e-05  Score=58.66  Aligned_cols=176  Identities=30%  Similarity=0.424  Sum_probs=120.1

Q ss_pred             CCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHH---------CCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEE
Q ss_conf             2106889987766520116899999999999984---------2444673599860565650279999997708824998
Q gi|254780270|r  327 KKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMR---------VIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRM  397 (820)
Q Consensus       327 ~~dl~~a~~iLd~~hyGl~~vK~rile~lav~~~---------~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~i  397 (820)
                      ...+...-..||++--||.-||.||-+.-|....         .....+-.+||.|-||+|||++|...|..|-      
T Consensus        10 ~~~~~~~l~~l~~~l~Gl~Pvk~r~~~~a~lllv~~~r~~~~l~~~~P~lhm~ftG~PGtGkttva~~m~~~l~------   83 (284)
T TIGR02880        10 ESGIKEVLDQLDRELIGLKPVKTRIREIAALLLVERLRQKLGLASAAPSLHMSFTGNPGTGKTTVALRMAQILH------   83 (284)
T ss_pred             HHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHH------
T ss_conf             75799999987676216415889999999999999999874221048832677516898724899999999998------


Q ss_pred             ECCCCCCHH-------HHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECHHHHHH-HCC---C-CHHHHHHHHCCCCC
Q ss_conf             618888888-------83563200145671289999983278873999933155423-117---7-11556655406001
Q gi|254780270|r  398 SLGGVYDEA-------DIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGS-DLR---G-DPSAALLEVLDPAQ  465 (820)
Q Consensus       398 slgg~~d~~-------~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~ldeidk~~~-~~~---g-dp~~allevldp~q  465 (820)
                      .||=++-..       ++-|   -|+|-..-+--..|++|.  -.|+++||---+-. ++.   | +....||.+.....
T Consensus        84 ~lGy~r~G~~~~~trddlvG---qy~GhtaPktke~lk~a~--GGvlfideayyly~P~nerdyG~eaieillq~men~r  158 (284)
T TIGR02880        84 RLGYVRKGHLVSVTRDDLVG---QYIGHTAPKTKEVLKRAM--GGVLFIDEAYYLYRPDNERDYGQEAIEILLQVMENQR  158 (284)
T ss_pred             HCCCCCCCCEEEEEHHHHHH---HHHCCCCCHHHHHHHHHC--CCEEEEECHHHHCCCCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             71540036267853001311---221257722689998742--8736642203321776410223799999999872365


Q ss_pred             CCCEEEEECCCCCCCCCEEEEEECCCC-C---CCHH-HCCC-EEEEEECCCCHHHHHHHHHHHHHHHH
Q ss_conf             681332010352364427999934865-5---4413-1172-47998258786899989998608989
Q gi|254780270|r  466 NSSFVDHYLEVEYDLSDVMFIMTANTL-N---IPLP-LMDR-MEIIRIAGYTEEEKLQIAKNHLVKKV  527 (820)
Q Consensus       466 n~~f~d~y~~~~~dls~v~fi~tan~~-~---i~~~-l~dr-me~i~~~~y~~~ek~~i~~~~l~p~~  527 (820)
                      +.              -|+.++-+.+- +   -..| +..| -.-|+.|.|+.+|-..||.--|-.++
T Consensus       159 ~~--------------lvvi~aGy~~rm~~f~~snPG~~sr~a~h~~fPdy~~~~l~~ia~~~l~~~~  212 (284)
T TIGR02880       159 DD--------------LVVILAGYKDRMDSFFESNPGLSSRVAHHVDFPDYSEEELLAIAELMLEEQQ  212 (284)
T ss_pred             CC--------------EEEEEECCHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             53--------------7888717078888875117862467764315888776789999999886541


No 177
>PRK08939 primosomal protein DnaI; Reviewed
Probab=98.16  E-value=6e-05  Score=56.31  Aligned_cols=88  Identities=26%  Similarity=0.291  Sum_probs=56.1

Q ss_pred             HHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHH
Q ss_conf             99999999998424446735998605656502799999977088249986188888888356320014567128999998
Q gi|254780270|r  349 ERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLK  428 (820)
Q Consensus       349 ~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~  428 (820)
                      ..+.+|+.  ...++....-|-|.||+|||||-|+..||++|-++-+.+.+=-+  ..+++.-+-+|-..--...++.++
T Consensus       142 ~~a~~F~~--~y~~~~~~kGlyl~G~~G~GKTyL~~aian~La~~g~~v~~v~~--p~~~~~lK~s~~d~s~~~~i~~~k  217 (306)
T PRK08939        142 MAALDFLE--AYKPGEKVKGLYLYGDFGVGKTYLLAAIANELAKKGVSSTLVHF--PEFIRELKNAISDGSVKEKIDAVK  217 (306)
T ss_pred             HHHHHHHH--HHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEH--HHHHHHHHHHHCCCCHHHHHHHHH
T ss_conf             99999999--73769888778898999998999999999999986992999875--999999999864898899999984


Q ss_pred             HCCCCCEEEEEECHHH
Q ss_conf             3278873999933155
Q gi|254780270|r  429 RAKRSNPLLLLDEIDK  444 (820)
Q Consensus       429 ~~~~~npv~~ldeidk  444 (820)
                      +    -||.+||.|..
T Consensus       218 ~----~~vLiLDDiGa  229 (306)
T PRK08939        218 E----APVLMLDDIGA  229 (306)
T ss_pred             C----CCEEEEECCCC
T ss_conf             4----99899844465


No 178
>TIGR01817 nifA Nif-specific regulatory protein; InterPro: IPR010113   This entry represents NifA, a DNA-binding regulatory protein for nitrogen fixation. Not included in this group are: the homologue in Aquifex aeolicus (which lacks nitrogenase), transcriptional activators of alternative nitrogenases (VFe or FeFe instead of MoFe), and truncated forms.   In diazotrophic proteobacteria, the sigma54-dependent activator NifA activates transcription of the nif (nitrogen fixation) genes by a conserved mechanism common to members of the enhancer binding protein family. Although NifA proteins have similar domain structures, both transcriptional regulation of nifA expression and posttranslational regulation of NifA activity by oxygen and fixed nitrogen vary significantly from one organism to another. In Klebsiella pneumoniae and Azotobacter vinelandii, nifA is co-ordinately transcribed with a second gene, nifL, whose product inhibits NifA activity in response to oxygen and fixed nitrogen .; GO: 0003677 DNA binding, 0016563 transcription activator activity, 0009399 nitrogen fixation.
Probab=98.16  E-value=9.1e-06  Score=62.48  Aligned_cols=277  Identities=24%  Similarity=0.404  Sum_probs=167.5

Q ss_pred             HHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH---CCCEEEEECCCCCC---HHHHCCCCCC-CCCC---
Q ss_conf             999999999984244467359986056565027999999770---88249986188888---8883563200-1456---
Q gi|254780270|r  349 ERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKAT---GRQYVRMSLGGVYD---EADIRGHRRT-YIGS---  418 (820)
Q Consensus       349 ~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al---~r~f~~islgg~~d---~~~i~gh~~t-y~ga---  418 (820)
                      .++++.+  ++..+. ++ ..+|=|=-||||=-+||.|..-=   +||||++.+.-+.|   |||+=||=+= +-||   
T Consensus       222 ~~v~~~~--~~vA~~-nS-TVLlRGESGTGKEl~A~AIH~~SpR~~~PFVK~NCAALse~lLESELFGHEKGAFTGA~~~  297 (574)
T TIGR01817       222 RQVVDQI--KVVARS-NS-TVLLRGESGTGKELIAKAIHELSPRAKRPFVKLNCAALSETLLESELFGHEKGAFTGAVAQ  297 (574)
T ss_pred             HHHHHHH--HHHCCC-CC-EEEEECCCCCCHHHHHHHHCCCCCCCCCCCEEEECCCCCCCHHHHHHHCCCCHHHHHHHHH
T ss_conf             9999886--520131-76-6785056574433444234046645578854500644776112454513430146888751


Q ss_pred             CCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHC--------------------------CCC---CCCCE
Q ss_conf             7128999998327887399993315542311771155665540--------------------------600---16813
Q gi|254780270|r  419 MPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVL--------------------------DPA---QNSSF  469 (820)
Q Consensus       419 ~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevl--------------------------dp~---qn~~f  469 (820)
                      --||+=  |-.-||    .|||||.-+|..|+    +-||=||                          |=|   |+-+|
T Consensus       298 RkGRFE--lAdGGT----LFLDEIGEISPaFQ----AKLLRVLQEGEFERVGG~~TlKVdVRlvaATNrdLE~aV~~GeF  367 (574)
T TIGR01817       298 RKGRFE--LADGGT----LFLDEIGEISPAFQ----AKLLRVLQEGEFERVGGNRTLKVDVRLVAATNRDLEEAVAKGEF  367 (574)
T ss_pred             CCCCEE--ECCCCC----CCCCCCCCCCHHHH----HHHHHHHHCCCEEEECCCEEEEEEEEEEECCCCCHHHHHHCCCC
T ss_conf             777533--027883----20000146785688----89988752100253278724887367886137355889727897


Q ss_pred             E-EEECCCCCCCCCEEEEEECCCCC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCC-CCCCHHHHH
Q ss_conf             3-20103523644279999348655-44131172479982587868999899986089899862578131-322899999
Q gi|254780270|r  470 V-DHYLEVEYDLSDVMFIMTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEE-CCISDGVLL  546 (820)
Q Consensus       470 ~-d~y~~~~~dls~v~fi~tan~~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~-~~~~~~~i~  546 (820)
                      + |=|.    -||         ... +-||||.|++=|-           ---++++-|.-++||-   . +.|++.||+
T Consensus       368 RaDLYY----Rin---------VvPl~lPPLRER~~DIP-----------~LA~~fL~kf~~en~R---~mL~~~~~Ai~  420 (574)
T TIGR01817       368 RADLYY----RIN---------VVPLILPPLRERREDIP-----------LLAEAFLEKFNRENGR---PMLTLSPSAIR  420 (574)
T ss_pred             CCHHHH----HHH---------HHHHHCCCCCCCCCHHH-----------HHHHHHHHHHHHHHCC---CEEEECHHHHH
T ss_conf             302355----442---------22340787778731168-----------9999999987665187---20322678998


Q ss_pred             HHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCH--------HHHHHHHCCCC-CC---CCCHHCCCCCCCC
Q ss_conf             997317741023478887999989876542117852012796--------78675305200-03---3200022336500
Q gi|254780270|r  547 DIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDTTVSINE--------NNLQDYLGVPR-YK---YGKIEGEDQVGIV  614 (820)
Q Consensus       547 ~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~~~~~~~i~~--------~~l~~~lg~~~-~~---~~~~~~~~~~G~v  614 (820)
                      .+-+ |-+=-=||+||=||.    ..|.-- ++    -+||.        +++...|..+. |.   ..........-.+
T Consensus       421 ~Lm~-c~wPGNVRELENC~e----RtAtLs-~~----~~It~~df~c~~~~c~s~~L~~~~~~~~~~P~~~~~p~~~~~~  490 (574)
T TIGR01817       421 VLMS-CKWPGNVRELENCVE----RTATLS-RS----GTITRSDFSCQSGQCLSKMLAKSSAYKKVDPAVPDAPLGAVSI  490 (574)
T ss_pred             HHHC-CCCCCCCEEHHHHHH----HHHHHC-CC----CCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEC
T ss_conf             9751-789997400443787----787541-68----8516423664278888888888887788778777888886532


Q ss_pred             CEEEECCCCCEEEE-E-EEEEECCCCCEEECC---------CHHHHHHH---HHHHHHHHHHHHHHH-CCCCHH----HH
Q ss_conf             00000001680799-9-999974899724432---------56899999---999999999998886-299855----74
Q gi|254780270|r  615 TGLAWTEVGGEILT-V-EGVIMPGKGEITITG---------NLKEIMKE---SILAASSYVRSKATT-FGIIPS----AF  675 (820)
Q Consensus       615 ~GLa~t~~GG~~l~-I-E~~~~~g~g~l~lTG---------~lg~vmkE---S~~~A~s~~k~~~~~-~~~~~~----~~  675 (820)
                      ++||-+..    +| + +.......+.-.++|         .|-|  +|   +|.--..||-+.|.+ ++++|.    -+
T Consensus       491 ~pla~~~~----~PA~~~pa~~~~p~~~~~~gteaCPavA~~l~e--RERli~AlE~aGWVQAKAARlLg~TPRQVgYal  564 (574)
T TIGR01817       491 VPLAETTA----LPAVESPASAALPAEVGLSGTEACPAVAPTLSE--RERLIAALEKAGWVQAKAARLLGLTPRQVGYAL  564 (574)
T ss_pred             CCCCCCCC----CCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCC--HHHHHHHHHHCCHHHHHHHHHHCCCHHHHHHHH
T ss_conf             57301467----752205433467766777875545567887231--789999997515379999997378655899999


Q ss_pred             HHCCCEE
Q ss_conf             2078147
Q gi|254780270|r  676 NEINIHV  682 (820)
Q Consensus       676 ~~~diHi  682 (820)
                      .++||||
T Consensus       565 r~~~I~~  571 (574)
T TIGR01817       565 RKLNIEV  571 (574)
T ss_pred             HHCCCCC
T ss_conf             8848765


No 179
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]
Probab=98.15  E-value=5.3e-05  Score=56.71  Aligned_cols=174  Identities=22%  Similarity=0.378  Sum_probs=99.1

Q ss_pred             HHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHC----------CCEEEEECCCCCCHHHHC
Q ss_conf             5201168999999999999842444673599860565650279999997708----------824998618888888835
Q gi|254780270|r  340 DHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATG----------RQYVRMSLGGVYDEADIR  409 (820)
Q Consensus       340 ~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~----------r~f~~islgg~~d~~~i~  409 (820)
                      -.-|=++--+|.++.|. +..+++   |  +|+|+||||||.|+...|...-          ..-+...+|.+--.+-.|
T Consensus       171 PvIGRd~EI~r~iqIL~-RR~KNN---P--vLiGEpGVGKTAIvEGLA~rIv~g~VP~~L~~~~i~sLD~g~LvAGakyR  244 (786)
T COG0542         171 PVIGRDEEIRRTIQILS-RRTKNN---P--VLVGEPGVGKTAIVEGLAQRIVNGDVPESLKDKRIYSLDLGSLVAGAKYR  244 (786)
T ss_pred             CCCCHHHHHHHHHHHHH-CCCCCC---C--EEECCCCCCHHHHHHHHHHHHHCCCCCHHHCCCEEEEECHHHHHCCCCCC
T ss_conf             77374799999999983-568899---8--47668988899999899999746999978758879971487674646535


Q ss_pred             CCCCCCCCCCCHHH---HHHHHHCCCCCEEEEEECHHHH-HHHC-C---CCHHHHHHHHCCCCCCCCEEEEECCCCCCCC
Q ss_conf             63200145671289---9999832788739999331554-2311-7---7115566554060016813320103523644
Q gi|254780270|r  410 GHRRTYIGSMPGRI---IQSLKRAKRSNPLLLLDEIDKM-GSDL-R---GDPSAALLEVLDPAQNSSFVDHYLEVEYDLS  481 (820)
Q Consensus       410 gh~~ty~ga~pg~i---i~~l~~~~~~npv~~ldeidk~-~~~~-~---gdp~~allevldp~qn~~f~d~y~~~~~dls  481 (820)
                             |-.--|+   +..+.+++  |.++++|||..+ |.+. .   .|.++.|--.|--   -+            =
T Consensus       245 -------GeFEeRlk~vl~ev~~~~--~vILFIDEiHtiVGAG~~~g~a~DAaNiLKPaLAR---Ge------------L  300 (786)
T COG0542         245 -------GEFEERLKAVLKEVEKSK--NVILFIDEIHTIVGAGATEGGAMDAANLLKPALAR---GE------------L  300 (786)
T ss_pred             -------CCHHHHHHHHHHHHHCCC--CEEEEEECHHHHCCCCCCCCCCCCHHHHHHHHHHC---CC------------E
T ss_conf             -------738999999999985179--84999823554057776666651256646778745---87------------3


Q ss_pred             CEEEEEECCC----CCCCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHH
Q ss_conf             2799993486----5544131172479982587868999899986089899862578131322899999997
Q gi|254780270|r  482 DVMFIMTANT----LNIPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDII  549 (820)
Q Consensus       482 ~v~fi~tan~----~~i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii  549 (820)
                      +++=-+|.+-    ..-.++|--|+-.|.+.--+.++-+.|-+. |-++--.-|     .|.++|+||..-+
T Consensus       301 ~~IGATT~~EYRk~iEKD~AL~RRFQ~V~V~EPs~e~ti~ILrG-lk~~yE~hH-----~V~i~D~Al~aAv  366 (786)
T COG0542         301 RCIGATTLDEYRKYIEKDAALERRFQKVLVDEPSVEDTIAILRG-LKERYEAHH-----GVRITDEALVAAV  366 (786)
T ss_pred             EEEEECCHHHHHHHHHHCHHHHHCCCEEECCCCCHHHHHHHHHH-HHHHHHHCC-----CCEECHHHHHHHH
T ss_conf             79973558999887330667784675102799898999999987-788887706-----9643379999999


No 180
>pfam01078 Mg_chelatase Magnesium chelatase, subunit ChlI. Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX. This is the first unique step in the synthesis of (bacterio)chlorophyll. Due to this, it is thought that Mg-chelatase has an important role in channelling inter- mediates into the (bacterio)chlorophyll branch in response to conditions suitable for photosynthetic growth. ChlI and BchD have molecular weight between 38-42 kDa.
Probab=98.14  E-value=6.2e-06  Score=63.76  Aligned_cols=151  Identities=25%  Similarity=0.416  Sum_probs=80.7

Q ss_pred             HHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC-------CEE-EEECCCCCCHHHHCCC
Q ss_conf             52011689999999999998424446735998605656502799999977088-------249-9861888888883563
Q gi|254780270|r  340 DHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGR-------QYV-RMSLGGVYDEADIRGH  411 (820)
Q Consensus       340 ~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r-------~f~-~islgg~~d~~~i~gh  411 (820)
                      |.-|-+.+|.-+ |. |.      ..|--+.++||||+|||.+|+.++..|--       +.. --|+.|......+..|
T Consensus         4 di~GQ~~akrAl-~i-Aa------aG~H~lLl~GpPG~GKTmlA~rl~~iLP~l~~~e~le~~~i~S~~g~~~~~~l~~~   75 (207)
T pfam01078         4 DVKGQEQAKRAL-EI-AA------AGGHNLLMIGPPGSGKTMLAKRLPGILPPLTEQEALEVTAIHSVAGLGGDGGLIRR   75 (207)
T ss_pred             HHCCCHHHHHHH-HH-HH------CCCCCEEEECCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCC
T ss_conf             863859999999-99-85------47875897889980299999763014899878998877764230368777774457


Q ss_pred             C--------CC---CCC----CCCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEE-CC
Q ss_conf             2--------00---145----67128999998327887399993315542311771155665540600168133201-03
Q gi|254780270|r  412 R--------RT---YIG----SMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHY-LE  475 (820)
Q Consensus       412 ~--------~t---y~g----a~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y-~~  475 (820)
                      |        -|   .+|    ..||-|..|      .|.|.+|||+.....+    --.+|++.|.--+..--+-+| ..
T Consensus        76 rPfr~PHhs~s~~aliGGg~~~~PGeIslA------H~GVLFLDE~~Ef~~~----vle~LrqpLE~~~v~IsRa~~~~~  145 (207)
T pfam01078        76 RPFRAPHHSASAAALVGGGSIPRPGEISLA------HNGVLFLDELPEFSRR----VLESLRQPLEDGEITISRARAKVT  145 (207)
T ss_pred             CCCCCCCCCCCHHHCCCCCCCCCCCCEEEC------CCCEEEECCHHHCCHH----HHHHHHHHHCCCCEEEEECCCEEE
T ss_conf             986578876436332268888999706663------6878884764653988----999998766049489995675898


Q ss_pred             CCCCCCCEEEEEECCC-----------------------CC-CCHHHCCCEEE-EEECCCC
Q ss_conf             5236442799993486-----------------------55-44131172479-9825878
Q gi|254780270|r  476 VEYDLSDVMFIMTANT-----------------------LN-IPLPLMDRMEI-IRIAGYT  511 (820)
Q Consensus       476 ~~~dls~v~fi~tan~-----------------------~~-i~~~l~drme~-i~~~~y~  511 (820)
                      +|   ++.++|+++|-                       .+ |+.||+||+.+ ++++.-+
T Consensus       146 ~P---A~f~LvaA~NPCpCG~~~~~~~~C~C~~~~~~~Y~~rlSgPllDRiDl~v~~~~~~  203 (207)
T pfam01078       146 FP---ARFQLVAAMNPCPCGYLGDPDKRCRCTPRQIRRYLSRLSGPLLDRIDLQVEVPRLS  203 (207)
T ss_pred             EC---CCEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCHHHHCCEEEEEECCCCC
T ss_conf             60---43488885057777878899997578899999998764522020687899778999


No 181
>TIGR00602 rad24 checkpoint protein rad24; InterPro: IPR004582    To be effective as a mechanism that preserves genomic integrity, the DNA damage checkpoint must be extremely sensitive in its ability to detect DNA damage. In Saccharomyces cerevisiae the Ddc1/Rad17/Mec3 complex and Rad24 are DNA damage checkpoint components which may promote checkpoint activation by "sensing" DNA damage directly . Rad24 shares sequence homology with RF-c, a protein that recognises DNA template/RNA primer hybrids during DNA replication. The Ddc1 complex has structural homology to proliferating-cell nuclear antigen (PCNA), which clamps onto DNA and confers processivity to DNA polymerases delta and epsilon. Rad24 is postulated to recognise DNA lesions and then recruit the Ddc1 complex to generate checkpoint signals. ; GO: 0006281 DNA repair, 0007049 cell cycle, 0005634 nucleus.
Probab=98.14  E-value=1.2e-05  Score=61.66  Aligned_cols=126  Identities=25%  Similarity=0.385  Sum_probs=79.0

Q ss_pred             CCCC-CCCCCCCCH---HHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC
Q ss_conf             0415-876632210---688998776652011689999999999998424446735998605656502799999977088
Q gi|254780270|r  317 GVPW-DKKSKTKKN---LDFAIRILDQDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGR  392 (820)
Q Consensus       317 ~lPW-~~~t~~~~d---l~~a~~iLd~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r  392 (820)
                      .=|| .||.+....   +.+-+         +++|++-+.-.  +.-..+...|.||++.||||.|||+..|-+||.||.
T Consensus        76 ~e~W~eKykP~~~~~lAvHK~K---------i~~v~~wl~a~--~Le~~~~rGGs~LLi~GPsGCgKsT~~k~LsKelg~  144 (670)
T TIGR00602        76 NELWVEKYKPETQEELAVHKKK---------IEEVEEWLKAQ--VLESAKKRGGSILLITGPSGCGKSTTIKILSKELGI  144 (670)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHH---------HHHHHHHHHHH--CCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHH
T ss_conf             8744102675424577664777---------99999997520--020456677537884175588447899999888644


Q ss_pred             CEE--------------------------EE---ECCCCCCHHHHCCCCCCCCCCCCHHHHHHH-HHCCCCCEEEEEECH
Q ss_conf             249--------------------------98---618888888835632001456712899999-832788739999331
Q gi|254780270|r  393 QYV--------------------------RM---SLGGVYDEADIRGHRRTYIGSMPGRIIQSL-KRAKRSNPLLLLDEI  442 (820)
Q Consensus       393 ~f~--------------------------~i---slgg~~d~~~i~gh~~ty~ga~pg~ii~~l-~~~~~~npv~~ldei  442 (820)
                      .+.                          ++   |+=-+-.|-+++-..+.        =+|.+ ..+.+.--+||+|||
T Consensus       145 ~~~ew~Np~~~~~~~n~~k~~~~~~~~f~~~PY~sq~e~f~efll~a~kY~--------~lQ~lG~~~~~~kk~Il~e~l  216 (670)
T TIGR00602       145 KVQEWLNPVLLKEQKNDEKDTLSLESKFSRFPYLSQIEVFSEFLLRATKYN--------KLQKLGDDLQTDKKLILVEDL  216 (670)
T ss_pred             HHHHHHCCCCCCCCCCHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHHHH--------HHHHCCCCCCCCCCEEEECCC
T ss_conf             565540787888885124444212540221676314554678764212346--------664214110247545772137


Q ss_pred             HHHHHHCCCCHH-HHHHHHCC
Q ss_conf             554231177115-56655406
Q gi|254780270|r  443 DKMGSDLRGDPS-AALLEVLD  462 (820)
Q Consensus       443 dk~~~~~~gdp~-~allevld  462 (820)
                      =.+ +-|++|+. .|+=+||-
T Consensus       217 Phl-n~F~~d~~rr~~~~vlr  236 (670)
T TIGR00602       217 PHL-NKFYRDLDRRALREVLR  236 (670)
T ss_pred             CCH-HHHCCCHHHHHHHHHHH
T ss_conf             640-22136612689999999


No 182
>PRK06871 DNA polymerase III subunit delta'; Validated
Probab=98.13  E-value=0.00013  Score=53.75  Aligned_cols=133  Identities=17%  Similarity=0.245  Sum_probs=84.4

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHCC--CEEEEECCCCCCHHH-HCC-CCCC-CCCCCCHH---------HHHHHHHC
Q ss_conf             6735998605656502799999977088--249986188888888-356-3200-14567128---------99999832
Q gi|254780270|r  365 KGLILCFVGPPGVGKTSLAQSIAKATGR--QYVRMSLGGVYDEAD-IRG-HRRT-YIGSMPGR---------IIQSLKRA  430 (820)
Q Consensus       365 ~g~il~l~gppgvGKts~~~sia~al~r--~f~~islgg~~d~~~-i~g-h~~t-y~ga~pg~---------ii~~l~~~  430 (820)
                      -+..+.|.||+|+||+++|+.+|++|-=  +-..-+.|..++--- ..| |--. ++...-|+         +++.+...
T Consensus        22 ~~HA~L~~G~~G~Gk~~la~~~a~~llC~~~~~~~~Cg~C~sC~l~~~g~HPD~~~i~~~~~k~I~vd~IR~l~~~~~~~  101 (324)
T PRK06871         22 GHHALLFKADSGLGTEQLIRALAQWLMCQAPGDEQPCGQCHSCHLFQAGNHPDFHILEPIDGKDIGVDQVREINEKVSQF  101 (324)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHC
T ss_conf             54378768999978999999999998289999999888898999997389998799846788878899999999998646


Q ss_pred             --CCCCEEEEEECHHHHHHHCCCCHHHHHHHHCC-CCCCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHHHCCCEEEEE
Q ss_conf             --78873999933155423117711556655406-0016813320103523644279999348655-4413117247998
Q gi|254780270|r  431 --KRSNPLLLLDEIDKMGSDLRGDPSAALLEVLD-PAQNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLPLMDRMEIIR  506 (820)
Q Consensus       431 --~~~npv~~ldeidk~~~~~~gdp~~allevld-p~qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~drme~i~  506 (820)
                        ...+-|+++|+.|+|+..    .++|||-.|. |.                ++++||..++..+ +++.++.|--++.
T Consensus       102 ~~~g~~KV~iI~~ae~m~~~----AaNALLKtLEEPp----------------~~~~fiL~t~~~~~ll~TI~SRCq~~~  161 (324)
T PRK06871        102 AQQGGNKVVYIQGAERLTEA----AANALLKTLEEPR----------------PNTYFLLQADLSASLLATIYSRCQTWL  161 (324)
T ss_pred             CCCCCCEEEEECCHHHHHHH----HHHHHHHHHCCCC----------------CCEEEEEEECCCCCCCCHHHHCCCCEE
T ss_conf             22059669997588885799----9999999833898----------------783899987870103240862661200


Q ss_pred             ECCCCHHHHHH
Q ss_conf             25878689998
Q gi|254780270|r  507 IAGYTEEEKLQ  517 (820)
Q Consensus       507 ~~~y~~~ek~~  517 (820)
                      ++.-..++-..
T Consensus       162 ~~~p~~~~~~~  172 (324)
T PRK06871        162 IHVPEEQIALD  172 (324)
T ss_pred             CCCCCHHHHHH
T ss_conf             89949999999


No 183
>KOG2680 consensus
Probab=98.13  E-value=2.2e-05  Score=59.54  Aligned_cols=203  Identities=29%  Similarity=0.442  Sum_probs=117.3

Q ss_pred             HCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC--CEEEEECCC---------------------CC--CHHH-HCCCC-
Q ss_conf             424446735998605656502799999977088--249986188---------------------88--8888-35632-
Q gi|254780270|r  360 RVIKNKGLILCFVGPPGVGKTSLAQSIAKATGR--QYVRMSLGG---------------------VY--DEAD-IRGHR-  412 (820)
Q Consensus       360 ~~~~~~g~il~l~gppgvGKts~~~sia~al~r--~f~~islgg---------------------~~--d~~~-i~gh~-  412 (820)
                      ..++..|..+++.|+||+|||-||-.+|++||-  ||..||-.-                     ++  .|.| |.|.- 
T Consensus        60 ~egkiaGraiLiaG~pgtGKtAiAmg~sksLG~~tpF~~i~gSEI~SlEmsKTEAltQAfRksiGvrIKEetevIEGEVV  139 (454)
T KOG2680          60 REGKIAGRAILIAGQPGTGKTAIAMGMSKSLGDDTPFTSISGSEIYSLEMSKTEALTQAFRKSIGVRIKEETEVIEGEVV  139 (454)
T ss_pred             HCCCCCCEEEEEECCCCCCCEEEEEEHHHHHCCCCCEEEEECCEEEEECCCHHHHHHHHHHHHHCEEEEHEEEEECCEEE
T ss_conf             72863213899724898884410000245407887503650222221000177999999888516474000014300589


Q ss_pred             -------CCCCCCCC-----------------HHHHHHHHHCCCCC-EEEEEEC----HHHHHHHCCC----CHH-----
Q ss_conf             -------00145671-----------------28999998327887-3999933----1554231177----115-----
Q gi|254780270|r  413 -------RTYIGSMP-----------------GRIIQSLKRAKRSN-PLLLLDE----IDKMGSDLRG----DPS-----  454 (820)
Q Consensus       413 -------~ty~ga~p-----------------g~ii~~l~~~~~~n-pv~~lde----idk~~~~~~g----dp~-----  454 (820)
                             -|-.|+.-                 -+.|.+|.|-++.- -||-+|-    |-|+|.+|.-    |+.     
T Consensus       140 eiqidRp~tg~g~k~GKlt~kTtdMEt~ydlG~Kmi~~l~KeKV~aGDVI~idka~GkitKlGrSf~rsrdyDamG~~tk  219 (454)
T KOG2680         140 EIQIDRPATGMGSKVGKLTLKTTDMETIYDLGMKMIESLTKEKVQAGDVITIDKASGKITKLGRSFTRSRDYDAMGSQTK  219 (454)
T ss_pred             EEEEECCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCEEEHHHCCCCCCCCCCCCCCCCC
T ss_conf             99960466676764444677521115588788999877657533678559987024630021012010346776577651


Q ss_pred             ------HHH-------------------------------------HHHCCCCC----------------CCCEEE--EE
Q ss_conf             ------566-------------------------------------55406001----------------681332--01
Q gi|254780270|r  455 ------AAL-------------------------------------LEVLDPAQ----------------NSSFVD--HY  473 (820)
Q Consensus       455 ------~al-------------------------------------levldp~q----------------n~~f~d--~y  473 (820)
                            .-|                                     -||-|--.                .--|.|  |.
T Consensus       220 fVqCPeGElqkrkevvhtvsLHeIDViNSrtqG~lALFsGdTGEIr~EvRdqin~KV~eWreEGKAeivpGVLFIDEvHM  299 (454)
T KOG2680         220 FVQCPEGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIRSEVRDQINTKVAEWREEGKAEIVPGVLFIDEVHM  299 (454)
T ss_pred             EECCCCHHHHHEEEEEEEEEECCCCCCCCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCEEEEEEEHH
T ss_conf             42399314410023357643000133455665248997078652018889888788898886177242255178740021


Q ss_pred             CC----------CCCCCCCEEEEEEC---------CCC--C-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             03----------52364427999934---------865--5-44131172479982587868999899986089899862
Q gi|254780270|r  474 LE----------VEYDLSDVMFIMTA---------NTL--N-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEH  531 (820)
Q Consensus       474 ~~----------~~~dls~v~fi~ta---------n~~--~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~  531 (820)
                      ||          +.-|++-++.++|-         |+.  . ||.-|+|||-+|...+|+.+|-..|.+-          
T Consensus       300 LDIEcFsFlNrAlE~d~~PiiimaTNrgit~iRGTn~~SphGiP~D~lDR~lII~t~py~~~d~~~IL~i----------  369 (454)
T KOG2680         300 LDIECFSFLNRALENDMAPIIIMATNRGITRIRGTNYRSPHGIPIDLLDRMLIISTQPYTEEDIKKILRI----------  369 (454)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEECCCCEEEEECCCCCCCCCCCHHHHHHHHEEECCCCCHHHHHHHHHH----------
T ss_conf             1157999888876504685799972775577605777898888677764412552565768899999875----------


Q ss_pred             CCCCCCCCCCHHHHHHHHHCCCCCCHHHH---HHHHHHHHHHHHH
Q ss_conf             57813132289999999731774102347---8887999989876
Q gi|254780270|r  532 ALKQEECCISDGVLLDIIRLFTHEAGVRS---FERALMKIARKAV  573 (820)
Q Consensus       532 ~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~---l~r~i~~i~r~~~  573 (820)
                      -..++++.++++|+..+..- ..+.+.|-   |=-.-.-+|+|..
T Consensus       370 Rc~EEdv~m~~~A~d~Lt~i-~~~tsLRYai~Lit~a~~~~~krk  413 (454)
T KOG2680         370 RCQEEDVEMNPDALDLLTKI-GEATSLRYAIHLITAASLVCLKRK  413 (454)
T ss_pred             HHHHHCCCCCHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             50052133587899999986-131237899999889999998754


No 184
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed
Probab=98.12  E-value=2.4e-05  Score=59.33  Aligned_cols=186  Identities=20%  Similarity=0.279  Sum_probs=114.5

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCC-----CEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECH
Q ss_conf             5998605656502799999977088-----24998618888888835632001456712899999832788739999331
Q gi|254780270|r  368 ILCFVGPPGVGKTSLAQSIAKATGR-----QYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEI  442 (820)
Q Consensus       368 il~l~gppgvGKts~~~sia~al~r-----~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~ldei  442 (820)
                      -|-++|++|+|||.|-.+||..+-+     +.+.++     .|.+..    -|+.|+-.+=++.+++-=..-.|+|+|.|
T Consensus       147 PLfIyG~~GlGKTHLl~AIgn~~~~~~p~~~v~Y~t-----ae~F~~----~~v~al~~~~~~~Fr~~yr~~DvLliDDi  217 (447)
T PRK00149        147 PLFIYGGVGLGKTHLLHAIGNYILEKNPNAKVVYVS-----SEKFTN----DFVKALRNNAMEEFKEKYRSVDVLLIDDI  217 (447)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEE-----HHHHHH----HHHHHHHCCCHHHHHHHHHCCCEEEECHH
T ss_conf             558977998878899999999999858997289954-----999999----99999851869999999972885432148


Q ss_pred             HHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECC---CCC-CCHHHCCCEE---EEEECCCCHHHH
Q ss_conf             554231177115566554060016813320103523644279999348---655-4413117247---998258786899
Q gi|254780270|r  443 DKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTAN---TLN-IPLPLMDRME---IIRIAGYTEEEK  515 (820)
Q Consensus       443 dk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan---~~~-i~~~l~drme---~i~~~~y~~~ek  515 (820)
                      .=++.-  ..-.--++++++-=             ++-.|-+.+++.-   ++. +.+-|+.|++   ++++..-..+-+
T Consensus       218 qfl~gk--~~tqeeff~~fn~l-------------~~~~kqiv~tsd~~P~~l~~l~~rL~SRf~~Gl~~~i~~Pd~e~r  282 (447)
T PRK00149        218 QFLAGK--EKTQEEFFHTFNAL-------------HENNKQIVITSDRPPKELEGLEDRLRSRFEWGLTVDIEPPDLETR  282 (447)
T ss_pred             HHHHCC--HHHHHHHHHHHHHH-------------HHCCCEEEEECCCCHHHCCCCCHHHHHHHHCCEEEECCCCCHHHH
T ss_conf             886055--77999999999999-------------984996899578896765651177886763762651059999999


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHH
Q ss_conf             98999860898998625781313228999999973177410234788879999898765421178520127967867530
Q gi|254780270|r  516 LQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDTTVSINENNLQDYL  595 (820)
Q Consensus       516 ~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~l  595 (820)
                      +.|.++-.     +..     .+.++++++++|.++.+.  -||+||-.|.++.-...   +.+.    .|+.+.+.+.|
T Consensus       283 ~~Il~~k~-----~~~-----~~~l~~~v~~~iA~~~~~--nvR~LeGal~~l~a~~~---~~~~----~i~~~~~~~~l  343 (447)
T PRK00149        283 VAILQKKA-----EEE-----GINLPNEVLEFIAKRIRS--NIRELEGALNRLVAYAS---LTGR----PITLELAKEAL  343 (447)
T ss_pred             HHHHHHHH-----HHC-----CCCCCHHHHHHHHHHCCC--CHHHHHHHHHHHHHHHH---HHCC----CCCHHHHHHHH
T ss_conf             99999999-----972-----899998999999971268--89999999999999999---8689----99999999999


Q ss_pred             C
Q ss_conf             5
Q gi|254780270|r  596 G  596 (820)
Q Consensus       596 g  596 (820)
                      +
T Consensus       344 ~  344 (447)
T PRK00149        344 K  344 (447)
T ss_pred             H
T ss_conf             9


No 185
>pfam01637 Arch_ATPase Archaeal ATPase. This family contain a conserved P-loop motif that is involved in binding ATP. This family is almost exclusively found in archaebacteria and particularly in Methanococcus jannaschii that encodes sixteen members of this family.
Probab=98.10  E-value=0.00024  Score=51.76  Aligned_cols=168  Identities=15%  Similarity=0.148  Sum_probs=95.6

Q ss_pred             HHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCE---EEEECCCCCCHHHHCC---CCC------CCCC--------
Q ss_conf             9842444673599860565650279999997708824---9986188888888356---320------0145--------
Q gi|254780270|r  358 QMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQY---VRMSLGGVYDEADIRG---HRR------TYIG--------  417 (820)
Q Consensus       358 ~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f---~~islgg~~d~~~i~g---h~~------ty~g--------  417 (820)
                      ..+-.+.+++++.++||=++|||||.+..++-+.-+.   +.+..........++-   .++      ...+        
T Consensus        12 ~~~~~~~~~~~ivi~G~RR~GKTsLi~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~   91 (223)
T pfam01637        12 EEWAERGTYPIIVVYGPRRCGKTALLREFLEELRELGYRVIYYDPLRREFEEKLDRFEEAKRLAEALGDALPKIGIAKSK   91 (223)
T ss_pred             HHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEEECHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCC
T ss_conf             99996699718999868878799999999986334685289995144437999998888899999987651233222112


Q ss_pred             ---CCCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCH--HHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCC
Q ss_conf             ---671289999983278873999933155423117711--556655406001681332010352364427999934865
Q gi|254780270|r  418 ---SMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDP--SAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTL  492 (820)
Q Consensus       418 ---a~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp--~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~  492 (820)
                         ...-.+...+.+. ..++|+++||..-+. ..+++|  -++|..+.|.-+             .-+++.||++..+.
T Consensus        92 ~~~~~l~~~~~~l~~~-~~~~iiviDEfq~l~-~~~~~~~~~~~l~~~~d~~~-------------~~~~~~~I~~GS~~  156 (223)
T pfam01637        92 LAFLSLTLLFELLKRK-GKKIAIIIDEVQYAI-GLNGAESYVKLLLNLIDYPP-------------KEYHLIVVLCGSSE  156 (223)
T ss_pred             CHHHHHHHHHHHHHHC-CCCEEEEEECHHHHH-HCCCCHHHHHHHHHHHHHHH-------------CCCCEEEEEECCHH
T ss_conf             0788999999999855-996599970167764-02443059999999999752-------------45775899972719


Q ss_pred             -------CCCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHH
Q ss_conf             -------5441311724799825878689998999860898998625781313228999999973
Q gi|254780270|r  493 -------NIPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIR  550 (820)
Q Consensus       493 -------~i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~  550 (820)
                             .-..||.-|-..|++.+...++=.+-.+     +..++.|     +.++++.++.+..
T Consensus       157 ~~m~~~~~~~~plygR~~~i~l~p~~~~~~~efl~-----~~f~e~~-----~~~~~~~~~~iy~  211 (223)
T pfam01637       157 GLTIELLDYKSPLYGRHRWALLKPFDFETAWNFLR-----EGFEELY-----EPGPKEEFEEVWR  211 (223)
T ss_pred             HHHHHHHCCCCCCCCCCCEEEECCCCHHHHHHHHH-----HHHHHHC-----CCCCHHHHHHHHH
T ss_conf             99999862056535750227726899899999999-----9999847-----8999899999999


No 186
>PRK06090 DNA polymerase III subunit delta'; Validated
Probab=98.10  E-value=5.3e-05  Score=56.70  Aligned_cols=135  Identities=19%  Similarity=0.284  Sum_probs=86.2

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHCCC-EEEEECCCCCCHHH-HCC-CCCCC-CCC-CCHH--HHHHHHHC----
Q ss_conf             44467359986056565027999999770882-49986188888888-356-32001-456-7128--99999832----
Q gi|254780270|r  362 IKNKGLILCFVGPPGVGKTSLAQSIAKATGRQ-YVRMSLGGVYDEAD-IRG-HRRTY-IGS-MPGR--IIQSLKRA----  430 (820)
Q Consensus       362 ~~~~g~il~l~gppgvGKts~~~sia~al~r~-f~~islgg~~d~~~-i~g-h~~ty-~ga-~pg~--ii~~l~~~----  430 (820)
                      .+.-+..+.|.||+|+||+++|+.+|++|-=. ...-+.|-.+.-.. -.| |---| +.. ..|+  -|+.++..    
T Consensus        21 ~~rl~HA~L~~g~~G~Gk~~la~~la~~LlC~~~~~~~Cg~C~sC~l~~~g~HPD~~~i~pe~~~k~I~vd~IR~l~~~~  100 (319)
T PRK06090         21 AERIPGALLLQSDEGLGVESLVELFSHALLCQNYQSEACGFCHSCELMKSGNHPDLHVIKPEKEGKSITVEQIRQCNRLA  100 (319)
T ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCCCHHHHHHHHHHH
T ss_conf             69963067667999857999999999998089999998877877999875899982366123356768799999999997


Q ss_pred             -----CCCCEEEEEECHHHHHHHCCCCHHHHHHHHC-CCCCCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHHHCCCEE
Q ss_conf             -----7887399993315542311771155665540-60016813320103523644279999348655-4413117247
Q gi|254780270|r  431 -----KRSNPLLLLDEIDKMGSDLRGDPSAALLEVL-DPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLPLMDRME  503 (820)
Q Consensus       431 -----~~~npv~~ldeidk~~~~~~gdp~~allevl-dp~qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~drme  503 (820)
                           ...+-|+++|+.|+|+.    ..++|||-.| .|.                .+++||.+++..+ +++.++.|.-
T Consensus       101 ~~~~~~g~~KV~iI~~ae~m~~----~AaNALLKtLEEPp----------------~~t~fiL~t~~~~~ll~TI~SRCq  160 (319)
T PRK06090        101 QESSQLGGYRLFVIEPADAMNE----SASNALLKTLEEPA----------------PNCLFLLVTHNQKRLLPTIVSRCQ  160 (319)
T ss_pred             HHCCCCCCCEEEEECCHHHCCH----HHHHHHHHHHCCCC----------------CCEEEEEEECCHHHCCCCHHHCCC
T ss_conf             5452106936999814443499----99999999842899----------------883899876851208641876144


Q ss_pred             EEEECCCCHHHHH
Q ss_conf             9982587868999
Q gi|254780270|r  504 IIRIAGYTEEEKL  516 (820)
Q Consensus       504 ~i~~~~y~~~ek~  516 (820)
                      .+.++.-..++-.
T Consensus       161 ~~~l~~p~~~~~~  173 (319)
T PRK06090        161 QWVVTPPSTDQAM  173 (319)
T ss_pred             CCCCCCCCHHHHH
T ss_conf             5028995999999


No 187
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]
Probab=98.08  E-value=0.00034  Score=50.61  Aligned_cols=212  Identities=21%  Similarity=0.310  Sum_probs=134.3

Q ss_pred             HHHHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHH----HCCCEEEEECCCCCC---HHHHC
Q ss_conf             76652011689999999999998424446735998605656502799999977----088249986188888---88835
Q gi|254780270|r  337 LDQDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKA----TGRQYVRMSLGGVYD---EADIR  409 (820)
Q Consensus       337 Ld~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~a----l~r~f~~islgg~~d---~~~i~  409 (820)
                      |=-+++-++++.|+|.-      ..+  .|.-+.+.|++||||+-+|.-|...    .+-||+.+.++-...   ++++=
T Consensus        80 LIG~~~~~~~~~eqik~------~ap--~~~~vLi~GetGtGKel~A~~iH~~s~r~~~~PFI~~NCa~~~en~~~~eLF  151 (403)
T COG1221          80 LIGESPSLQELREQIKA------YAP--SGLPVLIIGETGTGKELFARLIHALSARRAEAPFIAFNCAAYSENLQEAELF  151 (403)
T ss_pred             HHCCCHHHHHHHHHHHH------HCC--CCCCEEEECCCCCCHHHHHHHHHHHHHCCCCCCEEEEEHHHHCCCHHHHHHH
T ss_conf             63568889999999986------189--9984798668875388999999986121358987997777737677777773


Q ss_pred             CCCC-CCCCCC---CHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEE
Q ss_conf             6320-014567---128999998327887399993315542311771155665540600168133201035236442799
Q gi|254780270|r  410 GHRR-TYIGSM---PGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMF  485 (820)
Q Consensus       410 gh~~-ty~ga~---pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~f  485 (820)
                      ||.. +|-||.   +|.+=++      .-...+||||--+...-+    ..||-+||-   ..|+--==.-| .-++|..
T Consensus       152 G~~kGaftGa~~~k~Glfe~A------~GGtLfLDEI~~LP~~~Q----~kLl~~le~---g~~~rvG~~~~-~~~dVRl  217 (403)
T COG1221         152 GHEKGAFTGAQGGKAGLFEQA------NGGTLFLDEIHRLPPEGQ----EKLLRVLEE---GEYRRVGGSQP-RPVDVRL  217 (403)
T ss_pred             CCCCCEEECCCCCCCCHHEEC------CCCEEEHHHHHHCCHHHH----HHHHHHHHC---CCEEECCCCCC-CCCCCEE
T ss_conf             200000025667867642052------797776563653798589----999999871---86576688888-6777404


Q ss_pred             EEECCC-C-C-CCH--HHCCC--EEEEEECCCCHHHHHHH--HHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCC
Q ss_conf             993486-5-5-441--31172--47998258786899989--99860898998625781313228999999973177410
Q gi|254780270|r  486 IMTANT-L-N-IPL--PLMDR--MEIIRIAGYTEEEKLQI--AKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEA  556 (820)
Q Consensus       486 i~tan~-~-~-i~~--~l~dr--me~i~~~~y~~~ek~~i--~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~Ea  556 (820)
                      ||.-|. + . +-.  -|.+|  .-+|++|+--.- |-.|  --.|.+.....+.++...  .++++++..+ ..|+...
T Consensus       218 i~AT~~~l~~~~~~g~dl~~rl~~~~I~LPpLrER-~~Di~~L~e~Fl~~~~~~l~~~~~--~~~~~a~~~L-~~y~~pG  293 (403)
T COG1221         218 ICATTEDLEEAVLAGADLTRRLNILTITLPPLRER-KEDILLLAEHFLKSEARRLGLPLS--VDSPEALRAL-LAYDWPG  293 (403)
T ss_pred             EECCCCCHHHHHHHHCCHHHHHCCCEECCCCHHHC-HHHHHHHHHHHHHHHHHHCCCCCC--CCCHHHHHHH-HHCCCCC
T ss_conf             51356687999874052556416754318972435-555999999999999997399988--8889999999-8488998


Q ss_pred             HHHHHHHHHHHHHHHHHH
Q ss_conf             234788879999898765
Q gi|254780270|r  557 GVRSFERALMKIARKAVT  574 (820)
Q Consensus       557 GvR~l~r~i~~i~r~~~~  574 (820)
                      -||+|+..+..+|-..-.
T Consensus       294 NirELkN~Ve~~~~~~~~  311 (403)
T COG1221         294 NIRELKNLVERAVAQASG  311 (403)
T ss_pred             CHHHHHHHHHHHHHHHCC
T ss_conf             399999999999997354


No 188
>KOG0729 consensus
Probab=98.07  E-value=1.8e-05  Score=60.27  Aligned_cols=86  Identities=27%  Similarity=0.541  Sum_probs=59.1

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCC-CCCEEEEEECHHHH
Q ss_conf             35998605656502799999977088249986188888888356320014567128999998327-88739999331554
Q gi|254780270|r  367 LILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAK-RSNPLLLLDEIDKM  445 (820)
Q Consensus       367 ~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~-~~npv~~ldeidk~  445 (820)
                      .-++|+||||+|||-.|+.+|+-.+--|.|+-      .||+-   ..|||--.-+.-.-...|. -.-++|++||||-+
T Consensus       212 KGvllyGPPGtGKTL~ARAVANRTdAcFIRVi------GSELV---QKYvGEGARMVRElFeMAr~KKACiiFFDEiDAi  282 (435)
T KOG0729         212 KGVLLYGPPGTGKTLCARAVANRTDACFIRVI------GSELV---QKYVGEGARMVRELFEMARTKKACIIFFDEIDAI  282 (435)
T ss_pred             CCEEEECCCCCCHHHHHHHHHCCCCCEEEEEH------HHHHH---HHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCC
T ss_conf             73378689998610899987456674587631------18999---9986246899999999852365279984101022


Q ss_pred             HHH-C----CCC--HHHHHHHHC
Q ss_conf             231-1----771--155665540
Q gi|254780270|r  446 GSD-L----RGD--PSAALLEVL  461 (820)
Q Consensus       446 ~~~-~----~gd--p~~allevl  461 (820)
                      |-. |    .||  ....|||++
T Consensus       283 GGaRFDDg~ggDNEVQRTMLEli  305 (435)
T KOG0729         283 GGARFDDGAGGDNEVQRTMLELI  305 (435)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             67203578887279999999999


No 189
>TIGR02173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR011892    Proteins in this family are believed to be cytidylate kinase. Members of this family are found in the archaea and in spirochaetes, and differ considerably from the common bacterial form of cytidylate kinase described by IPR003136 from INTERPRO.; GO: 0004127 cytidylate kinase activity, 0005524 ATP binding, 0006139 nucleobase nucleoside nucleotide and nucleic acid metabolic process.
Probab=98.07  E-value=3.1e-06  Score=66.06  Aligned_cols=59  Identities=34%  Similarity=0.505  Sum_probs=49.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECHHHH
Q ss_conf             599860565650279999997708824998618888888835632001456712899999832788739999331554
Q gi|254780270|r  368 ILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKM  445 (820)
Q Consensus       368 il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~ldeidk~  445 (820)
                      |+..-||||.||||+||.||+-|+.+|  ||=|-+|+-|+=+|           +=++..+++...|      ||||.
T Consensus         2 ~I~ISGpPGSGktTvA~~lA~~Lsl~~--iSaG~iRelA~~~G-----------ldl~E~~~aee~~------eIDk~   60 (173)
T TIGR02173         2 IITISGPPGSGKTTVAKILAEKLSLKL--ISAGDIRELAEKMG-----------LDLAESKYAEENP------EIDKK   60 (173)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCE--ECCCHHHHHHHHCC-----------CCHHHHHHHCCCC------CCCHH
T ss_conf             788735896864789999998639831--20200788986429-----------8877734430586------31167


No 190
>pfam03266 DUF265 Protein of unknown function, DUF265.
Probab=98.07  E-value=5.4e-06  Score=64.20  Aligned_cols=121  Identities=23%  Similarity=0.374  Sum_probs=68.0

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCCC------EEE--EECCCCCC---------H-----HHH---CCCC----CCCCCCC
Q ss_conf             9986056565027999999770882------499--86188888---------8-----883---5632----0014567
Q gi|254780270|r  369 LCFVGPPGVGKTSLAQSIAKATGRQ------YVR--MSLGGVYD---------E-----ADI---RGHR----RTYIGSM  419 (820)
Q Consensus       369 l~l~gppgvGKts~~~sia~al~r~------f~~--islgg~~d---------~-----~~i---~gh~----~ty~ga~  419 (820)
                      +.+.||||+|||++.+-+++.|...      |+.  +--+|.|-         .     |..   .++|    ..++.+.
T Consensus         2 i~ITG~pGvGKTTli~kv~~~l~~~~~~v~GF~T~evre~g~R~GF~iv~l~~g~~~~la~~~~~~~~~vGky~v~~~~f   81 (168)
T pfam03266         2 IFITGPPGVGKTTLVKKVIELLKSEGVKVGGFYTPEVREGGRRIGFDIVDLASGERGPLARVGGVSGPRVGKYVVNLEEF   81 (168)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCEECCCCEEEEEEEECCCCCEEEEEEECCCCCCCCCCCEECHHHH
T ss_conf             89978999889999999999998679707489930212589378999999047826774440688775457716668999


Q ss_pred             CHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECC--C-CCCCH
Q ss_conf             12899999832788739999331554231177115566554060016813320103523644279999348--6-55441
Q gi|254780270|r  420 PGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTAN--T-LNIPL  496 (820)
Q Consensus       420 pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan--~-~~i~~  496 (820)
                      ....+.+|+++-...-++++|||.||-... -.-..|+.++||+..                  -.++|-.  + ...-.
T Consensus        82 e~~~~~~L~~a~~~~dlivIDEIG~mEl~s-~~F~~~v~~~l~~~~------------------~vl~ti~~~~~~~~v~  142 (168)
T pfam03266        82 EEIALPALRRALEEADLIIIDEIGPMELKS-PKFREAIEEVLSSNK------------------PVLAVVHRRSDSPLVE  142 (168)
T ss_pred             HHHHHHHHHHCCCCCCEEEEECCCHHHHHH-HHHHHHHHHHHCCCC------------------CEEEEEEECCCCHHHH
T ss_conf             999999998406689899997631453314-999999999966999------------------7999997258983899


Q ss_pred             HHCCC--EEEEEEC
Q ss_conf             31172--4799825
Q gi|254780270|r  497 PLMDR--MEIIRIA  508 (820)
Q Consensus       497 ~l~dr--me~i~~~  508 (820)
                      .++.|  .+++++.
T Consensus       143 ~i~~~~d~~i~~vt  156 (168)
T pfam03266       143 RIRRRPDVKIFVVT  156 (168)
T ss_pred             HHHCCCCCEEEEEC
T ss_conf             97417993899978


No 191
>KOG0742 consensus
Probab=98.06  E-value=7.3e-05  Score=55.66  Aligned_cols=199  Identities=29%  Similarity=0.419  Sum_probs=111.2

Q ss_pred             HHHHHHHHHHHCC------------CCCCC-CCCCCHHHHHHHHHHHHHHCHHH-----HHHHHHHHHHHHHHCC-CCCC
Q ss_conf             8999998765404------------15876-63221068899877665201168-----9999999999998424-4467
Q gi|254780270|r  306 SVVRNYLDWLLGV------------PWDKK-SKTKKNLDFAIRILDQDHFGLEK-----VKERIIEYLAVQMRVI-KNKG  366 (820)
Q Consensus       306 ~v~r~Yld~~~~l------------PW~~~-t~~~~dl~~a~~iLd~~hyGl~~-----vK~rile~lav~~~~~-~~~g  366 (820)
                      .|+-.|+|-++.-            ||.-. +.-..-|+..+...-.-.--|+.     .-++=||-||.-.-|. ..++
T Consensus       303 ~V~w~yi~r~LGqPSLiREsSrg~~pw~gsls~~k~~i~~~~~~s~~gk~pl~~ViL~psLe~Rie~lA~aTaNTK~h~a  382 (630)
T KOG0742         303 LVTWRYIERRLGQPSLIRESSRGRFPWIGSLSALKHPIQGSRSASSRGKDPLEGVILHPSLEKRIEDLAIATANTKKHQA  382 (630)
T ss_pred             HHHHHHHHHHCCCCHHHHHHCCCCCCCCCCHHHHHCHHHHHHHHHHCCCCCCCCEECCHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             02899999872884233332046687735099985543777877635777767841277799999999887404300243


Q ss_pred             CE--EEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCH-HHHHHHHHCCCCC--EEEEEEC
Q ss_conf             35--99860565650279999997708824998618888888835632001456712-8999998327887--3999933
Q gi|254780270|r  367 LI--LCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPG-RIIQSLKRAKRSN--PLLLLDE  441 (820)
Q Consensus       367 ~i--l~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg-~ii~~l~~~~~~n--pv~~lde  441 (820)
                      |.  +.|+||||+|||-.|+++|.--|.-|.-+.=|-|   |-        .|+.-= +|-+-.--++.+|  -+.++||
T Consensus       383 pfRNilfyGPPGTGKTm~ArelAr~SGlDYA~mTGGDV---AP--------lG~qaVTkiH~lFDWakkS~rGLllFIDE  451 (630)
T KOG0742         383 PFRNILFYGPPGTGKTMFARELARHSGLDYAIMTGGDV---AP--------LGAQAVTKIHKLFDWAKKSRRGLLLFIDE  451 (630)
T ss_pred             HHHHEEEECCCCCCHHHHHHHHHHHCCCCEEHHCCCCC---CC--------CHHHHHHHHHHHHHHHHHCCCCEEEEEHH
T ss_conf             04400324799986049999998852874100137875---55--------21788999999878875156644998611


Q ss_pred             HHHH----HHHCCC-CHHHHHHHHC--CCCCCCCEEEEECCCCCCCCCEEEEEECCCC-CCCHHHCCC-EEEEEECCCCH
Q ss_conf             1554----231177-1155665540--6001681332010352364427999934865-544131172-47998258786
Q gi|254780270|r  442 IDKM----GSDLRG-DPSAALLEVL--DPAQNSSFVDHYLEVEYDLSDVMFIMTANTL-NIPLPLMDR-MEIIRIAGYTE  512 (820)
Q Consensus       442 idk~----~~~~~g-dp~~allevl--dp~qn~~f~d~y~~~~~dls~v~fi~tan~~-~i~~~l~dr-me~i~~~~y~~  512 (820)
                      -|-.    ++++-. |--|||=-+|  --+|-.              +++.+...|-. +.+.+.-|| =|+|+++=--.
T Consensus       452 ADAFLceRnktymSEaqRsaLNAlLfRTGdqSr--------------divLvlAtNrpgdlDsAV~DRide~veFpLPGe  517 (630)
T KOG0742         452 ADAFLCERNKTYMSEAQRSALNALLFRTGDQSR--------------DIVLVLATNRPGDLDSAVNDRIDEVVEFPLPGE  517 (630)
T ss_pred             HHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCC--------------CEEEEEECCCCCCHHHHHHHHHHHHEECCCCCH
T ss_conf             678998752010258899999889876256554--------------268996058832101678765554130689977


Q ss_pred             HHHHHHHHHHHHHHHHH
Q ss_conf             89998999860898998
Q gi|254780270|r  513 EEKLQIAKNHLVKKVLT  529 (820)
Q Consensus       513 ~ek~~i~~~~l~p~~~~  529 (820)
                      +|...+.+-||-.-+.+
T Consensus       518 EERfkll~lYlnkyi~~  534 (630)
T KOG0742         518 EERFKLLNLYLNKYILK  534 (630)
T ss_pred             HHHHHHHHHHHHHHHCC
T ss_conf             89999999999998147


No 192
>PRK08116 hypothetical protein; Validated
Probab=98.06  E-value=7.5e-05  Score=55.58  Aligned_cols=104  Identities=24%  Similarity=0.298  Sum_probs=57.5

Q ss_pred             HHHHHHHHHHHHHHCC-CCCCCEEEEECCCCCCHHHHHHHHHHHHCC---CEEEEECCCCCCHHHHCCCCCCCCCC---C
Q ss_conf             9999999999998424-446735998605656502799999977088---24998618888888835632001456---7
Q gi|254780270|r  347 VKERIIEYLAVQMRVI-KNKGLILCFVGPPGVGKTSLAQSIAKATGR---QYVRMSLGGVYDEADIRGHRRTYIGS---M  419 (820)
Q Consensus       347 vK~rile~lav~~~~~-~~~g~il~l~gppgvGKts~~~sia~al~r---~f~~islgg~~d~~~i~gh~~ty~ga---~  419 (820)
                      +.+--..|.  ..+.. ...+.-|.|.||||||||.||-+||+.|-.   +...++...     .+.--+.||-..   .
T Consensus        90 a~~~a~~Y~--~~f~~~~~~~~GLll~G~~GtGKThLa~aIa~~l~~~g~~V~~~~~~~-----ll~~lk~~~~~~~~~~  162 (262)
T PRK08116         90 AYKVAVKYV--KKFEEMKKESVGLLLWGSPGNGKTYLAAAIANELIEKGVPVVFVNVPE-----LLNRIKSTYNSEGKED  162 (262)
T ss_pred             HHHHHHHHH--HHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHHH-----HHHHHHHHHHCCCCHH
T ss_conf             999999999--989873646861899898999899999999999998799399988999-----9999999986356101


Q ss_pred             CHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCC
Q ss_conf             12899999832788739999331554231177115566554060
Q gi|254780270|r  420 PGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDP  463 (820)
Q Consensus       420 pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp  463 (820)
                      -..+++.+.+    -||.+||++.+-..+-  --.+.|.+|+|-
T Consensus       163 ~~e~l~~l~~----~dLLIiDDlG~e~~t~--w~~e~lf~IIn~  200 (262)
T PRK08116        163 ENEIIRALDN----ADLLILDDLGAEKDTE--WVREKLYNIIDS  200 (262)
T ss_pred             HHHHHHHHHC----CCEEEEEHHCCCCCCH--HHHHHHHHHHHH
T ss_conf             9999998612----9989983221456987--899999999999


No 193
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]
Probab=98.05  E-value=5.3e-05  Score=56.70  Aligned_cols=177  Identities=21%  Similarity=0.274  Sum_probs=104.2

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECHHH
Q ss_conf             67359986056565027999999770882499861888888883563200145671289999983278873999933155
Q gi|254780270|r  365 KGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDK  444 (820)
Q Consensus       365 ~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~ldeidk  444 (820)
                      ..+-|-|+||.|.|||.|..+|+.........-..=.+..+.+..    .+|-|.-..=++.+|+-= .--+.++|.|+-
T Consensus       112 ~~nplfi~G~~GlGKTHLl~Aign~~~~~~~~a~v~y~~se~f~~----~~v~a~~~~~~~~Fk~~y-~~dlllIDDiq~  186 (408)
T COG0593         112 AYNPLFIYGGVGLGKTHLLQAIGNEALANGPNARVVYLTSEDFTN----DFVKALRDNEMEKFKEKY-SLDLLLIDDIQF  186 (408)
T ss_pred             CCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEECCHHHHHH----HHHHHHHHHHHHHHHHHH-CCCEEEECHHHH
T ss_conf             689579987999978999999999998629986488504899899----999998850488888764-267355513867


Q ss_pred             HHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCC----CC-CCHHHCCCEE---EEEECCCCHHHHH
Q ss_conf             42311771155665540600168133201035236442799993486----55-4413117247---9982587868999
Q gi|254780270|r  445 MGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANT----LN-IPLPLMDRME---IIRIAGYTEEEKL  516 (820)
Q Consensus       445 ~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~----~~-i~~~l~drme---~i~~~~y~~~ek~  516 (820)
                      ++..-+-  .-++.++             |+-=.+-.+ --|.|+..    ++ +.+-|+.|++   ++++.+...+.++
T Consensus       187 l~gk~~~--qeefFh~-------------FN~l~~~~k-qIvltsdr~P~~l~~~~~rL~SR~~~Gl~~~I~~Pd~e~r~  250 (408)
T COG0593         187 LAGKERT--QEEFFHT-------------FNALLENGK-QIVLTSDRPPKELNGLEDRLRSRLEWGLVVEIEPPDDETRL  250 (408)
T ss_pred             HCCCHHH--HHHHHHH-------------HHHHHHCCC-EEEEECCCCCHHHCCCCHHHHHHHHCEEEEEECCCCHHHHH
T ss_conf             5677157--9999999-------------998885088-79997078832211035889989863057752798889999


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             8999860898998625781313228999999973177410234788879999898765
Q gi|254780270|r  517 QIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVT  574 (820)
Q Consensus       517 ~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~  574 (820)
                      .|.++     .     .....+.++++++.++.++.++.  ||+|+..+..+.+.+..
T Consensus       251 aiL~k-----k-----a~~~~~~i~~ev~~~la~~~~~n--vReLegaL~~l~~~a~~  296 (408)
T COG0593         251 AILRK-----K-----AEDRGIEIPDEVLEFLAKRLDRN--VRELEGALNRLDAFALF  296 (408)
T ss_pred             HHHHH-----H-----HHHCCCCCCHHHHHHHHHHHHCC--HHHHHHHHHHHHHHHHH
T ss_conf             99999-----9-----98658888879999999970030--99999999999999985


No 194
>KOG1514 consensus
Probab=98.03  E-value=0.00054  Score=49.09  Aligned_cols=181  Identities=24%  Similarity=0.389  Sum_probs=120.5

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHC--------CCEEEEECCCCCCH----------HHHCCCCCCCCCCCCHHHH
Q ss_conf             44673599860565650279999997708--------82499861888888----------8835632001456712899
Q gi|254780270|r  363 KNKGLILCFVGPPGVGKTSLAQSIAKATG--------RQYVRMSLGGVYDE----------ADIRGHRRTYIGSMPGRII  424 (820)
Q Consensus       363 ~~~g~il~l~gppgvGKts~~~sia~al~--------r~f~~islgg~~d~----------~~i~gh~~ty~ga~pg~ii  424 (820)
                      ..-|.++-..|-||+|||-....+-+.|.        ++|..+-+.|++=.          ..+-|||-|..-||     
T Consensus       419 ~~~g~~mYIsGvPGtGKT~tV~~Vm~~Lq~~s~~~e~p~f~yveINgm~l~~~~~~Y~~I~~~lsg~~~~~~~al-----  493 (767)
T KOG1514         419 QGLGSCMYISGVPGTGKTATVLEVMKELQTSSAQKELPKFDYVEINGLRLASPREIYEKIWEALSGERVTWDAAL-----  493 (767)
T ss_pred             CCCCEEEEEECCCCCCCEEHHHHHHHHHHHHHHHCCCCCCCEEEECCEEECCHHHHHHHHHHHCCCCCCCHHHHH-----
T ss_conf             777407998469998832129999999998775057898607987144615889999999997555743077889-----


Q ss_pred             HHHH------HCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCCCCHHH
Q ss_conf             9998------3278873999933155423117711556655406001681332010352364427999934865544131
Q gi|254780270|r  425 QSLK------RAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLNIPLPL  498 (820)
Q Consensus       425 ~~l~------~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~i~~~l  498 (820)
                      ++|.      +.+-.-.|+|+||+|-+-...+    ..|..++|=            .-.-=|+...||-||+.+.|+-+
T Consensus       494 ~~L~~~f~~~k~~~~~~VvLiDElD~Lvtr~Q----dVlYn~fdW------------pt~~~sKLvvi~IaNTmdlPEr~  557 (767)
T KOG1514         494 EALNFRFTVPKPKRSTTVVLIDELDILVTRSQ----DVLYNIFDW------------PTLKNSKLVVIAIANTMDLPERL  557 (767)
T ss_pred             HHHHHHHCCCCCCCCCEEEEECCHHHHHCCCH----HHHHHHHCC------------CCCCCCCEEEEEECCCCCCHHHH
T ss_conf             99986541678787877999635787735209----889777407------------76789866999951656477988


Q ss_pred             CC-----C--EEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             17-----2--4799825878689998999860898998625781313228999999973177410234788879999898
Q gi|254780270|r  499 MD-----R--MEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARK  571 (820)
Q Consensus       499 ~d-----r--me~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~  571 (820)
                      +-     |  .-.|.+.+||.++--+|...-          |+.. -.|.++|++.+-.+-+.=+|  ...| --.|||.
T Consensus       558 l~nrvsSRlg~tRi~F~pYth~qLq~Ii~~R----------L~~~-~~f~~~aielvarkVAavSG--DaRr-aldic~R  623 (767)
T KOG1514         558 LMNRVSSRLGLTRICFQPYTHEQLQEIISAR----------LKGL-DAFENKAIELVARKVAAVSG--DARR-ALDICRR  623 (767)
T ss_pred             HCCCHHHHCCCEEEECCCCCHHHHHHHHHHH----------CCCH-HHCCHHHHHHHHHHHHHCCC--CHHH-HHHHHHH
T ss_conf             5431123306505513778899999999986----------0315-43142489999988775042--2788-8899899


Q ss_pred             HHHHHHCC
Q ss_conf             76542117
Q gi|254780270|r  572 AVTKIVKN  579 (820)
Q Consensus       572 ~~~~~~~~  579 (820)
                      ++ ++.+.
T Consensus       624 A~-Eia~~  630 (767)
T KOG1514         624 AA-EIAEE  630 (767)
T ss_pred             HH-HHHHH
T ss_conf             99-97542


No 195
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit ClpA; InterPro: IPR013461    Proteins in this entry are related to ClpA () from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins..
Probab=98.02  E-value=0.00011  Score=54.36  Aligned_cols=295  Identities=24%  Similarity=0.396  Sum_probs=175.5

Q ss_pred             CHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHC-----------CCEEEEECCCCCCHHHHCCC
Q ss_conf             1168999999999999842444673599860565650279999997708-----------82499861888888883563
Q gi|254780270|r  343 GLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATG-----------RQYVRMSLGGVYDEADIRGH  411 (820)
Q Consensus       343 Gl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~-----------r~f~~islgg~~d~~~i~gh  411 (820)
                      |=|+.=||.|+-|+ |..+++.     .|||-||||||.|+...|...-           -+-+..+||.+==.+     
T Consensus       212 GRE~EleRtiQvLC-RR~KNNP-----l~VGEPGVGKTAI~EGLA~~I~~~~kvPe~Lkn~~IY~LDmG~LLAGT-----  280 (774)
T TIGR02639       212 GREDELERTIQVLC-RRKKNNP-----LLVGEPGVGKTAIVEGLAQRIAEGQKVPEVLKNAKIYSLDMGTLLAGT-----  280 (774)
T ss_pred             CCHHHHHHHHHHHC-CCCCCCC-----CEECCCCCCHHHHHHHHHHHHHCCCCCCHHHCCCCEEEECHHHHHHHC-----
T ss_conf             56688742333203-4567887-----204488864489999999986415646700247834540434564102-----


Q ss_pred             CCCCCCCCCHHHHHHHHH-CCCCCE-EEEEECHHHH-HH--HCCC--CHHHHHHH-HCCCCCCCCEEEEECCCCCCCCCE
Q ss_conf             200145671289999983-278873-9999331554-23--1177--11556655-406001681332010352364427
Q gi|254780270|r  412 RRTYIGSMPGRIIQSLKR-AKRSNP-LLLLDEIDKM-GS--DLRG--DPSAALLE-VLDPAQNSSFVDHYLEVEYDLSDV  483 (820)
Q Consensus       412 ~~ty~ga~pg~ii~~l~~-~~~~np-v~~ldeidk~-~~--~~~g--dp~~alle-vldp~qn~~f~d~y~~~~~dls~v  483 (820)
                        =|-|=--.||=+-+.. .++.|+ |.++|||--| |.  +--|  | ||=||- +|-.                 .++
T Consensus       281 --KYRGDFE~RLK~V~~Ei~~~~~anILFIDEIHTIVGAGATSGGsmD-ASNLLKPaL~~-----------------G~i  340 (774)
T TIGR02639       281 --KYRGDFEERLKAVVSEIEKEPNANILFIDEIHTIVGAGATSGGSMD-ASNLLKPALAS-----------------GKI  340 (774)
T ss_pred             --CCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCEEECCCCCCHHHH-HHHHHHHHHHC-----------------CCE
T ss_conf             --4542478999999999852899954664110103317878751552-44321125307-----------------877


Q ss_pred             EEE--EECCC---C-CCCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHH---CC--
Q ss_conf             999--93486---5-5441311724799825878689998999860898998625781313228999999973---17--
Q gi|254780270|r  484 MFI--MTANT---L-NIPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIR---LF--  552 (820)
Q Consensus       484 ~fi--~tan~---~-~i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~---~Y--  552 (820)
                      =||  +|+.-   . +-+.||-=|.-=|+++=-|.+|=++|-+.  |..+.|++    -+|+.+++||+.-++   .|  
T Consensus       341 RCIGsTTy~EY~~~FeKDrALsRRFQKIDv~EPs~eet~~ILkG--Lk~~YE~f----H~V~Y~~eal~~Av~LS~ryI~  414 (774)
T TIGR02639       341 RCIGSTTYEEYKNHFEKDRALSRRFQKIDVGEPSIEETVKILKG--LKEQYEEF----HHVKYSDEALEAAVELSARYIN  414 (774)
T ss_pred             EEECCCCHHHHHCHHHCCCCCCCCCCEECCCCCCHHHHHHHHHH--HHHHHHCC----CCEECCHHHHHHHHHHHHHHCC
T ss_conf             86226524864111010202165423311795788899999986--55420132----5011386999999999888602


Q ss_pred             -------------------------C----------------CCCHHHHHHHHHHHHHHHHHHHH--------HC-----
Q ss_conf             -------------------------7----------------41023478887999989876542--------11-----
Q gi|254780270|r  553 -------------------------T----------------HEAGVRSFERALMKIARKAVTKI--------VK-----  578 (820)
Q Consensus       553 -------------------------t----------------~EaGvR~l~r~i~~i~r~~~~~~--------~~-----  578 (820)
                                               +                -|-+|++.|+.|+++|+-=...+        ++     
T Consensus       415 DRfLPDKAIDviDEaGA~~~l~~~~~~~~~eadekGleetalPev~~~diE~vvak~a~iP~~~~s~ddD~~~L~~L~~~  494 (774)
T TIGR02639       415 DRFLPDKAIDVIDEAGAAFRLRAKAKKKANEADEKGLEETALPEVNVKDIEEVVAKMAKIPVKTVSSDDDREKLKNLEKE  494 (774)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCHHHCCCCCCCCCCCCHHHHHHHHHHHHCCCCEEECCCHHHHHHHHHHHH
T ss_conf             57898543228899999999712027764320112530004787854449999988718994154264479887204476


Q ss_pred             ---------------------------CCCCEE---------CCC----HHHHHHHHCCC--CCCCCCHHC--------C
Q ss_conf             ---------------------------785201---------279----67867530520--003320002--------2
Q gi|254780270|r  579 ---------------------------NSDTTV---------SIN----ENNLQDYLGVP--RYKYGKIEG--------E  608 (820)
Q Consensus       579 ---------------------------~~~~~~---------~i~----~~~l~~~lg~~--~~~~~~~~~--------~  608 (820)
                                                 ++.+|+         =|.    .+.|.+.||.+  ||+..-..+        .
T Consensus       495 L~~kIfGQD~AI~~lv~aiK~SrAGl~~~nkP~GSFLF~GPTGVGKTElak~LA~~LGv~l~RFDMSEYmEKHTVsRLIG  574 (774)
T TIGR02639       495 LKAKIFGQDEAIEQLVSAIKRSRAGLGEPNKPVGSFLFVGPTGVGKTELAKQLAEELGVHLLRFDMSEYMEKHTVSRLIG  574 (774)
T ss_pred             HHCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCHHCCCCCHHHHHHHHHHHHHC
T ss_conf             30131515899999999999987424778881688886479896257889999997082001046504468999987416


Q ss_pred             CCCCCCCEEEECCCC---CEEEEEEEE-EEC-------------------------------CCCC--------EEECCC
Q ss_conf             336500000000016---807999999-974-------------------------------8997--------244325
Q gi|254780270|r  609 DQVGIVTGLAWTEVG---GEILTVEGV-IMP-------------------------------GKGE--------ITITGN  645 (820)
Q Consensus       609 ~~~G~v~GLa~t~~G---G~~l~IE~~-~~~-------------------------------g~g~--------l~lTG~  645 (820)
                      ++||.        +|   |+.|. ||+ ++|                               .+|+        |+.|=|
T Consensus       575 sPPGY--------VGfEqGGLLT-~AvrK~P~cVLLLDEIEKAHpDI~NILLQVMD~AtLTDN~GrKaDFRNVILIMTSN  645 (774)
T TIGR02639       575 SPPGY--------VGFEQGGLLT-DAVRKHPHCVLLLDEIEKAHPDIYNILLQVMDYATLTDNNGRKADFRNVILIMTSN  645 (774)
T ss_pred             CCCCC--------CCCCCCCCCH-HHHCCCCCEEEHHHHHHHHHHHHHHHHHHHHCCCEEECCCCCEEEECCEEEEECCC
T ss_conf             88885--------1316777212-23312885354234666631336667876633543405888576311368884037


Q ss_pred             HHHHHHHHHHHHHHHHHHHHH-------HCCCCHHHHHHCCCEEECC
Q ss_conf             689999999999999999888-------6299855742078147448
Q gi|254780270|r  646 LKEIMKESILAASSYVRSKAT-------TFGIIPSAFNEINIHVHVP  685 (820)
Q Consensus       646 lg~vmkES~~~A~s~~k~~~~-------~~~~~~~~~~~~diHih~p  685 (820)
                      .|  .+|.++..+.|......       +---.|+|-.+-|==|||-
T Consensus       646 aG--a~E~~~~~iGF~~~~~~~~~~~Aikk~F~PEFRNRLDaii~F~  690 (774)
T TIGR02639       646 AG--AREMSKNPIGFGGERVEDKSEKAIKKLFSPEFRNRLDAIIAFN  690 (774)
T ss_pred             CC--CCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECC
T ss_conf             00--1023677644255541233488897315874201334644169


No 196
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]
Probab=97.97  E-value=0.00015  Score=53.21  Aligned_cols=88  Identities=24%  Similarity=0.452  Sum_probs=55.5

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHCCC---EEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEEC
Q ss_conf             67359986056565027999999770882---499861888888883563200145671289999983278873999933
Q gi|254780270|r  365 KGLILCFVGPPGVGKTSLAQSIAKATGRQ---YVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDE  441 (820)
Q Consensus       365 ~g~il~l~gppgvGKts~~~sia~al~r~---f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~lde  441 (820)
                      ++.=++|+||||||||.||-+||..|-+.   ...+.....  -.+++.-+.-  |....++...|+++    +|.+|||
T Consensus       104 ~~~nl~l~G~~G~GKthLa~Ai~~~l~~~g~sv~f~~~~el--~~~Lk~~~~~--~~~~~~l~~~l~~~----dlLIiDD  175 (254)
T COG1484         104 RGENLVLLGPPGVGKTHLAIAIGNELLKAGISVLFITAPDL--LSKLKAAFDE--GRLEEKLLRELKKV----DLLIIDD  175 (254)
T ss_pred             CCCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHHHH--HHHHHHHHHC--CCHHHHHHHHHHHC----CEEEEEC
T ss_conf             58828998999987999999999999983984999885999--9999998745--52689999887528----9899823


Q ss_pred             HHHHHHHCCCCHHHHHHHHCC
Q ss_conf             155423117711556655406
Q gi|254780270|r  442 IDKMGSDLRGDPSAALLEVLD  462 (820)
Q Consensus       442 idk~~~~~~gdp~~allevld  462 (820)
                      |-....+..  .++-++++++
T Consensus       176 lG~~~~~~~--~~~~~~q~I~  194 (254)
T COG1484         176 IGYEPFSQE--EADLLFQLIS  194 (254)
T ss_pred             CCCCCCCCH--HHHHHHHHHH
T ss_conf             677668815--5879999999


No 197
>PRK13695 putative NTPase; Provisional
Probab=97.95  E-value=1.4e-05  Score=61.15  Aligned_cols=94  Identities=30%  Similarity=0.443  Sum_probs=60.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCC------E--------------EEEEC-CCCCCH-------HHHC-CCCCCCCCC
Q ss_conf             59986056565027999999770882------4--------------99861-888888-------8835-632001456
Q gi|254780270|r  368 ILCFVGPPGVGKTSLAQSIAKATGRQ------Y--------------VRMSL-GGVYDE-------ADIR-GHRRTYIGS  418 (820)
Q Consensus       368 il~l~gppgvGKts~~~sia~al~r~------f--------------~~isl-gg~~d~-------~~i~-gh~~ty~ga  418 (820)
                      -+.+.||||||||+|.+-|.+.|...      |              .-+++ +|-+..       +..| |.-..++.+
T Consensus         5 kI~iTG~PGvGKTTli~Kv~~~L~~~g~~v~GF~T~Evre~G~R~GF~vv~l~~g~~~~lA~~~~~~~~~VgkY~V~~~~   84 (174)
T PRK13695          5 RIGITGMPGVGKTTLVLKIAELLAREGYKVGGFITEEVREGGKRIGFKIIDLDTGEEGILARVGAVSRPRVGKYVVNLED   84 (174)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEEEEEECCCEEEEEEEEECCCCCEEEEEECCCCCCCCCCCEEEEHHH
T ss_conf             99987899988999999999998636961746995256038828505999905885687675378898554566871689


Q ss_pred             CCHHHHHHHHHCCCCCEEEEEECHHHH---HHHCCCCHHHHHHHHCCCCC
Q ss_conf             712899999832788739999331554---23117711556655406001
Q gi|254780270|r  419 MPGRIIQSLKRAKRSNPLLLLDEIDKM---GSDLRGDPSAALLEVLDPAQ  465 (820)
Q Consensus       419 ~pg~ii~~l~~~~~~npv~~ldeidk~---~~~~~gdp~~allevldp~q  465 (820)
                      .-...+.+|.+|-...-++++|||.||   |..|    ..|+.++||+..
T Consensus        85 ~e~~~~~~l~~a~~~~dlivIDEIG~MEl~s~~F----~~~V~~~L~s~k  130 (174)
T PRK13695         85 LERIAIPAISRALREADLIIIDEIGPMELKSKKF----VSAVEEVLKSEK  130 (174)
T ss_pred             HHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHH----HHHHHHHHCCCC
T ss_conf             7899899998353578799996310331104999----999999973899


No 198
>PRK07276 DNA polymerase III subunit delta'; Validated
Probab=97.94  E-value=6.7e-05  Score=55.95  Aligned_cols=162  Identities=15%  Similarity=0.214  Sum_probs=94.3

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCE--EEEECCCCCCHHHH--CCCC-CCCCCC
Q ss_conf             168999999999999842444673599860565650279999997708824--99861888888883--5632-001456
Q gi|254780270|r  344 LEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQY--VRMSLGGVYDEADI--RGHR-RTYIGS  418 (820)
Q Consensus       344 l~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f--~~islgg~~d~~~i--~gh~-~ty~ga  418 (820)
                      +.+.-.+|++++ ...+..+.-+....|.|  |+||+.+|+.+|++|.-.-  -..+.|-.+.-.-|  ..|. -+++..
T Consensus         3 ~~~~Qp~i~~~l-~~~i~~~rl~HAyLf~G--~~Gk~~~A~~~A~~l~C~~~~~~~pCg~C~~C~~i~~~~hpDv~~i~~   79 (290)
T PRK07276          3 LAQKQPKLFQRF-QTILEQDRLNHAYLFSG--DFASFEMALFLAQSLFCEQKEDVLPCGHCRSCRLIEQGDFSDVTVIEP   79 (290)
T ss_pred             HHHHHHHHHHHH-HHHHHCCCCCEEEECCC--CCCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHCCCCCCCEEECC
T ss_conf             778789999999-99998499650542169--868799999999998189999989898899999987699987137716


Q ss_pred             CCHH--------HHHHHHHCC--CCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEE
Q ss_conf             7128--------999998327--887399993315542311771155665540600168133201035236442799993
Q gi|254780270|r  419 MPGR--------IIQSLKRAK--RSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMT  488 (820)
Q Consensus       419 ~pg~--------ii~~l~~~~--~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~t  488 (820)
                      ..-.        +++.+....  ...-|+++|+.|||+..    .++|||-.|.             -|-  ++++||..
T Consensus        80 ~~~~I~vd~IR~l~~~~~~~~~~g~~KV~II~~Ad~mt~~----AaNaLLK~LE-------------EPp--~~t~~iLl  140 (290)
T PRK07276         80 QGQVIKTDTIRELTANFSQSGYEGKRQVFIIKDADKMHVN----AANSLLKVIE-------------EPQ--SEIYIFLL  140 (290)
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCCCCEEEEEECCHHHCCHH----HHHHHHHHHC-------------CCC--CCCEEEEE
T ss_conf             7775768899999999844561378279997765652999----9999999703-------------898--88379988


Q ss_pred             CCCCC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             48655-44131172479982587868999899986089899862578131
Q gi|254780270|r  489 ANTLN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEE  537 (820)
Q Consensus       489 an~~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~  537 (820)
                      +++.+ +++..+.|--+|+++. ..+        ++ -+.+++.|+.+.+
T Consensus       141 t~~~~~lLpTI~SRCQ~i~fp~-~~~--------~l-~~~l~~~gi~~~~  180 (290)
T PRK07276        141 TNDENKVLPTIKSRTQIFHFPK-NEA--------YL-YQLLEEKGLLKTQ  180 (290)
T ss_pred             ECCHHHCCHHHHHCCCCCCCCC-CHH--------HH-HHHHHHCCCCHHH
T ss_conf             7992549378873660102899-679--------99-9999986998679


No 199
>KOG2227 consensus
Probab=97.94  E-value=0.00084  Score=47.61  Aligned_cols=210  Identities=20%  Similarity=0.309  Sum_probs=112.0

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHH---CCCEEEEECCCCC--CHHH-----------HCCCCCCCCCCCCHHHHHHH
Q ss_conf             467359986056565027999999770---8824998618888--8888-----------35632001456712899999
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKAT---GRQYVRMSLGGVY--DEAD-----------IRGHRRTYIGSMPGRIIQSL  427 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al---~r~f~~islgg~~--d~~~-----------i~gh~~ty~ga~pg~ii~~l  427 (820)
                      .++--|-..|-||+|||-.-.-+-..+   .+.|+++++.-+.  -..-           ..+-..|      |  +|-+
T Consensus       173 ~t~gSlYVsG~PGtgkt~~l~rvl~~~~~~~~~~~~v~inc~sl~~~~aiF~kI~~~~~q~~~s~~~------~--~~~~  244 (529)
T KOG2227         173 NTSGSLYVSGQPGTGKTALLSRVLDSLSKSSKSPVTVYINCTSLTEASAIFKKIFSSLLQDLVSPGT------G--MQHL  244 (529)
T ss_pred             CCCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHCCCCH------H--HHHH
T ss_conf             6676457517998654889999987403431665169985123542588999998889887428950------4--7899


Q ss_pred             HH-----CCCCCE-EEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCCCCHH----
Q ss_conf             83-----278873-99993315542311771155665540600168133201035236442799993486554413----
Q gi|254780270|r  428 KR-----AKRSNP-LLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLNIPLP----  497 (820)
Q Consensus       428 ~~-----~~~~np-v~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~i~~~----  497 (820)
                      .+     .+..+| |++|||+|-+...-++    +|+++.-      |      -.+-.|+.+.|--||+++.-.-    
T Consensus       245 ~~~~~h~~q~k~~~llVlDEmD~L~tr~~~----vLy~lFe------w------p~lp~sr~iLiGiANslDlTdR~Lpr  308 (529)
T KOG2227         245 EKFEKHTKQSKFMLLLVLDEMDHLITRSQT----VLYTLFE------W------PKLPNSRIILIGIANSLDLTDRFLPR  308 (529)
T ss_pred             HHHHHHHHCCCCEEEEEECHHHHHHHCCCC----EEEEEHH------C------CCCCCCEEEEEEEHHHHHHHHHHHHH
T ss_conf             999998752563389872125677604653----1432100------1------36776605666400135577777666


Q ss_pred             HCCCE----EEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             11724----79982587868999899986089899862578131322899999997317741023478887999989876
Q gi|254780270|r  498 LMDRM----EIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAV  573 (820)
Q Consensus       498 l~drm----e~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~  573 (820)
                      |.-|.    .++.+++||.++-++|.+.-|-         ......|-+.|++..+..-.--+|  +| |..-.|||. |
T Consensus       309 L~~~~~~~P~~l~F~PYTk~qI~~Il~~rl~---------~~~t~~~~~~Aie~~ArKvaa~SG--Dl-RkaLdv~R~-a  375 (529)
T KOG2227         309 LNLDLTIKPKLLVFPPYTKDQIVEILQQRLS---------EESTSIFLNAAIELCARKVAAPSG--DL-RKALDVCRR-A  375 (529)
T ss_pred             HHHCCCCCCCEEEECCCCHHHHHHHHHHHHH---------CCCCCCCCHHHHHHHHHHHCCCCH--HH-HHHHHHHHH-H
T ss_conf             5402578874665568788999999999974---------054433303899999998625761--28-999999987-8


Q ss_pred             HHHHCCCCCEECCCHHHHHHHHCCCCCCCCCHHCC-CCCCCCCEEEECC
Q ss_conf             54211785201279678675305200033200022-3365000000000
Q gi|254780270|r  574 TKIVKNSDTTVSINENNLQDYLGVPRYKYGKIEGE-DQVGIVTGLAWTE  621 (820)
Q Consensus       574 ~~~~~~~~~~~~i~~~~l~~~lg~~~~~~~~~~~~-~~~G~v~GLa~t~  621 (820)
                      .++++-+.....      .+    +. ..-..+.+ .+||+..+.++.+
T Consensus       376 iEI~E~e~r~~~------~~----~l-~~~~~p~~~~~v~~~~va~viS  413 (529)
T KOG2227         376 IEIAEIEKRKIL------DD----PL-SPGTSPEKKKKVGVEHVAAVIS  413 (529)
T ss_pred             HHHHHHHHHHCC------CC----CC-CCCCCCCCCCCCCHHHHHHHHH
T ss_conf             899999874134------46----78-8888855455500678998840


No 200
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones]
Probab=97.92  E-value=0.00033  Score=50.73  Aligned_cols=151  Identities=28%  Similarity=0.401  Sum_probs=121.0

Q ss_pred             CEEEEEEEEEECCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHCCCEEECCCCCCCCCCCCHHHHHHHH
Q ss_conf             80799999997489972443256899999999999999998886299855742078147448888478887306899999
Q gi|254780270|r  624 GEILTVEGVIMPGKGEITITGNLKEIMKESILAASSYVRSKATTFGIIPSAFNEINIHVHVPEGATPKDGPSAGIAMATA  703 (820)
Q Consensus       624 G~~l~IE~~~~~g~g~l~lTG~lg~vmkES~~~A~s~~k~~~~~~~~~~~~~~~~diHih~p~Ga~pKDGPSAGi~i~ta  703 (820)
                      +..+.||+...+|...+.+-|.-..-||||-.    -||+-...-+.   .|...-|-|+.-=...||.|+.=...|+.+
T Consensus         2 a~~V~VEv~~s~glp~~~iVGL~d~av~Esre----RVraal~nsgf---~~P~~ritiNLaPadl~KeG~~fDLpIal~   74 (490)
T COG0606           2 APPVEVEVDISNGLPGFTIVGLPDTAVKESRE----RVRAALTNSGF---EFPAKRITINLAPADLPKEGSRFDLPIALG   74 (490)
T ss_pred             CCCCCEEEEECCCCCCCEEEECCCHHHHHHHH----HHHHHHHHCCC---CCCHHHEEECCCCCCCCCCCCCCCHHHHHH
T ss_conf             97422388733897650364068177899999----99989874678---887678031157100254465344699999


Q ss_pred             HHHHHHCCC--CCCCCEEEEEEEECCEEEEECCHHHHHHHHHHCCCCEEECCHHHHHHHHHCCHHHHCCCEEEECCCHHH
Q ss_conf             999983688--875610663685030250006568999999970996998036775507761488770979998193999
Q gi|254780270|r  704 IVSIMTCIP--VYKNVAMTGELTLRGRVLPIGGLKEKLLAALRAGVTKVLIPEENIKDLMDIPENVKNGLEIIPVSFMGE  781 (820)
Q Consensus       704 l~S~~~~~~--v~~~iAmTGEitl~G~VlpiGGi~eK~laA~raGi~~viiP~~N~~d~~~ip~~~~~~l~~~~v~~~~e  781 (820)
                      ++.+.-..|  .-.+..+-||++|.|.+.||+|+--=.++|+.-+.+.+++|++|...-.-|     .++.+.+++++.|
T Consensus        75 ilaa~~~~~~~~l~~~~~lGEL~LdG~l~~v~G~lp~~~~a~~~~~~~~i~p~~n~~Easli-----~~~~v~~~~~l~e  149 (490)
T COG0606          75 ILAASGQLPADALILYEFLGELSLDGLLRPVGGVLPAALAAKEKGKRGLIVPKENAEEASLI-----GGLPVYGARYLEE  149 (490)
T ss_pred             HHHHCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCCCEECCHHCCCCCCCC-----CCCCCCCHHHHHH
T ss_conf             99742666413455577653341167522567711558887531578277241114403445-----8887253302999


Q ss_pred             HHHHH
Q ss_conf             88876
Q gi|254780270|r  782 VLKHA  786 (820)
Q Consensus       782 vl~~a  786 (820)
                      |.++-
T Consensus       150 v~~~l  154 (490)
T COG0606         150 VVNFL  154 (490)
T ss_pred             HHHHH
T ss_conf             99986


No 201
>PRK07952 DNA replication protein DnaC; Validated
Probab=97.91  E-value=0.00023  Score=51.81  Aligned_cols=86  Identities=21%  Similarity=0.369  Sum_probs=50.8

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHC---CCEEEEECCCCCCHHHHCCCCCCCCCC--CCHHHHHHHHHCCCCCEEEEEE
Q ss_conf             73599860565650279999997708---824998618888888835632001456--7128999998327887399993
Q gi|254780270|r  366 GLILCFVGPPGVGKTSLAQSIAKATG---RQYVRMSLGGVYDEADIRGHRRTYIGS--MPGRIIQSLKRAKRSNPLLLLD  440 (820)
Q Consensus       366 g~il~l~gppgvGKts~~~sia~al~---r~f~~islgg~~d~~~i~gh~~ty~ga--~pg~ii~~l~~~~~~npv~~ld  440 (820)
                      ..-|.|.||||||||.||-+||++|=   .+...++...+     +.--+.||-.+  ..-.++..+.    .-++.+||
T Consensus        96 ~~gLlF~G~~GTGKThLA~aIan~Li~~G~sVlf~t~~dL-----l~~lr~t~~~~~~~e~~~l~~l~----~~dLLIiD  166 (242)
T PRK07952         96 IASFIFSGKPGTGKNHLAAAICNELLLRGKSVLIITVADI-----MSAMKDTFRNSETSEEQLLNDLS----NVDLLVID  166 (242)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHHHH-----HHHHHHHHHCCCCCHHHHHHHHH----CCCEEEEE
T ss_conf             8717997899997899999999999987994999779999-----99999998068756999999863----18989873


Q ss_pred             CHHHHHHHCCCCHH-HHHHHHCCC
Q ss_conf             31554231177115-566554060
Q gi|254780270|r  441 EIDKMGSDLRGDPS-AALLEVLDP  463 (820)
Q Consensus       441 eidk~~~~~~gdp~-~allevldp  463 (820)
                      |+..-..   -+.+ ..|-+++|-
T Consensus       167 dlG~e~~---t~~~~~~lf~iId~  187 (242)
T PRK07952        167 EIGVQTE---SRYEKVIINQIVDR  187 (242)
T ss_pred             CCCCCCC---CHHHHHHHHHHHHH
T ss_conf             0146658---88899999999999


No 202
>TIGR00678 holB DNA polymerase III, delta' subunit; InterPro: IPR004622   DNA-directed DNA polymerase (2.7.7.7 from EC) catalyzes DNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time. DNA polymerase III is a complex, multi-chain enzyme responsible for most of the replicative synthesis in bacteria. The enzyme also has 3' to 5' exonuclease activity. It has a core composed of alpha, epsilon and theta chains, that associate with a tau subunit which allows the core dimerisation to form the PolIII' complex. PolIII' associates with the gamma complex (gamma, delta, delta', psi and chi chains) and with the beta chain. This domain is the N-terminal half of the delta' subunit of DNA polymerase III. Delta' is homologous to the gamma and tau subunits, which form an outgroup for phylogenetic comparison. The gamma/tau branch of the tree is much more tightly conserved than the delta' branch, and some members of that branch score more highly against this model than some proteins classified as delta'. The noise cut-off is set to detect weakly scoring delta' subunits rather than to exclude gamma/tau subunits.; GO: 0003887 DNA-directed DNA polymerase activity, 0008408 3'-5' exonuclease activity, 0006260 DNA replication.
Probab=97.90  E-value=0.00011  Score=54.36  Aligned_cols=144  Identities=23%  Similarity=0.317  Sum_probs=90.9

Q ss_pred             HHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCC------------------------EEEEECCCCC-----CHH--
Q ss_conf             984244467359986056565027999999770882------------------------4998618888-----888--
Q gi|254780270|r  358 QMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQ------------------------YVRMSLGGVY-----DEA--  406 (820)
Q Consensus       358 ~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~------------------------f~~islgg~~-----d~~--  406 (820)
                      ..+..+.-+.-++|.||+|+||..+|..+|++|-=.                        |.+|.==|..     |++  
T Consensus         6 ~~~~~~r~~HA~LF~G~~G~Gk~~~A~~~A~~l~C~~~~~~~~Cg~C~~C~~~~~G~HPD~~~~~P~~~~~~~~~de~~~   85 (216)
T TIGR00678         6 RALEKGRLAHAYLFTGPEGVGKELLALALAKALLCEPRGGGEPCGECHSCRLIEAGNHPDLHRLEPEGQSKSLTADEAAE   85 (216)
T ss_pred             HHHHCCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHCCCCCEEEEEEECCCCCCCHHHHHH
T ss_conf             89860678861254448887489999999999807785778888858889998707998237874234777777645897


Q ss_pred             -HHCC----CCCCCCCCCCH-HHHHHHHHCC--CCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCC
Q ss_conf             -8356----32001456712-8999998327--88739999331554231177115566554060016813320103523
Q gi|254780270|r  407 -DIRG----HRRTYIGSMPG-RIIQSLKRAK--RSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEY  478 (820)
Q Consensus       407 -~i~g----h~~ty~ga~pg-~ii~~l~~~~--~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~  478 (820)
                       +. |    --+++|+--== -+++-+-+..  ...=|++||.-|+|+..    -|+|||-+|             |-|=
T Consensus        86 ~~~-g~a~~~~~~~Ik~dq~R~l~~~~~~~~~~~~~rVviI~~Ae~mn~~----AANALLKtL-------------EEPp  147 (216)
T TIGR00678        86 GEE-GSAKRRALPQIKVDQVRELVEFLSLTPQESGRRVVIIEDAERMNEA----AANALLKTL-------------EEPP  147 (216)
T ss_pred             HHC-CCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEECCHHHCCHH----HHHHHHHHE-------------ECCC
T ss_conf             625-6421136787872789999999860642147517997673232589----898651010-------------1279


Q ss_pred             CCCCEEEEEECCCC--C-CCHHHCCCEEEEEECCCCHHHHHHHHHH
Q ss_conf             64427999934865--5-4413117247998258786899989998
Q gi|254780270|r  479 DLSDVMFIMTANTL--N-IPLPLMDRMEIIRIAGYTEEEKLQIAKN  521 (820)
Q Consensus       479 dls~v~fi~tan~~--~-i~~~l~drme~i~~~~y~~~ek~~i~~~  521 (820)
                        .+++||..+++.  + |-+.++.|=-++.++.-+.++=.++-.+
T Consensus       148 --~~t~fiL~~~~~DP~~lLpTI~SRCq~~~f~~l~~~~~~~~L~~  191 (216)
T TIGR00678       148 --PNTLFILITHSPDPERLLPTIRSRCQVLPFPPLSEEALLQWLIE  191 (216)
T ss_pred             --CCEEEEEECCCCCHHHHCCCCCCCEEEEEECCCCHHHHHHHHHH
T ss_conf             --87079885088884332211103201586259988999999997


No 203
>PRK08699 DNA polymerase III subunit delta'; Validated
Probab=97.90  E-value=7.8e-05  Score=55.45  Aligned_cols=134  Identities=22%  Similarity=0.331  Sum_probs=86.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCC--EE-EEECCCCCCHHHH-C-CCCCC-CCCC-----CCHH-----HHHHH
Q ss_conf             467359986056565027999999770882--49-9861888888883-5-63200-1456-----7128-----99999
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQ--YV-RMSLGGVYDEADI-R-GHRRT-YIGS-----MPGR-----IIQSL  427 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~--f~-~islgg~~d~~~i-~-gh~~t-y~ga-----~pg~-----ii~~l  427 (820)
                      .-+--+.|.||.|+||+++|+.+|++|-=.  .. -.+.|-..+=.-+ . .|--- ++..     --|+     =|..+
T Consensus        19 rl~HA~L~~Gp~G~Gk~~~A~~~A~~llC~~~~~~~~~Cg~C~sC~~~~~g~HPD~~~i~p~~~~~~~g~~~~~I~idqi   98 (325)
T PRK08699         19 RRPNAWLFVGKKGTGKTAFARFAAKALLCETPAPGCKPCGECMSCHLFGQGSHPDFYEITPLADEPENGRKLLQIKIDAV   98 (325)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCHHHH
T ss_conf             50117975799997899999999999828999888998988888999865999996885134453001665566769999


Q ss_pred             HH---------CCCCCEEEEEECHHHHHHHCCCCHHHHHHHHC-CCCCCCCEEEEECCCCCCCCCEEEEEECCCCC-CCH
Q ss_conf             83---------27887399993315542311771155665540-60016813320103523644279999348655-441
Q gi|254780270|r  428 KR---------AKRSNPLLLLDEIDKMGSDLRGDPSAALLEVL-DPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPL  496 (820)
Q Consensus       428 ~~---------~~~~npv~~ldeidk~~~~~~gdp~~allevl-dp~qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~  496 (820)
                      +.         .....=|+++|+.|+|+.    .-++|||..| .|.                ++++||.+++..+ +++
T Consensus        99 R~l~~~~~~~~~~~~~kV~ii~~ae~mn~----~aaNaLLK~LEEPp----------------~~~~fiL~t~~~~~llp  158 (325)
T PRK08699         99 REIIDNVYLTSVRGGLRVILIHPAESMNV----QAANSLLKVLEEPP----------------PQVVFLLVSHAADKVLP  158 (325)
T ss_pred             HHHHHHHCCCCCCCCCEEEEECCHHHHCH----HHHHHHHHHHCCCC----------------CCEEEEEEECCHHHCCC
T ss_conf             99999971086568946999857777589----99999999841788----------------88489998798464623


Q ss_pred             HHCCCEEEEEECCCCHHHHHH
Q ss_conf             311724799825878689998
Q gi|254780270|r  497 PLMDRMEIIRIAGYTEEEKLQ  517 (820)
Q Consensus       497 ~l~drme~i~~~~y~~~ek~~  517 (820)
                      .++.|--.+.++.-+.++-..
T Consensus       159 TI~SRc~~~~~~~p~~~~~~~  179 (325)
T PRK08699        159 TIKSRCRKMVLPAPSHEEALA  179 (325)
T ss_pred             HHHHCCCCCCCCCCCHHHHHH
T ss_conf             398645421089959999999


No 204
>pfam05673 DUF815 Protein of unknown function (DUF815). This family consists of several bacterial proteins of unknown function.
Probab=97.90  E-value=0.0014  Score=45.92  Aligned_cols=178  Identities=21%  Similarity=0.308  Sum_probs=118.7

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHC---CCEEEEECCCCCCHHHHCCCCCCC
Q ss_conf             65201168999999999999842444673599860565650279999997708---824998618888888835632001
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATG---RQYVRMSLGGVYDEADIRGHRRTY  415 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~---r~f~~islgg~~d~~~i~gh~~ty  415 (820)
                      ++-.|.++-|+.+++-.  ........+.-.+|.|.-|+||+|+.|++.....   ...+.|+-.              .
T Consensus        28 ~~L~Gie~Qk~~l~~NT--~~F~~G~pAnnvLLwG~RGtGKSSlVKall~~~~~~gLrlIEv~k~--------------~   91 (248)
T pfam05673        28 DDLVGIDRQKEALLRNT--EQFLAGLPANNVLLWGARGTGKSSLVKALLNEYADQGLRLIEVDKD--------------D   91 (248)
T ss_pred             HHHCCHHHHHHHHHHHH--HHHHCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEECHH--------------H
T ss_conf             89349399999999999--9998089861367676898988899999999863149569998788--------------8


Q ss_pred             CCCCCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCH-HHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCC-
Q ss_conf             45671289999983278873999933155423117711-5566554060016813320103523644279999348655-
Q gi|254780270|r  416 IGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDP-SAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN-  493 (820)
Q Consensus       416 ~ga~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp-~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~-  493 (820)
                      ++.+| .|+..|+... ..=++++|.+   |-+ .+|+ +.+|--+||-.           +.-.-++|+|-+|.|--+ 
T Consensus        92 L~~Lp-~i~~~l~~~~-~kFIiF~DDL---SFe-~~d~~yk~LKs~LeG~-----------l~~~p~NvliYaTSNRRHL  154 (248)
T pfam05673        92 LGDLP-DIVDLLRGRP-YRFILFCDDL---SFE-EGESSYKALKSVLEGG-----------LEARPDNVLIYATSNRRHL  154 (248)
T ss_pred             HCCHH-HHHHHHHCCC-CCEEEEECCC---CCC-CCCHHHHHHHHHHCCC-----------CCCCCCEEEEEEECCCHHC
T ss_conf             72199-9999996499-7579996355---767-8973699999996576-----------4468873899984270003


Q ss_pred             CCHHHCCCEEEEE-ECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHH
Q ss_conf             4413117247998-2587868999899986089899862578131322899999997317741023
Q gi|254780270|r  494 IPLPLMDRMEIIR-IAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGV  558 (820)
Q Consensus       494 i~~~l~drme~i~-~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGv  558 (820)
                      ||.-..||..-=+ -++=+.+||+..+-+|         ||.-.--.++.+.-..|+++|...-|+
T Consensus       155 i~e~~~d~~~~~ei~~~d~~eEklSLsDRF---------GL~l~F~~~~q~~YL~IV~~~~~~~~~  211 (248)
T pfam05673       155 IPEYMSDNEGDGEIHPGDAVEEKLSLSDRF---------GLWLGFHPFDQDEYLAIVRGYAARLGL  211 (248)
T ss_pred             CCHHHCCCCCCCCCCCCHHHHHHHHHHHHC---------CEEEEECCCCHHHHHHHHHHHHHHCCC
T ss_conf             633323477744367255777453489867---------717850799999999999999998299


No 205
>pfam03215 Rad17 Rad17 cell cycle checkpoint protein.
Probab=97.89  E-value=0.00036  Score=50.42  Aligned_cols=112  Identities=26%  Similarity=0.384  Sum_probs=63.0

Q ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEE----ECCCCCCHH---HHCCCCCCCCCCCCHHHHH--------
Q ss_conf             2444673599860565650279999997708824998----618888888---8356320014567128999--------
Q gi|254780270|r  361 VIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRM----SLGGVYDEA---DIRGHRRTYIGSMPGRIIQ--------  425 (820)
Q Consensus       361 ~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~i----slgg~~d~~---~i~gh~~ty~ga~pg~ii~--------  425 (820)
                      .+..+..||.|.||||+|||+..+-+|+.||-....-    +.++...+.   +.+|..-++--+.--.+-.        
T Consensus        40 ~~~~~~~iLlLtGPaG~GKTTTI~lLAkeLG~ei~EW~NP~~~~~~~~~~q~~d~~g~~~~~~~S~~~~F~eFLlr~~ky  119 (490)
T pfam03215        40 LESNKQLILLLTGPSGCGKSTTVKVLSKELGIEIIEWSNPEYLHNPDNECQKPDFRGDCIVNSLSQMEQFREFLLRGARY  119 (490)
T ss_pred             CCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCEEEEECCCCCCCCCCCHHHCCCCCCCCCCCCCCHHHHHHHHHHHCCCC
T ss_conf             47777318998798998899999999997596899814865456775022101212345766663777767887622335


Q ss_pred             -HHHHCCCCCEEEEEECHHHHHHHCCCCHH---HHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEEC
Q ss_conf             -99832788739999331554231177115---56655406001681332010352364427999934
Q gi|254780270|r  426 -SLKRAKRSNPLLLLDEIDKMGSDLRGDPS---AALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTA  489 (820)
Q Consensus       426 -~l~~~~~~npv~~ldeidk~~~~~~gdp~---~allevldp~qn~~f~d~y~~~~~dls~v~fi~ta  489 (820)
                       .|...+..--|||++|+.   ..+.+|+.   .+|++.|-..+.              +-+.||.|-
T Consensus       120 ~sL~~~~~~kriILIEE~P---n~~~~d~~~fr~~L~~~L~s~~~--------------~PlV~IiSE  170 (490)
T pfam03215       120 GSLQGGGLKKKLILVEELP---NQFYSDAEKFREVIREVLQSIWH--------------LPLIFCLTE  170 (490)
T ss_pred             CCCCCCCCCCEEEEEECCC---CCCCCCHHHHHHHHHHHHHHCCC--------------CCEEEEEEE
T ss_conf             6544578873599996588---74423669999999999970899--------------987999970


No 206
>PRK13406 bchD magnesium chelatase subunit D; Provisional
Probab=97.89  E-value=0.00064  Score=48.52  Aligned_cols=191  Identities=14%  Similarity=0.212  Sum_probs=117.3

Q ss_pred             HHHHHCCC-CCCCEEEEECCCCCCHHHHHHHHHHHH--CCCEEEEECC--------CCCCHHHHC-CCCCCCCCCCCHHH
Q ss_conf             99984244-467359986056565027999999770--8824998618--------888888835-63200145671289
Q gi|254780270|r  356 AVQMRVIK-NKGLILCFVGPPGVGKTSLAQSIAKAT--GRQYVRMSLG--------GVYDEADIR-GHRRTYIGSMPGRI  423 (820)
Q Consensus       356 av~~~~~~-~~g~il~l~gppgvGKts~~~sia~al--~r~f~~islg--------g~~d~~~i~-gh~~ty~ga~pg~i  423 (820)
                      .+...+|. ..|  +++-|++|++|.++.+.++.-|  +.||+++.+|        |+.=++-++ |++..    .||-+
T Consensus        16 ~L~aidP~glGG--vlirg~~Gtakst~~r~l~~llp~~~p~~~lPl~~tedrl~G~lDi~~tL~~G~~v~----~~GLL   89 (584)
T PRK13406         16 ALFAVDPAGLGG--VVLRARAGPVRDRWLAALRALLPAGTPLRRLPPGIADDRLLGGLDLAATLRAGRPVA----ERGLL   89 (584)
T ss_pred             HHHCCCCCCCCC--EEEECCCCCHHHHHHHHHHHHCCCCCCEEECCCCCCHHHHCCCCCHHHHHHCCCEEC----CCCHH
T ss_conf             984848666551--899779995799999999975689998465699997415147125999997689852----57533


Q ss_pred             HHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCC--C--CCHHHC
Q ss_conf             999983278873999933155423117711556655406001681332010352364427999934865--5--441311
Q gi|254780270|r  424 IQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTL--N--IPLPLM  499 (820)
Q Consensus       424 i~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~--~--i~~~l~  499 (820)
                            +++.+.|+++||+..+..+.    .+.||.++|--.|.-=+|-- .+.. -++..+|+|.|..  +  .|+.|+
T Consensus        90 ------a~A~~gvLyvdevnll~d~l----v~~Ll~a~~~G~~~vEReGi-S~~~-parf~LIa~deg~e~de~~~~~l~  157 (584)
T PRK13406         90 ------AEADGGVLVLAMAERLEPGT----AARLAAALDAGEVAIERDGL-ALRM-PARFGLVALDEGAEEDERAPAALA  157 (584)
T ss_pred             ------HCCCCCEEEEECHHHCCHHH----HHHHHHHHHCCCCCCCCCCC-CCCC-CCEEEEEEECCCCCCCCCHHHHHH
T ss_conf             ------30369989985147378889----99999998548740025876-6356-650589994678876431107888


Q ss_pred             CCEEE-EEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHH
Q ss_conf             72479-9825878689998999860898998625781313228999999973177410234788879999
Q gi|254780270|r  500 DRMEI-IRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKI  568 (820)
Q Consensus       500 drme~-i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i  568 (820)
                      ||+-. +.+.+....+.-.-   -..+..+...--.-.+|.++++.+.++..- +...||-.+.-.|..+
T Consensus       158 dRla~~vd~~~~~~~~~~~~---~~~~~~i~~Ar~~L~~V~i~d~~~~~l~~~-a~~~gv~g~Ra~i~~~  223 (584)
T PRK13406        158 DRLAFHLDLDGLALRDTREF---PIDADDIAAARARLAAVRVPPEAIEALCAA-AAALGIASLRAPLLAL  223 (584)
T ss_pred             HHHCCCCCHHHHHHHHHHHH---HHHHHHHHHHHHHCCCCCCCHHHHHHHHHH-HHHHCCCCCCHHHHHH
T ss_conf             76507068167666640111---123689999998678666699999999999-9983998620999999


No 207
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit; InterPro: IPR012804   Cobalamin (vitamin B12) can be complexed with metal via ATP-dependent reactions (aerobic pathway) (e.g., in Pseudomonas denitrificans) or via ATP-independent reactions (anaerobic pathway) (e.g., in Salmonella typhimurium) , . The corresponding cobalt chelatases are not homologous.   Cobaltochelatase is responsible for the insertion of cobalt into the corrin ring of coenzyme B12 during its biosynthesis. Two versions have been well described. CbiK/CbiX is a monomeric, anaerobic version which acts early in the biosynthesis (IPR010388 from INTERPRO). CobNST is a trimeric, ATP-dependent, aerobic version which acts late in the biosynthesis, (IPR011953 from INTERPRO, IPR006537 from INTERPRO, IPR006538 from INTERPRO) .    The two pathways differ in the point of cobalt insertion during corrin ring formation . There are apparently a number of variations on these two pathways, where the major differences seem to be concerned with the process of ring contraction .   Cobaltochelatase shows similarities with magnesium chelatase, which is also a complex ATP-dependent enzyme made up of two separable components. However, unlike the situation in cobaltochelatase, one of these two components is membrane bound in magnesium chelatase . .
Probab=97.87  E-value=0.00029  Score=51.08  Aligned_cols=181  Identities=24%  Similarity=0.392  Sum_probs=121.7

Q ss_pred             CHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHC-------------------------------
Q ss_conf             1168999999999999842444673599860565650279999997708-------------------------------
Q gi|254780270|r  343 GLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATG-------------------------------  391 (820)
Q Consensus       343 Gl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~-------------------------------  391 (820)
                      |.|+.|.=.|    +...+|+..|=+  .-|.=||||++.|+|++.-|=                               
T Consensus         8 GQe~LK~ALL----L~Av~P~iGGVL--irG~KGTAKSTaaR~L~~LLP~i~~v~gC~f~cdP~~P~~~C~~C~~~~~~~   81 (688)
T TIGR02442         8 GQEDLKLALL----LNAVNPRIGGVL--IRGEKGTAKSTAARGLAALLPDIDVVAGCPFSCDPDDPEEWCEECRRKLEEQ   81 (688)
T ss_pred             CHHHHHHHHH----HEEECCCCCEEE--EECCCCCHHHHHHHHHHHHCCHHHHHCCCCCCCCCCCCCCCCHHHHHHHHCC
T ss_conf             4279865321----002526637078--8778886278988848761602366404788877788704006767555204


Q ss_pred             ---------CCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHH----------CCCCCEEEEEECHHHHHHHCCCC
Q ss_conf             ---------82499861888888883563200145671289999983----------27887399993315542311771
Q gi|254780270|r  392 ---------RQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKR----------AKRSNPLLLLDEIDKMGSDLRGD  452 (820)
Q Consensus       392 ---------r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~----------~~~~npv~~ldeidk~~~~~~gd  452 (820)
                               -+||-+.||=..|         =-||++=  |=++|+.          |+..+.|+|+|||-=        
T Consensus        82 G~~~~~~~~~~~V~LPlgATED---------RVvG~LD--i~~al~~G~~~FqPGLLA~AhrGiLYiDEVNL--------  142 (688)
T TIGR02442        82 GTLPSEQRPVPFVNLPLGATED---------RVVGSLD--IERALKEGEKAFQPGLLAEAHRGILYIDEVNL--------  142 (688)
T ss_pred             CCCCCCCCCCEEEECCCCCCHH---------HHCCHHH--HHHHHHHCHHHHCCCCHHHHCCCEEEEEEECC--------
T ss_conf             7753135873588658775233---------2213054--89998718566078861754687167852001--------


Q ss_pred             HHHHHHHHCCCCCCCCEEEEECCCCCC------------------CCCEEEEEECCCCC--CCHHHCCCEE-EEEECCC-
Q ss_conf             155665540600168133201035236------------------44279999348655--4413117247-9982587-
Q gi|254780270|r  453 PSAALLEVLDPAQNSSFVDHYLEVEYD------------------LSDVMFIMTANTLN--IPLPLMDRME-IIRIAGY-  510 (820)
Q Consensus       453 p~~allevldp~qn~~f~d~y~~~~~d------------------ls~v~fi~tan~~~--i~~~l~drme-~i~~~~y-  510 (820)
                                      +.|||+|+=.|                  =|..+-|.|+|-..  .=+=|+||+= .|++.+- 
T Consensus       143 ----------------LdDhlVD~lLDaaA~G~n~VEREG~S~~Hparf~L~GTMNPEEG~LRPQLLDRFGL~V~v~~~~  206 (688)
T TIGR02442       143 ----------------LDDHLVDVLLDAAAMGVNRVEREGLSVSHPARFVLIGTMNPEEGDLRPQLLDRFGLCVDVAASR  206 (688)
T ss_pred             ----------------CCCHHHHHHHHHHHCCCEEEEECCCCHHCHHHHHHHCCCCCCHHHHCHHHHHHHHCEEEECCCC
T ss_conf             ----------------4414778999987648006763574300114553220378522110223242440115502435


Q ss_pred             CHHHHHHHHHHHHHH--------------------HHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             868999899986089--------------------89986257813132289999999731774102347888799
Q gi|254780270|r  511 TEEEKLQIAKNHLVK--------------------KVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALM  566 (820)
Q Consensus       511 ~~~ek~~i~~~~l~p--------------------~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~  566 (820)
                      ..++.++|.++=|-=                    ++..-=.+ =..|.|+|+.+.+| ..-|++.||....=.|.
T Consensus       207 d~~~R~Ev~~Rrl~~d~dP~~F~~~~~~~~~~L~~~I~~AR~l-Lp~V~l~d~~~~~I-~~lc~~~~V~GhRAdi~  280 (688)
T TIGR02442       207 DPEERVEVIRRRLAFDADPEAFAARWAAEQEELRERIAAARSL-LPSVRLSDSLLRFI-SELCIEFGVDGHRADIV  280 (688)
T ss_pred             CHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHH-CCCCCCCHHHHHHH-HHHHHHCCCCCCHHHHH
T ss_conf             8668999999997540267788999999999999999999975-47765888999999-99999728885259999


No 208
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed
Probab=97.85  E-value=4.9e-05  Score=56.97  Aligned_cols=75  Identities=19%  Similarity=0.337  Sum_probs=51.0

Q ss_pred             HHHCCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCC
Q ss_conf             53110257899999876540415876632210688998776652011689999999999998424446735998605656
Q gi|254780270|r  298 MNPLSAESSVVRNYLDWLLGVPWDKKSKTKKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGV  377 (820)
Q Consensus       298 m~~~s~E~~v~r~Yld~~~~lPW~~~t~~~~dl~~a~~iLd~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgv  377 (820)
                      -.+.|||+.++|.+|+-.          ....              +..|++.+-+.+..  -....+.+-|||+|.+|.
T Consensus        91 ~~~~~~~~~~~~~~l~~~----------~~~~--------------~~~~~~~l~~~~~~--~~~~~~~~rIaLIGlmGa  144 (304)
T PRK08154         91 EDTSSPDWPLIRELLEQA----------TPAQ--------------LARARDALSGMLGT--GGGAARRPRIALIGLRGA  144 (304)
T ss_pred             CCCCCHHHHHHHHHHHCC----------CHHH--------------HHHHHHHHHHHHCC--CCCCCCCCCEEEECCCCC
T ss_conf             888881289999998518----------9999--------------99999998763023--766677784798899999


Q ss_pred             CHHHHHHHHHHHHCCCEEEEE
Q ss_conf             502799999977088249986
Q gi|254780270|r  378 GKTSLAQSIAKATGRQYVRMS  398 (820)
Q Consensus       378 GKts~~~sia~al~r~f~~is  398 (820)
                      |||++|+-+|+.||.||+-..
T Consensus       145 GKSTvGr~LA~~Lg~pFvDlD  165 (304)
T PRK08154        145 GKSTLGRMLAARLGVPFVELN  165 (304)
T ss_pred             CHHHHHHHHHHHHCCCEEECH
T ss_conf             888999999999598977877


No 209
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR013462    The GvpN protein is associated with the production of gas vesicles produced in some prokaryotes to give cells buoyancy , . It belongs to a larger family of ATPases .; GO: 0000166 nucleotide binding, 0005524 ATP binding, 0031412 gas vesicle organization and biogenesis, 0031411 gas vesicle.
Probab=97.85  E-value=2.7e-05  Score=58.93  Aligned_cols=206  Identities=25%  Similarity=0.416  Sum_probs=120.8

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCC--HHHHCCCCCC-------
Q ss_conf             1689999999999998424446735998605656502799999977088249986188888--8883563200-------
Q gi|254780270|r  344 LEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYD--EADIRGHRRT-------  414 (820)
Q Consensus       344 l~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d--~~~i~gh~~t-------  414 (820)
                      .++|..|-+.||.+        |.=+-|.||.|+||||||..+|+.++||-+-|.  |=++  .+++-|--+-       
T Consensus         7 v~~v~~R~l~yL~~--------G~PvHl~GPaG~GKT~LA~hvA~~r~RPV~l~~--Gd~eL~~~DLvG~~~g~~~~kv~   76 (265)
T TIGR02640         7 VKRVTSRALRYLKS--------GYPVHLRGPAGTGKTTLAMHVARKRDRPVVLIN--GDAELTTSDLVGSYAGYTRKKVV   76 (265)
T ss_pred             HHHHHHHHHHHHCC--------CCCEEEECCCCCCHHHHHHHHHHHCCCCEEEEE--CCCCCCCCCCCCCCCCCEEEEEE
T ss_conf             79999987663227--------886674478885568999999973689689986--58232654423154675222232


Q ss_pred             --CCCC------------CCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHH--HHHHHHC------CCCCCCCEEEE
Q ss_conf             --1456------------712899999832788739999331554231177115--5665540------60016813320
Q gi|254780270|r  415 --YIGS------------MPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPS--AALLEVL------DPAQNSSFVDH  472 (820)
Q Consensus       415 --y~ga------------~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~--~allevl------dp~qn~~f~d~  472 (820)
                        ||-+            .=+|...|.+..=    -..-||.      .|.-|.  +.||-||      =|  -+.-.+.
T Consensus        77 DqfihnV~K~~d~~~~~W~D~rLt~Av~eG~----TLVYdEF------~RskP~~nNVLLSvlEE~vL~LP--g~~~~~~  144 (265)
T TIGR02640        77 DQFIHNVVKLEDIVRQNWVDNRLTLAVREGF----TLVYDEF------TRSKPETNNVLLSVLEEGVLELP--GKRGESR  144 (265)
T ss_pred             ECCEEEEECCCCCCCCCCCCCHHHHHHHCCC----EEEECCC------CCCCCHHHHHHHHHHHHHHHCCC--CCCCCCC
T ss_conf             0121113425122002667835789975697----2766475------78862045656755552321588--8787787


Q ss_pred             ECCCCCCCCCEEEEEECCCC------CCCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHH
Q ss_conf             10352364427999934865------544131172479982587868999899986089899862578131322899999
Q gi|254780270|r  473 YLEVEYDLSDVMFIMTANTL------NIPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLL  546 (820)
Q Consensus       473 y~~~~~dls~v~fi~tan~~------~i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~  546 (820)
                      |+.|-=++=   -|+|.|+.      +-..+|+||+=.|.++=|=..-.++|+..+               ..+.++-..
T Consensus       145 Yv~VhP~FR---~IfTSNp~EYAGVh~~QDALlDRL~ti~~D~~D~~~e~ai~~~~---------------t~~~~~~a~  206 (265)
T TIGR02640       145 YVDVHPEFR---VIFTSNPVEYAGVHETQDALLDRLVTISMDYPDEDTETAILRAK---------------TDVAEESAA  206 (265)
T ss_pred             CEEECCCCC---EEECCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHH---------------HCCCHHHHH
T ss_conf             225788702---46314870105767716677664400457854447899999986---------------061246789


Q ss_pred             HHHHCCCCCCHHHH---HHHHHHHHHHHHHHHHHC---CCCCEECCCHHHHHH
Q ss_conf             99731774102347---888799998987654211---785201279678675
Q gi|254780270|r  547 DIIRLFTHEAGVRS---FERALMKIARKAVTKIVK---NSDTTVSINENNLQD  593 (820)
Q Consensus       547 ~ii~~Yt~EaGvR~---l~r~i~~i~r~~~~~~~~---~~~~~~~i~~~~l~~  593 (820)
                      .||.-- |  -+|+   ++..-+-- -++++.+++   ..+-++..+...+.+
T Consensus       207 ~IV~lv-~--~~R~a~g~e~~~Gl~-~RA~lMiA~~at~~dipv~~d~~~f~~  255 (265)
T TIGR02640       207 TIVRLV-R--ELRLASGDEKTSGLS-LRASLMIAEVATQEDIPVDVDDEDFVD  255 (265)
T ss_pred             HHHHHH-H--HHHHHCCCCCCCCHH-HHHHHHHHHHHHHCCCCCCCCHHHHHH
T ss_conf             999999-9--984212553337436-899999998754437986776025778


No 210
>PRK06620 hypothetical protein; Validated
Probab=97.82  E-value=0.0011  Score=46.73  Aligned_cols=164  Identities=18%  Similarity=0.245  Sum_probs=90.3

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECHHHH
Q ss_conf             73599860565650279999997708824998618888888835632001456712899999832788739999331554
Q gi|254780270|r  366 GLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKM  445 (820)
Q Consensus       366 g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~ldeidk~  445 (820)
                      ...+.++||+|-|||.|++..++--+-.+  ++      +...           +..+.   .    ...++++|.+|+.
T Consensus        44 ~~~l~I~Gp~gSGKTHL~~i~~~~~~a~~--~~------~~~~-----------~~~~~---~----~~~~~iiddid~~   97 (214)
T PRK06620         44 KFTLLIKGPSSSGKTYLTKIWQNLSNAYI--IK------DIFF-----------NEEIL---E----KYNAFIIEDIENW   97 (214)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHCCEE--EC------HHHC-----------CHHHH---H----HCCCEEEECCCCC
T ss_conf             55599987999988999999999828588--15------1214-----------58788---4----3793798467757


Q ss_pred             HHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCC--CCCCHH-HCCC---EEEEEECCCCHHHHHHHH
Q ss_conf             2311771155665540600168133201035236442799993486--554413-1172---479982587868999899
Q gi|254780270|r  446 GSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANT--LNIPLP-LMDR---MEIIRIAGYTEEEKLQIA  519 (820)
Q Consensus       446 ~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~--~~i~~~-l~dr---me~i~~~~y~~~ek~~i~  519 (820)
                      .       ..+|.|+..--+.              ++...+.|++.  .++.-| |+.|   +.++++..-..+.+..+.
T Consensus        98 ~-------e~~lfhlfN~~~~--------------~~~~llits~~~p~~~~L~DL~SRl~~~~~~~i~~PdD~l~~~ll  156 (214)
T PRK06620         98 Q-------EPALLHIFNIINE--------------KQKYLLLTSSDKSRNFTLPDLSSRIKSVLSILLNSPDDELIKILI  156 (214)
T ss_pred             C-------HHHHHHHHHHHHH--------------CCCEEEEEECCCCCCCCCCCHHHHHHCCCEEECCCCCHHHHHHHH
T ss_conf             4-------6799999999971--------------598799982798522453578999854644332698989999999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHH
Q ss_conf             9860898998625781313228999999973177410234788879999898765421178520127967867530
Q gi|254780270|r  520 KNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDTTVSINENNLQDYL  595 (820)
Q Consensus       520 ~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~l  595 (820)
                      .++          +...++.++++++.||+.+..|.  .+.+.+.+..|-+....+       .-.||-..+.+.|
T Consensus       157 ~k~----------~~~r~i~i~~~vi~yl~~ri~Rs--~~~l~~~v~~ld~~sl~~-------kr~Iti~likevL  213 (214)
T PRK06620        157 FKH----------FSISSVTISRQIIDFLLVNLPRE--YSKIIEILENINYFALIS-------KRKITISLVKEVL  213 (214)
T ss_pred             HHH----------HHHCCCCCCHHHHHHHHHHHCCC--HHHHHHHHHHHHHHHHHC-------CCCCCHHHHHHHH
T ss_conf             999----------99869988755999999985178--999999999999999983-------9998899999983


No 211
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator; InterPro: IPR014264   Members of this protein family share full-length homology with (but do not include) the acetoacetate metabolism regulatory protein AtoC (see Q06065 from SWISSPROT). These proteins have a Fis family DNA binding sequence, a response regulator receiver domain, and sigma-54 interaction domain. They are found strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system  common in Gram-positive bacteria, where members of IPR014265 from INTERPRO and IPR014266 from INTERPRO also occur..
Probab=97.78  E-value=0.00013  Score=53.76  Aligned_cols=256  Identities=22%  Similarity=0.365  Sum_probs=157.5

Q ss_pred             CCCHHHHCC--CCCCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHC--CHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             100001012--466550467899985222478857888889999999875311--0257899999876540415876632
Q gi|254780270|r  251 MKAIQKELD--NGEEGRDEISDFEARISKIRLSKEAREKALSELQKLRQMNPL--SAESSVVRNYLDWLLGVPWDKKSKT  326 (820)
Q Consensus       251 LKaIqkELG--e~ed~~~Ei~el~~Ki~~~~lp~e~~~~~~kEl~rL~~m~~~--s~E~~v~r~Yld~~~~lPW~~~t~~  326 (820)
                      +|||+  ||  |.-.+.-+.+.|.--++-+    -.....++|=+||++....  |+--+++-               . 
T Consensus        90 lkAi~--lGAYDFyqKP~d~d~L~liv~RA----f~L~~Le~ENRrL~~~~~~Gst~~~Gli~---------------~-  147 (451)
T TIGR02915        90 LKAIG--LGAYDFYQKPIDPDVLKLIVDRA----FRLYTLETENRRLQSALGGGSTALEGLIT---------------S-  147 (451)
T ss_pred             HHHHH--CCCCCCCCCCCCHHHHHHHHHHH----HHHHHHHHHHHHHHHCCCCCCCCCCCEEE---------------C-
T ss_conf             99964--37510135787578999999998----88888888769987406887410365220---------------6-


Q ss_pred             CCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC---CEEEEECCCCC
Q ss_conf             210688998776652011689999999999998424446735998605656502799999977088---24998618888
Q gi|254780270|r  327 KKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGR---QYVRMSLGGVY  403 (820)
Q Consensus       327 ~~dl~~a~~iLd~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r---~f~~islgg~~  403 (820)
                                    --||.|+-..      +.|..++- -++| |.|--||||=-+||.|.+.=.|   +||-|.++-+=
T Consensus       148 --------------~~~m~kic~t------IekvA~sd-~Tvl-lLGESGTGKEV~ArA~H~~S~R~~~~FVAINCAAIP  205 (451)
T TIGR02915       148 --------------SPGMQKICRT------IEKVAPSD-ITVL-LLGESGTGKEVLARALHELSDRKDKRFVAINCAAIP  205 (451)
T ss_pred             --------------CCCHHHHHHH------HHHHCCCC-CEEE-EECCCCCHHHHHHHHHHHHCCCCCCCEEEEECCCCC
T ss_conf             --------------8506789888------65212000-0130-104667117899989842057897773444167457


Q ss_pred             C---HHHHCCCCCCCCCCCCHHHHHHHHHCCCC-CEEEEEECHHHHHHHCCCCHHHHHHHHC------------------
Q ss_conf             8---88835632001456712899999832788-7399993315542311771155665540------------------
Q gi|254780270|r  404 D---EADIRGHRRTYIGSMPGRIIQSLKRAKRS-NPLLLLDEIDKMGSDLRGDPSAALLEVL------------------  461 (820)
Q Consensus       404 d---~~~i~gh~~ty~ga~pg~ii~~l~~~~~~-npv~~ldeidk~~~~~~gdp~~allevl------------------  461 (820)
                      +   |||+=||=+   ||--|=.=|-+=|..+- ..-++||||--|=-..    .+-||=.|                  
T Consensus       206 EnLLEsELFGyEK---GAFTGA~k~T~GKIE~A~~GTLFLDEIGDLP~~L----QAKLLRFLQErVIER~GGR~eIPVDV  278 (451)
T TIGR02915       206 ENLLESELFGYEK---GAFTGAVKQTLGKIEYAHGGTLFLDEIGDLPLNL----QAKLLRFLQERVIERLGGREEIPVDV  278 (451)
T ss_pred             CHHHHHHHHCCCC---HHHHHHHCCCCCCEEEECCCCCCCCCHHCCCHHH----HHHHHHHHHHHHHHCCCCCCCCCCCE
T ss_conf             5246677603410---1242200347761675068830111122067668----99999875466631058872456142


Q ss_pred             ----CCCCC-------CCEE-EEECCCCCCCCCEEEEEECCCCCCCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             ----60016-------8133-20103523644279999348655441311724799825878689998999860898998
Q gi|254780270|r  462 ----DPAQN-------SSFV-DHYLEVEYDLSDVMFIMTANTLNIPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLT  529 (820)
Q Consensus       462 ----dp~qn-------~~f~-d~y~~~~~dls~v~fi~tan~~~i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~  529 (820)
                          =..||       .+|+ |=|    |-|+.|       +++| ||||||-          .+=+-+|+-| +.+--.
T Consensus       279 RvvCATnqdL~~~i~eg~FREDLf----YRl~Ei-------si~i-PPLR~R~----------gDa~lLA~~F-l~rf~~  335 (451)
T TIGR02915       279 RVVCATNQDLKKMIAEGTFREDLF----YRLAEI-------SITI-PPLRDRD----------GDAVLLANAF-LERFAR  335 (451)
T ss_pred             EEEECCCHHHHHHHHCCCCCCCCE----EEEEEE-------EEEC-CCCCCCH----------HHHHHHHHHH-HHHHHH
T ss_conf             675032246899985489720001----346667-------8625-8899860----------1899999999-998878


Q ss_pred             HHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHH
Q ss_conf             625781313228999999973177410234788879999898765421178520127967867
Q gi|254780270|r  530 EHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDTTVSINENNLQ  592 (820)
Q Consensus       530 ~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~  592 (820)
                      +  .+...-.||+||+.+ |+.|++=--||+||=+|     |.|+-.+++.    .||.+||-
T Consensus       336 ~--~k~~~~~F~~DA~~a-le~h~WPGNvRELEN~v-----KRAVIMa~g~----qIt~~DLG  386 (451)
T TIGR02915       336 E--LKRKAKGFTDDALRA-LEAHKWPGNVRELENKV-----KRAVIMAEGN----QITAEDLG  386 (451)
T ss_pred             H--HCCCCCCHHHHHHHH-HHCCCCCCCHHHHHCHH-----HEEEEECCCC----CCCHHHCC
T ss_conf             7--330216606999999-76069988415440300-----2134533787----13565488


No 212
>TIGR03499 FlhF flagellar biosynthetic protein FlhF.
Probab=97.77  E-value=0.00015  Score=53.35  Aligned_cols=93  Identities=23%  Similarity=0.405  Sum_probs=49.3

Q ss_pred             CHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHCH
Q ss_conf             04678999852224788578888899999998753110257899999876540415876632210688998776652011
Q gi|254780270|r  265 RDEISDFEARISKIRLSKEAREKALSELQKLRQMNPLSAESSVVRNYLDWLLGVPWDKKSKTKKNLDFAIRILDQDHFGL  344 (820)
Q Consensus       265 ~~Ei~el~~Ki~~~~lp~e~~~~~~kEl~rL~~m~~~s~E~~v~r~Yld~~~~lPW~~~t~~~~dl~~a~~iLd~~hyGl  344 (820)
                      ......+.+++...+++++....+...+.   .-.    .+...+++                                 
T Consensus       133 ~~~~~~l~~~L~~~gv~~~~~~~l~~~~~---~~~----~~~~~~~~---------------------------------  172 (282)
T TIGR03499       133 DPEGAKLYERLEEAGVSEELARELLEKLP---ERA----DAESAWRW---------------------------------  172 (282)
T ss_pred             CHHHHHHHHHHHHCCCCHHHHHHHHHHHH---HCC----CHHHHHHH---------------------------------
T ss_conf             86899999999986999999999999746---029----97899999---------------------------------


Q ss_pred             HHHHHHHHHHHHHHHHC--CCCCCCEEEEECCCCCCHHHHHHHHH-H-HH--C-CCEEEEEC
Q ss_conf             68999999999999842--44467359986056565027999999-7-70--8-82499861
Q gi|254780270|r  345 EKVKERIIEYLAVQMRV--IKNKGLILCFVGPPGVGKTSLAQSIA-K-AT--G-RQYVRMSL  399 (820)
Q Consensus       345 ~~vK~rile~lav~~~~--~~~~g~il~l~gppgvGKts~~~sia-~-al--~-r~f~~isl  399 (820)
                        +.+.+-+.+.+....  ...++.|++|+||+|||||+..--+| . ++  | ++-.-|++
T Consensus       173 --l~~~L~~~i~~~~~~~~~~~~~~vi~lvGPTGVGKTTTiAKLAa~~~l~~~~~~V~lIT~  232 (282)
T TIGR03499       173 --LREALENMLPVKPEEDEILEQGGVIALVGPTGVGKTTTLAKLAARFVLEHGKKKVALITT  232 (282)
T ss_pred             --HHHHHHHHCCCCCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             --999999647778876554456727999778887578899999999999738996799980


No 213
>pfam06309 Torsin Torsin. This family consists of several eukaryotic torsin proteins. Torsion dystonia is an autosomal dominant movement disorder characterized by involuntary, repetitive muscle contractions and twisted postures. The most severe early-onset form of dystonia has been linked to mutations in the human DYT1 (TOR1A) gene encoding a protein termed torsinA. While causative genetic alterations have been identified, the function of torsin proteins and the molecular mechanism underlying dystonia remain unknown. Phylogenetic analysis of the torsin protein family indicates these proteins share distant sequence similarity with the large and diverse family of (pfam00004) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia.
Probab=97.75  E-value=0.00022  Score=52.09  Aligned_cols=77  Identities=27%  Similarity=0.263  Sum_probs=62.0

Q ss_pred             CCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCCC-CCCCEEEEECCCCCCHHHHHHHHHHHH-----CCCEEEEECC
Q ss_conf             2106889987766520116899999999999984244-467359986056565027999999770-----8824998618
Q gi|254780270|r  327 KKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRVIK-NKGLILCFVGPPGVGKTSLAQSIAKAT-----GRQYVRMSLG  400 (820)
Q Consensus       327 ~~dl~~a~~iLd~~hyGl~~vK~rile~lav~~~~~~-~~g~il~l~gppgvGKts~~~sia~al-----~r~f~~islg  400 (820)
                      ..|+..-++.|++..||-.-|++.|+..+.-...+++ .|+-+|.|.|||||||+-+++-||++|     .-+||+.=.+
T Consensus        13 ~~~~~~Le~~L~~~lfGQhla~~~v~~al~~~l~~~~p~KpLVlSfHG~tGtGKn~vs~liA~~Ly~~G~~S~~Vh~fi~   92 (127)
T pfam06309        13 SFNYHGLERDLARRLFGQHLVKQLVVRSVKGHWENPKPRKPLVLSFHGWTGTGKNFVAEIIADNLYRDGLRSPYVHHFVA   92 (127)
T ss_pred             CCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCEEEECC
T ss_conf             88779999999875347798999999999999748999997488701899987989999999998754347875688424


Q ss_pred             CCC
Q ss_conf             888
Q gi|254780270|r  401 GVY  403 (820)
Q Consensus       401 g~~  403 (820)
                      -.+
T Consensus        93 ~~h   95 (127)
T pfam06309        93 TNH   95 (127)
T ss_pred             CCC
T ss_conf             224


No 214
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=97.72  E-value=0.00073  Score=48.06  Aligned_cols=129  Identities=26%  Similarity=0.338  Sum_probs=64.4

Q ss_pred             CCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             50467899985222478857888889999999875311025789999987654041587663221068899877665201
Q gi|254780270|r  264 GRDEISDFEARISKIRLSKEAREKALSELQKLRQMNPLSAESSVVRNYLDWLLGVPWDKKSKTKKNLDFAIRILDQDHFG  343 (820)
Q Consensus       264 ~~~Ei~el~~Ki~~~~lp~e~~~~~~kEl~rL~~m~~~s~E~~v~r~Yld~~~~lPW~~~t~~~~dl~~a~~iLd~~hyG  343 (820)
                      .......+.+++...+++++..+.+...+   .   ...                                        .
T Consensus       150 ~~p~~~~l~~~L~~~Gvs~~la~~l~~~~---~---~~~----------------------------------------~  183 (412)
T PRK05703        150 IPPEFAKLYKRLKESGLSPEIADKLLKLL---L---EDM----------------------------------------N  183 (412)
T ss_pred             CCHHHHHHHHHHHHCCCCHHHHHHHHHHH---H---HCC----------------------------------------C
T ss_conf             88789999999998699999999999986---6---428----------------------------------------9


Q ss_pred             HHHHHHHHHHHHHH----HHHCCCCCCCEEEEECCCCCCHHHHHHHHHH--HH--CC-CEEEEECCCCCC--------HH
Q ss_conf             16899999999999----9842444673599860565650279999997--70--88-249986188888--------88
Q gi|254780270|r  344 LEKVKERIIEYLAV----QMRVIKNKGLILCFVGPPGVGKTSLAQSIAK--AT--GR-QYVRMSLGGVYD--------EA  406 (820)
Q Consensus       344 l~~vK~rile~lav----~~~~~~~~g~il~l~gppgvGKts~~~sia~--al--~r-~f~~islgg~~d--------~~  406 (820)
                      -++.+..+++.|+-    .......++.+++||||+|||||+..--||.  +|  |+ +-.-|++---|=        -+
T Consensus       184 ~~~~~~~l~~~L~~~l~~~~~~~~~~~~vvalVGPTGVGKTTTiAKLAA~~~l~~~~~kV~lIT~DtyRigA~eQLk~Ya  263 (412)
T PRK05703        184 PREAWRYLLELLANMLPTRVEDILEQGGVVALVGPTGVGKTTTLAKLAARYALEEGKDKVALITLDTYRIGAVEQLKTYA  263 (412)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHHH
T ss_conf             79999999999997578887665456736999888887567699999999999729981799983767777999999999


Q ss_pred             HHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEE
Q ss_conf             8356320014567128999998327887399993
Q gi|254780270|r  407 DIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLD  440 (820)
Q Consensus       407 ~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~ld  440 (820)
                      +|=|-- .++-.-|.-+-++|.+..-.. +||+|
T Consensus       264 ~ilgvp-~~v~~~~~~l~~al~~~~~~d-lILID  295 (412)
T PRK05703        264 KIMGIP-VKVAYDPKELAKALEQLANCD-LILID  295 (412)
T ss_pred             HHCCCE-EEEECCHHHHHHHHHHHCCCC-EEEEE
T ss_conf             971973-798479999999998715899-79996


No 215
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=97.71  E-value=0.0003  Score=50.99  Aligned_cols=81  Identities=23%  Similarity=0.363  Sum_probs=42.7

Q ss_pred             CCCEEEEECCCCCCHHHH-HHHHHHH-H--CC-CEEEEECCCCCCHH--------HHCCCCCCCCCCCCHHHHHHHHHCC
Q ss_conf             673599860565650279-9999977-0--88-24998618888888--------8356320014567128999998327
Q gi|254780270|r  365 KGLILCFVGPPGVGKTSL-AQSIAKA-T--GR-QYVRMSLGGVYDEA--------DIRGHRRTYIGSMPGRIIQSLKRAK  431 (820)
Q Consensus       365 ~g~il~l~gppgvGKts~-~~sia~a-l--~r-~f~~islgg~~d~~--------~i~gh~~ty~ga~pg~ii~~l~~~~  431 (820)
                      +|.|++||||+|||||+- ||==|++ |  |+ +-.-|++---|=.|        +|=|- -.|+-.-|.-+-++|.+..
T Consensus       175 ~ggV~alVGPTGVGKTTTiAKLAAr~~l~~g~~kVaLIT~DTYRIgAvEQLktYa~Ilgv-Pv~vv~~~~eL~~aL~~l~  253 (404)
T PRK06995        175 RGGVFALVGPTGVGKTTTTAKLAARCVMRHGASKVALLTTDSYRIGGHEQLRIYGKILGV-PVHAVKDAADLRLALAELR  253 (404)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHCCC-EEEEECCHHHHHHHHHHHC
T ss_conf             475589866888763758999999999983898379997687547899999999987595-5999599999999999708


Q ss_pred             CCCEEEEEECHHHHHHHCC
Q ss_conf             8873999933155423117
Q gi|254780270|r  432 RSNPLLLLDEIDKMGSDLR  450 (820)
Q Consensus       432 ~~npv~~ldeidk~~~~~~  450 (820)
                      .. -+||+|-   .|.+++
T Consensus       254 ~~-dlILIDT---aGrs~r  268 (404)
T PRK06995        254 NK-HIVLIDT---VGMSQR  268 (404)
T ss_pred             CC-CEEEEEC---CCCCCC
T ss_conf             99-9999809---998976


No 216
>KOG1968 consensus
Probab=97.68  E-value=0.00018  Score=52.70  Aligned_cols=182  Identities=25%  Similarity=0.312  Sum_probs=104.2

Q ss_pred             HHHHHHCHHHHHHHHHHHHHHHHHCC---------CCCCC-EEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHH
Q ss_conf             76652011689999999999998424---------44673-599860565650279999997708824998618888888
Q gi|254780270|r  337 LDQDHFGLEKVKERIIEYLAVQMRVI---------KNKGL-ILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEA  406 (820)
Q Consensus       337 Ld~~hyGl~~vK~rile~lav~~~~~---------~~~g~-il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~  406 (820)
                      +...-++...+| .+.++||-++-..         ...+- ++.+.||||+|||+-+--+|+.+|-.-+.+.-+-+|...
T Consensus       319 ~k~~~~~~~~~~-~~~~~l~~~k~~~~~sy~~~~~~ss~~~~~l~~G~pGigKT~~~h~~~k~~g~~v~E~Nas~~RSk~  397 (871)
T KOG1968         319 SKALEGNASSSK-KASKWLAKSKDKEKSSYKENEPDSSKKKALLLSGPPGIGKTTAAHKAAKELGFKVVEKNASDVRSKK  397 (871)
T ss_pred             HHHHHCCCCHHH-HHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCCEEECCCCCCCCCC
T ss_conf             776633520366-6665887622133354002686156677887317887772056766301206540104754334422


Q ss_pred             HHCCCCCCCCCCCCHHHHHHHH-------HCCCCCEEEEEECHHHHHHHCCCCHH--HHHHHHCCCCCCCCEEEEECCCC
Q ss_conf             8356320014567128999998-------32788739999331554231177115--56655406001681332010352
Q gi|254780270|r  407 DIRGHRRTYIGSMPGRIIQSLK-------RAKRSNPLLLLDEIDKMGSDLRGDPS--AALLEVLDPAQNSSFVDHYLEVE  477 (820)
Q Consensus       407 ~i~gh~~ty~ga~pg~ii~~l~-------~~~~~npv~~ldeidk~~~~~~gdp~--~allevldp~qn~~f~d~y~~~~  477 (820)
                      +++-   -+-++.-...|....       ......-|+++||+|=|...-||.-.  +.+.+                  
T Consensus       398 ~l~~---~~~~~~~s~si~~~~~~~~~~~~~~~~~~vil~devD~~~~~dRg~v~~l~~l~~------------------  456 (871)
T KOG1968         398 ELLN---KLGNATSSHSIKGSKKKKGNRQSLNSDHFLILMDEVDGMFGEDRGGVSKLSSLCK------------------  456 (871)
T ss_pred             HHHH---HHHCCCCCCCHHHHHCCCCCCCCCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHH------------------
T ss_conf             7776---6402446640001111113300046660699974255442000136999999998------------------


Q ss_pred             CCCCCEEEEEECCCCCCCHH-HCCCE-EEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCC
Q ss_conf             36442799993486554413-11724-79982587868999899986089899862578131322899999997317
Q gi|254780270|r  478 YDLSDVMFIMTANTLNIPLP-LMDRM-EIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLF  552 (820)
Q Consensus       478 ~dls~v~fi~tan~~~i~~~-l~drm-e~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Y  552 (820)
                        -|..=-|||+|+.+-|.. .++|- ..++++--...        -+.++++.  ....+.+.++++.++.++..+
T Consensus       457 --ks~~Piv~~cndr~~p~sr~~~~~~~~l~f~kP~~~--------~i~~ri~s--i~~se~~ki~~~~l~~~s~~~  521 (871)
T KOG1968         457 --KSSRPLVCTCNDRNLPKSRALSRACSDLRFSKPSSE--------LIRSRIMS--ICKSEGIKISDDVLEEISKLS  521 (871)
T ss_pred             --HCCCCEEEEECCCCCCCCCCHHHHCCEEEECCCCHH--------HHHHHHHH--HHCCCCEECCCHHHHHHHHHC
T ss_conf             --635776887337777665202232002340488577--------77766653--302464241727889998750


No 217
>PRK07993 DNA polymerase III subunit delta'; Validated
Probab=97.67  E-value=0.00018  Score=52.75  Aligned_cols=139  Identities=15%  Similarity=0.180  Sum_probs=86.6

Q ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEE--EEECCCCCCHHHHCC--CCC-CCCCCCCHH--H-HHHHHH---
Q ss_conf             24446735998605656502799999977088249--986188888888356--320-014567128--9-999983---
Q gi|254780270|r  361 VIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYV--RMSLGGVYDEADIRG--HRR-TYIGSMPGR--I-IQSLKR---  429 (820)
Q Consensus       361 ~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~--~islgg~~d~~~i~g--h~~-ty~ga~pg~--i-i~~l~~---  429 (820)
                      ..+.-+-.+.|.||+|+||..+|+.+|++|-=.--  --+.|-.++---+..  |-- .++..-.|+  | |..++.   
T Consensus        19 ~~~rl~HA~L~~G~~G~Gk~~la~~~a~~llC~~~~~~~~Cg~C~~C~l~~~~~HPD~~~i~pe~~~~~I~IdqIR~l~~   98 (334)
T PRK07993         19 QAGRGHHALLIQALPGMGDDALIYALSRYLLCQQPQGHKSCGHCRGCQLMQAGTHPDYYTLTPEKGKSSLGVDAVREVTE   98 (334)
T ss_pred             HCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEECCCCCCCCCCHHHHHHHHH
T ss_conf             85981046754799998899999999999818999999999999789998668999847753422345599999999999


Q ss_pred             ------CCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHHHCCCE
Q ss_conf             ------2788739999331554231177115566554060016813320103523644279999348655-441311724
Q gi|254780270|r  430 ------AKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLPLMDRM  502 (820)
Q Consensus       430 ------~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~drm  502 (820)
                            ....+=|+++|..|+|+..    -++|||-.|.             -|=  .+++||.+++..+ +++..+.|-
T Consensus        99 ~~~~~~~~g~~kV~iI~~Ae~mn~~----AaNaLLKtLE-------------EPp--~~t~~iL~t~~~~~lLpTI~SRC  159 (334)
T PRK07993         99 KLYEHARLGGAKVVWLPDAALLTDA----AANALLKTLE-------------EPP--EKTWFFLACREPARLLATLRSRC  159 (334)
T ss_pred             HHHHCCCCCCCEEEEECCHHHHCHH----HHHHHHHHHC-------------CCC--CCEEEEEECCCHHHCCCHHHHHC
T ss_conf             9843665699479997667775999----9999998612-------------799--88499986698565723887523


Q ss_pred             EEEEECCCCHHHHHHH
Q ss_conf             7998258786899989
Q gi|254780270|r  503 EIIRIAGYTEEEKLQI  518 (820)
Q Consensus       503 e~i~~~~y~~~ek~~i  518 (820)
                      -.+.++.-+.++-..-
T Consensus       160 q~~~~~~~~~~~~~~w  175 (334)
T PRK07993        160 RLHYLAPPPEQYALTW  175 (334)
T ss_pred             CCCCCCCCCHHHHHHH
T ss_conf             0415899799999999


No 218
>pfam08298 AAA_PrkA PrkA AAA domain. This is a family of PrkA bacterial and archaeal serine kinases approximately 630 residues long. This is the N-terminal AAA domain.
Probab=97.58  E-value=0.00017  Score=52.84  Aligned_cols=54  Identities=35%  Similarity=0.604  Sum_probs=45.9

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC
Q ss_conf             652011689999999999998424446735998605656502799999977088
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGR  392 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r  392 (820)
                      +|-|||+++=++|+.|+---......+-.||.|+||+|-||+||+..+-++|.+
T Consensus        58 ~dffGme~~i~~iV~~~ksAA~g~e~~kqIllL~GPVGsGKSsl~e~LK~glE~  111 (358)
T pfam08298        58 ADFFGMEETIERIVNYFRHAAQGLEERKQILYLLGPVGGGKSSLAERLKKLLEL  111 (358)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCC
T ss_conf             320015999999999999997236721058999778987758999999987205


No 219
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]
Probab=97.57  E-value=5.3e-05  Score=56.69  Aligned_cols=88  Identities=33%  Similarity=0.584  Sum_probs=57.5

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHC-CCCC----------------CCCC--------------
Q ss_conf             99860565650279999997708824998618888888835-6320----------------0145--------------
Q gi|254780270|r  369 LCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIR-GHRR----------------TYIG--------------  417 (820)
Q Consensus       369 l~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~-gh~~----------------ty~g--------------  417 (820)
                      +...||||||||++++-||+.|...=  +.+||.-- .|+| |-+|                .|+|              
T Consensus         8 i~ITG~PGvGKtTl~~ki~e~L~~~g--~kvgGf~t-~EVR~gGkR~GF~Ivdl~tg~~~~la~~~~~~~rvGkY~V~v~   84 (179)
T COG1618           8 IFITGRPGVGKTTLVLKIAEKLREKG--YKVGGFIT-PEVREGGKRIGFKIVDLATGEEGILARVGFSRPRVGKYGVNVE   84 (179)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCC--CEEEEEEE-EEEECCCEEEEEEEEECCCCCEEEEEECCCCCCCCCEEEEEHH
T ss_conf             99867998458999999999998559--66513983-1142088275159998147955798884788762104786278


Q ss_pred             CCCHHHHHHHHHCCCCCEEEEEECHHHH---HHHCCCCHHHHHHHHCCC
Q ss_conf             6712899999832788739999331554---231177115566554060
Q gi|254780270|r  418 SMPGRIIQSLKRAKRSNPLLLLDEIDKM---GSDLRGDPSAALLEVLDP  463 (820)
Q Consensus       418 a~pg~ii~~l~~~~~~npv~~ldeidk~---~~~~~gdp~~allevldp  463 (820)
                      .+.-..+.++++|-..--||.+|||.+|   |..|+    +++=|+|+.
T Consensus        85 ~le~i~~~al~rA~~~aDvIIIDEIGpMElks~~f~----~~ve~vl~~  129 (179)
T COG1618          85 GLEEIAIPALRRALEEADVIIIDEIGPMELKSKKFR----EAVEEVLKS  129 (179)
T ss_pred             HHHHHHHHHHHHHHHCCCEEEEECCCCHHHCCHHHH----HHHHHHHCC
T ss_conf             889986899998863499899943363302008899----999999658


No 220
>PRK00131 aroK shikimate kinase; Reviewed
Probab=97.57  E-value=6.9e-05  Score=55.85  Aligned_cols=33  Identities=27%  Similarity=0.551  Sum_probs=30.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEE
Q ss_conf             467359986056565027999999770882499
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVR  396 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~~  396 (820)
                      .++.-|+|+|+||+|||++||.+|+.|+.+|+-
T Consensus         2 ~~~~nI~liG~~GsGKTtvgk~LA~~L~~~fiD   34 (175)
T PRK00131          2 LKGPNIVLIGMMGAGKSTIGRLLAKRLGYEFID   34 (175)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCC
T ss_conf             999808988899999899999999995969023


No 221
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism]
Probab=97.57  E-value=0.0053  Score=41.57  Aligned_cols=166  Identities=24%  Similarity=0.347  Sum_probs=116.6

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHCC---CEEEEECCCCCC---HHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEE
Q ss_conf             6735998605656502799999977088---249986188888---8883563200145671289999983278873999
Q gi|254780270|r  365 KGLILCFVGPPGVGKTSLAQSIAKATGR---QYVRMSLGGVYD---EADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLL  438 (820)
Q Consensus       365 ~g~il~l~gppgvGKts~~~sia~al~r---~f~~islgg~~d---~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~  438 (820)
                      ..| |++.|--|+||--+||.-.-+--|   ||.-.++.|+-|   |+|+=||.-- .+..+|-+=++      .-.-.+
T Consensus       227 DAP-LLI~GeTGTGKdLlAkaCH~~S~R~~~pFlalNCA~lPe~~aEsElFG~apg-~~gk~GffE~A------ngGTVl  298 (511)
T COG3283         227 DAP-LLITGETGTGKDLLAKACHLASPRHSKPFLALNCASLPEDAAESELFGHAPG-DEGKKGFFEQA------NGGTVL  298 (511)
T ss_pred             CCC-EEEECCCCCHHHHHHHHHHHCCCCCCCCEEEEECCCCCHHHHHHHHHCCCCC-CCCCCCHHHHC------CCCEEE
T ss_conf             787-6874488861889999874438455897367644779666767777356888-77763463402------697488


Q ss_pred             EECHHHHHHHCCCCHHHHHHHHCCCCCCCCEE------EEECCCCCCCCCEEEEEEC---------------------CC
Q ss_conf             93315542311771155665540600168133------2010352364427999934---------------------86
Q gi|254780270|r  439 LDEIDKMGSDLRGDPSAALLEVLDPAQNSSFV------DHYLEVEYDLSDVMFIMTA---------------------NT  491 (820)
Q Consensus       439 ldeidk~~~~~~gdp~~allevldp~qn~~f~------d~y~~~~~dls~v~fi~ta---------------------n~  491 (820)
                      ||||..||...+    +.||-.|.   .-+|+      .||.|       |-.|||.                     |.
T Consensus       299 LDeIgEmSp~lQ----aKLLRFL~---DGtFRRVGee~Ev~vd-------VRVIcatq~nL~~lv~~g~fReDLfyRLNV  364 (511)
T COG3283         299 LDEIGEMSPRLQ----AKLLRFLN---DGTFRRVGEDHEVHVD-------VRVICATQVNLVELVQKGKFREDLFYRLNV  364 (511)
T ss_pred             EEHHHHCCHHHH----HHHHHHHC---CCCCCCCCCCCEEEEE-------EEEEECCCCCHHHHHHCCCHHHHHHHHHHE
T ss_conf             500332499899----99999862---7760003775457877-------899961666699998637258878877501


Q ss_pred             CC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             55-4413117247998258786899989998608989986257813132289999999731774102347888799
Q gi|254780270|r  492 LN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALM  566 (820)
Q Consensus       492 ~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~  566 (820)
                      ++ --+||++|++=|           .---.+.+-+...+.|..  .-+++++.+.+ ...|.+-.-||+|+-.|.
T Consensus       365 Ltl~~PpLRer~~di-----------~pL~e~Fv~q~s~elg~p--~pkl~~~~~~~-L~~y~WpGNVRqL~N~iy  426 (511)
T COG3283         365 LTLNLPPLRERPQDI-----------MPLAELFVQQFSDELGVP--RPKLAADLLTV-LTRYAWPGNVRQLKNAIY  426 (511)
T ss_pred             EEECCCCCCCCCCCC-----------HHHHHHHHHHHHHHHCCC--CCCCCHHHHHH-HHHCCCCCCHHHHHHHHH
T ss_conf             342388500065210-----------689999999999975899--87668789999-987799960999999999


No 222
>pfam01695 IstB IstB-like ATP binding protein. This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function.
Probab=97.56  E-value=8.5e-05  Score=55.14  Aligned_cols=105  Identities=24%  Similarity=0.320  Sum_probs=61.5

Q ss_pred             HHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHC---CCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHH
Q ss_conf             9999999999842444673599860565650279999997708---8249986188888888356320014567128999
Q gi|254780270|r  349 ERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATG---RQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQ  425 (820)
Q Consensus       349 ~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~---r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~  425 (820)
                      .+.+..||-..|-.  ++.-|+|.||||||||-||-+|+.++=   .+...++...+-  .+++..   +...--.+.++
T Consensus        32 ~~~i~~L~~~~~i~--~~~Nlll~G~~GtGKThLA~Ai~~~~~~~g~~v~f~~~~~L~--~~l~~~---~~~~~~~~~l~  104 (178)
T pfam01695        32 RRLIAELAGLDWIE--QAENLLLLGPPGVGKTHLACALGHQACRAGYSVLFTRTPDLV--EQLKRA---RGDGRLARTLQ  104 (178)
T ss_pred             HHHHHHHHCCCCHH--CCCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECHHHH--HHHHHH---HHCCCHHHHHH
T ss_conf             99999885597421--587689989999878999999999999869859999616799--999987---52674999999


Q ss_pred             HHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCC
Q ss_conf             99832788739999331554231177115566554060016
Q gi|254780270|r  426 SLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQN  466 (820)
Q Consensus       426 ~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn  466 (820)
                      .+.+    -+|.+|||+-....+-  ..+.-|++++|.-.+
T Consensus       105 ~~~~----~dlLIiDDlG~~~~s~--~~~~~lf~li~~Rye  139 (178)
T pfam01695       105 RLAK----ADLLILDDIGYLPLSQ--EAAHLLFELISDRYE  139 (178)
T ss_pred             HHHC----CCEEEEEHHCCCCCCH--HHHHHHHHHHHHHHC
T ss_conf             9625----8978872001656898--999999999999975


No 223
>TIGR00390 hslU heat shock protein HslVU, ATPase subunit HslU; InterPro: IPR004491   This family of proteins represent HslU, a bacterial clpX homolog, which is an ATPase and chaperone belonging to the AAA Clp/Hsp100 family and a component of the eubacterial proteasome.    ATP-dependent protease complexes are present in all three kingdoms of life, where they rid the cell of misfolded or damaged proteins and control the level of certain regulatory proteins. They include the proteasome in Eukaryotes, Archaea, and Actinomycetales and the HslVU (ClpQY, ClpXP) complex in other eubacteria. Genes homologous to eubacterial HslV, IPR001353 from INTERPRO, (ClpQ,) and HslU (ClpY, ClpX) have also been demonstrated in to be present in the genome of trypanosomatid protozoa. They are expressed as precursors, with a propeptide that is removed to produce the active protease. The protease is probably located in the kinetoplast (mitochondrion). Phylogenetic analysis shows that HslV and HslU from trypanosomatids form a single clad with other eubacterial homologs . ; GO: 0005515 protein binding, 0005524 ATP binding, 0009377 HslUV protease activity, 0016887 ATPase activity, 0005737 cytoplasm, 0009376 HslUV protease complex.
Probab=97.53  E-value=0.0002  Score=52.27  Aligned_cols=163  Identities=23%  Similarity=0.391  Sum_probs=112.2

Q ss_pred             HHHHCCCCCEEEEEECHHHHHHHC----CCCHHH-----HHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECC-----C
Q ss_conf             998327887399993315542311----771155-----66554060016813320103523644279999348-----6
Q gi|254780270|r  426 SLKRAKRSNPLLLLDEIDKMGSDL----RGDPSA-----ALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTAN-----T  491 (820)
Q Consensus       426 ~l~~~~~~npv~~ldeidk~~~~~----~gdp~~-----allevldp~qn~~f~d~y~~~~~dls~v~fi~tan-----~  491 (820)
                      |+.++. .+.||++|||||+....    +-||+-     =||=+.--   ++-.-.|=-|.  =++|||||+--     -
T Consensus       262 A~~~vE-~~GiiFIDEIDKIa~~~~e~S~~DvSrEGVQRDlLPiVEG---S~V~TKyG~Vk--TdHiLFIAaGAF~lAKP  335 (463)
T TIGR00390       262 AIDRVE-QSGIIFIDEIDKIAKKGKESSGADVSREGVQRDLLPIVEG---STVNTKYGSVK--TDHILFIAAGAFHLAKP  335 (463)
T ss_pred             HHHHHH-HCCCEEEECCHHHHCCCCCCCCCCCCCCCCCCCCCCCCCC---CEEEEECCEEE--CCHHHHHHHHHHCCCCC
T ss_conf             999998-4782898530354216888678887655651011420226---66431001042--21578767523202777


Q ss_pred             CC-CCHHHCCCEEE-EEECCCCHHHHHHHHHH---HHHHH---HHHHHCCCCCCCCCCHHHHHHHHHC-C-----CCCCH
Q ss_conf             55-44131172479-98258786899989998---60898---9986257813132289999999731-7-----74102
Q gi|254780270|r  492 LN-IPLPLMDRMEI-IRIAGYTEEEKLQIAKN---HLVKK---VLTEHALKQEECCISDGVLLDIIRL-F-----THEAG  557 (820)
Q Consensus       492 ~~-i~~~l~drme~-i~~~~y~~~ek~~i~~~---~l~p~---~~~~~~~~~~~~~~~~~~i~~ii~~-Y-----t~EaG  557 (820)
                      .| ||. |--|+=+ +||...|.++=..|-+.   =|+.+   .++-.|+   ++.|+|+||..|.+- |     |-.=|
T Consensus       336 SDLIPE-LQGRfPirVEL~~Lt~~d~~rIL~~p~~Sl~kQY~ALl~~eGv---~i~F~d~AI~~iAe~ay~~N~~teniG  411 (463)
T TIGR00390       336 SDLIPE-LQGRFPIRVELEALTVDDFERILTEPKNSLIKQYQALLKVEGV---NIEFSDEAIKKIAELAYNVNQKTENIG  411 (463)
T ss_pred             CCCCCH-HHCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCC---CEEECHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             666631-1066737787676329999996208343689999998876276---403355689999999998164423346


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHCCC
Q ss_conf             34788879999898765421178520127967867530520
Q gi|254780270|r  558 VRSFERALMKIARKAVTKIVKNSDTTVSINENNLQDYLGVP  598 (820)
Q Consensus       558 vR~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~lg~~  598 (820)
                      -|-|.-.++.+.-.+..+.-.-.-..++||.+-+.+-||.-
T Consensus       412 ARRLHTv~E~lledisFea~D~~~~~~~I~~~YV~~kL~~~  452 (463)
T TIGR00390       412 ARRLHTVLERLLEDISFEAPDVSGQKVTITADYVEKKLGDL  452 (463)
T ss_pred             CCHHHHHHHHHHHHHCCCCCCCCCCEEEECHHHHHHHHHHH
T ss_conf             50466899999987512666863432450789999998788


No 224
>PRK13948 shikimate kinase; Provisional
Probab=97.52  E-value=9.6e-05  Score=54.76  Aligned_cols=34  Identities=18%  Similarity=0.374  Sum_probs=30.4

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEE
Q ss_conf             4673599860565650279999997708824998
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRM  397 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~~i  397 (820)
                      ...+.|+|+|+||.|||++|+.+|+.||.+|+-.
T Consensus         8 ~~~~~IvLIG~mGsGKStiGk~LA~~l~~~fiD~   41 (182)
T PRK13948          8 RPATFVALAGFMGTGKSRIGWELSRALALHFVDT   41 (182)
T ss_pred             CCCCCEEEECCCCCCHHHHHHHHHHHHCCCEEEC
T ss_conf             9998189889999988999999999969598888


No 225
>TIGR00390 hslU heat shock protein HslVU, ATPase subunit HslU; InterPro: IPR004491   This family of proteins represent HslU, a bacterial clpX homolog, which is an ATPase and chaperone belonging to the AAA Clp/Hsp100 family and a component of the eubacterial proteasome.    ATP-dependent protease complexes are present in all three kingdoms of life, where they rid the cell of misfolded or damaged proteins and control the level of certain regulatory proteins. They include the proteasome in Eukaryotes, Archaea, and Actinomycetales and the HslVU (ClpQY, ClpXP) complex in other eubacteria. Genes homologous to eubacterial HslV, IPR001353 from INTERPRO, (ClpQ,) and HslU (ClpY, ClpX) have also been demonstrated in to be present in the genome of trypanosomatid protozoa. They are expressed as precursors, with a propeptide that is removed to produce the active protease. The protease is probably located in the kinetoplast (mitochondrion). Phylogenetic analysis shows that HslV and HslU from trypanosomatids form a single clad with other eubacterial homologs . ; GO: 0005515 protein binding, 0005524 ATP binding, 0009377 HslUV protease activity, 0016887 ATPase activity, 0005737 cytoplasm, 0009376 HslUV protease complex.
Probab=97.52  E-value=0.0002  Score=52.29  Aligned_cols=88  Identities=26%  Similarity=0.431  Sum_probs=60.3

Q ss_pred             HHHHHHHHCHHHHHHHHHHHHHHHHH----------CCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCC
Q ss_conf             87766520116899999999999984----------24446735998605656502799999977088249986188888
Q gi|254780270|r  335 RILDQDHFGLEKVKERIIEYLAVQMR----------VIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYD  404 (820)
Q Consensus       335 ~iLd~~hyGl~~vK~rile~lav~~~----------~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d  404 (820)
                      .-||+.-=|-+++|.-|-  +|.+..          +...-+.=|+-.||-|||||-|||=|||-.+-||+++=      
T Consensus         8 ~~LD~yIiGQ~~AKk~VA--iALrNRyrR~~L~~~L~~EV~PKNILMiGpTGVGKTEIARRlAKL~~aPFiKVE------   79 (463)
T TIGR00390         8 AELDKYIIGQDEAKKAVA--IALRNRYRRSQLEEELKDEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVE------   79 (463)
T ss_pred             HHHCCCCCCHHHHHHHHH--HHHHHHHHHHCCCCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCCEEEE------
T ss_conf             751442206366788999--998866776128711135658743043278898544799999998448914666------


Q ss_pred             HHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEE
Q ss_conf             88835632001456712899999832788739
Q gi|254780270|r  405 EADIRGHRRTYIGSMPGRIIQSLKRAKRSNPL  436 (820)
Q Consensus       405 ~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv  436 (820)
                       |    -.||=|| .=||=|.+|.+==+.+-|
T Consensus        80 -A----tKfTEVG-YVGrdVeSmvRDL~~~aV  105 (463)
T TIGR00390        80 -A----TKFTEVG-YVGRDVESMVRDLVDTAV  105 (463)
T ss_pred             -E----EEEEECC-EECCCHHHHHHHHHHHHH
T ss_conf             -4----1001102-142410036787899999


No 226
>PRK05057 aroK shikimate kinase I; Reviewed
Probab=97.52  E-value=8.7e-05  Score=55.08  Aligned_cols=30  Identities=23%  Similarity=0.543  Sum_probs=27.5

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEE
Q ss_conf             599860565650279999997708824998
Q gi|254780270|r  368 ILCFVGPPGVGKTSLAQSIAKATGRQYVRM  397 (820)
Q Consensus       368 il~l~gppgvGKts~~~sia~al~r~f~~i  397 (820)
                      =|+|+|+||+|||++|+.+|+.|+++|+-.
T Consensus         6 nI~LiG~mGsGKstvgk~LA~~l~~~fiD~   35 (172)
T PRK05057          6 NIFLVGPMGAGKSTIGRQLAQQLNMEFYDS   35 (172)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHCCCEEEC
T ss_conf             289889999988999999999969996878


No 227
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional
Probab=97.51  E-value=0.0016  Score=45.48  Aligned_cols=45  Identities=36%  Similarity=0.618  Sum_probs=29.1

Q ss_pred             HHHHHHHHHHHHHHHHH-----CCCCCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             16899999999999984-----2444673599860565650279999997
Q gi|254780270|r  344 LEKVKERIIEYLAVQMR-----VIKNKGLILCFVGPPGVGKTSLAQSIAK  388 (820)
Q Consensus       344 l~~vK~rile~lav~~~-----~~~~~g~il~l~gppgvGKts~~~sia~  388 (820)
                      .+++++.++++++-...     ..+.++.|++||||.|||||+-.--+|.
T Consensus       147 ~~~v~~~l~~~i~~~i~~~~~~~~~~k~~vi~lVGPTGvGKTTTiAKLAa  196 (388)
T PRK12723        147 YDKVRDSVIIYIAKTIKCSGSIIDNLKKRIFILVGPTGVGKTTTIAKLAA  196 (388)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHH
T ss_conf             87999999999997622366653355762899989988757879999999


No 228
>PRK13947 shikimate kinase; Provisional
Probab=97.51  E-value=9.1e-05  Score=54.92  Aligned_cols=29  Identities=21%  Similarity=0.472  Sum_probs=27.1

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEE
Q ss_conf             99860565650279999997708824998
Q gi|254780270|r  369 LCFVGPPGVGKTSLAQSIAKATGRQYVRM  397 (820)
Q Consensus       369 l~l~gppgvGKts~~~sia~al~r~f~~i  397 (820)
                      |+|+|+||.|||++||.+|+.|+.+|+-.
T Consensus         4 I~LiG~mGsGKTtiGk~La~~L~~~fiD~   32 (171)
T PRK13947          4 IVLIGFMGTGKTTVGKKVATTLSFGFIDT   32 (171)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEC
T ss_conf             89979999988999999999979698987


No 229
>PRK13946 shikimate kinase; Provisional
Probab=97.47  E-value=0.00011  Score=54.41  Aligned_cols=38  Identities=18%  Similarity=0.282  Sum_probs=32.2

Q ss_pred             HCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEE
Q ss_conf             42444673599860565650279999997708824998
Q gi|254780270|r  360 RVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRM  397 (820)
Q Consensus       360 ~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~i  397 (820)
                      +.+..+..-|.|+|+||+|||++||.+|+.|+.+|+-.
T Consensus        14 ~~~~l~kknIvLIG~mGsGKStvGk~LA~~L~~~fiD~   51 (195)
T PRK13946         14 IRAALGKRTVVLVGLMGAGKSTVGRRLATMLGLPFLDA   51 (195)
T ss_pred             HHHHHCCCCEEEECCCCCCHHHHHHHHHHHHCCCEEEC
T ss_conf             99985899589989999988999999999979798988


No 230
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants. Chorismic acid is a important intermediate in the synthesis of aromatic compounds, such as aromatic amino acids, p-aminobenzoic acid, folate and ubiquinone. Shikimate kinase catalyses the phosphorylation of the 3-hydroxyl group of shikimic acid using ATP.
Probab=97.46  E-value=0.00012  Score=54.10  Aligned_cols=29  Identities=34%  Similarity=0.651  Sum_probs=27.0

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEE
Q ss_conf             99860565650279999997708824998
Q gi|254780270|r  369 LCFVGPPGVGKTSLAQSIAKATGRQYVRM  397 (820)
Q Consensus       369 l~l~gppgvGKts~~~sia~al~r~f~~i  397 (820)
                      |+|+|+||+|||++||.+|+.|+.+|+-.
T Consensus         2 I~LiG~~G~GKstigk~la~~l~~~fiD~   30 (154)
T cd00464           2 IVLIGMMGAGKTTVGRLLAKALGLPFVDL   30 (154)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEC
T ss_conf             89988999988999999999979897968


No 231
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism]
Probab=97.45  E-value=9.7e-05  Score=54.73  Aligned_cols=30  Identities=23%  Similarity=0.546  Sum_probs=27.0

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHCCCEEE
Q ss_conf             359986056565027999999770882499
Q gi|254780270|r  367 LILCFVGPPGVGKTSLAQSIAKATGRQYVR  396 (820)
Q Consensus       367 ~il~l~gppgvGKts~~~sia~al~r~f~~  396 (820)
                      +-|-|+|+||+||||||+-+|++|+.+|+-
T Consensus         3 ~~IvLiG~mGaGKSTIGr~LAk~L~~~F~D   32 (172)
T COG0703           3 MNIVLIGFMGAGKSTIGRALAKALNLPFID   32 (172)
T ss_pred             CCEEEECCCCCCHHHHHHHHHHHCCCCCCC
T ss_conf             618997179997768999999981998022


No 232
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only]
Probab=97.44  E-value=0.0065  Score=40.89  Aligned_cols=138  Identities=21%  Similarity=0.248  Sum_probs=82.3

Q ss_pred             CCC-EEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCC-CCEEEEEECH
Q ss_conf             673-59986056565027999999770882499861888888883563200145671289999983278-8739999331
Q gi|254780270|r  365 KGL-ILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKR-SNPLLLLDEI  442 (820)
Q Consensus       365 ~g~-il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~-~npv~~ldei  442 (820)
                      ..+ +.++.||-+||||++.+-+.+.+...+..++.      .|++-++..-     .-..+++....- ..+.|+||||
T Consensus        35 ~~~~i~~i~GpR~~GKTtllk~l~~~~~~~~iy~~~------~d~~~~~~~l-----~d~~~~~~~~~~~~~~yifLDEI  103 (398)
T COG1373          35 LRPFIILILGPRQVGKTTLLKLLIKGLLEEIIYINF------DDLRLDRIEL-----LDLLRAYIELKEREKSYIFLDEI  103 (398)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEC------CCCCCCHHHH-----HHHHHHHHHHHCCCCCEEEEEEE
T ss_conf             578549998886477899999999747773599973------6200013567-----78999999852225745999833


Q ss_pred             HHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCC----CCCHHHCCCEEEEEECCCCHHHHHHH
Q ss_conf             55423117711556655406001681332010352364427999934865----54413117247998258786899989
Q gi|254780270|r  443 DKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTL----NIPLPLMDRMEIIRIAGYTEEEKLQI  518 (820)
Q Consensus       443 dk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~----~i~~~l~drme~i~~~~y~~~ek~~i  518 (820)
                      ..+-.-.+     ++-             ++.|....   =+||.+-|+.    .+..-|.-|-..+++.+.+-.|=...
T Consensus       104 q~v~~W~~-----~lk-------------~l~d~~~~---~v~itgsss~ll~~~~s~~L~GR~~~~~l~PlSF~Efl~~  162 (398)
T COG1373         104 QNVPDWER-----ALK-------------YLYDRGNL---DVLITGSSSSLLSKEISESLAGRGKDLELYPLSFREFLKL  162 (398)
T ss_pred             CCCHHHHH-----HHH-------------HHHCCCCC---EEEEECCCHHHHCCCHHHHCCCCEEEEEECCCCHHHHHHH
T ss_conf             37610899-----999-------------99756775---0999837167541330232499823789848888998641


Q ss_pred             HH--------HHHHHHHHHHHCCC
Q ss_conf             99--------86089899862578
Q gi|254780270|r  519 AK--------NHLVKKVLTEHALK  534 (820)
Q Consensus       519 ~~--------~~l~p~~~~~~~~~  534 (820)
                      ..        .-++-+-+..-|+.
T Consensus       163 ~~~~~~~~~~~~~f~~Yl~~GGfP  186 (398)
T COG1373         163 KGEEIEPSKLELLFEKYLETGGFP  186 (398)
T ss_pred             CCCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             352100256799999987728985


No 233
>pfam00931 NB-ARC NB-ARC domain.
Probab=97.43  E-value=0.001  Score=46.94  Aligned_cols=154  Identities=21%  Similarity=0.257  Sum_probs=76.9

Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHH--HCCCE---EEEECCCCCCHHHHCCCCCCCCCC--
Q ss_conf             89999999999998424446735998605656502799999977--08824---998618888888835632001456--
Q gi|254780270|r  346 KVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKA--TGRQY---VRMSLGGVYDEADIRGHRRTYIGS--  418 (820)
Q Consensus       346 ~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~a--l~r~f---~~islgg~~d~~~i~gh~~ty~ga--  418 (820)
                      +-.+.|++.|    +..+..-.+++++|++|+|||+||+.+.+.  ....|   +.++++.-.+..+|...=...++.  
T Consensus         3 ~~~~~i~~~L----~~~~~~~~vI~I~G~gGiGKTtLA~~v~~~~~i~~~F~~~~wv~vs~~~~~~~i~~~i~~~l~~~~   78 (285)
T pfam00931         3 DMIEALIEKL----LEMSENLGVVGIVGMGGVGKTTLAKQIYNDDSVGGHFDSVAWVVVSKTYTEFRLQKDILQELGLDD   78 (285)
T ss_pred             HHHHHHHHHH----HCCCCCCEEEEEECCCCCCHHHHHHHHHCCHHHHHCCCEEEEEEECCCCCHHHHHHHHHHHHCCCC
T ss_conf             8999999998----648989539998899956399999999716556505983899997976668999999999856665


Q ss_pred             ------CCHHHHHHHHH-CCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCC
Q ss_conf             ------71289999983-27887399993315542311771155665540600168133201035236442799993486
Q gi|254780270|r  419 ------MPGRIIQSLKR-AKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANT  491 (820)
Q Consensus       419 ------~pg~ii~~l~~-~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~  491 (820)
                            -...+...+++ ....+-+++||.+..-. .     -..+.. .-|..+            .=|+|+ |+|-|.
T Consensus        79 ~~~~~~~~~~l~~~l~~~L~~kr~LiVLDDVw~~~-~-----~~~l~~-~~~~~~------------~gSrII-vTTR~~  138 (285)
T pfam00931        79 SDWVEKNESELAVKIKEALLRKRFLLVLDDVWEKN-D-----WDKIGV-PFPDGE------------NGSRVI-VTTRSE  138 (285)
T ss_pred             CCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCHH-H-----HHHHHC-CCCCCC------------CCCEEE-EECCCH
T ss_conf             45555789999999999972796699963888789-9-----999734-575789------------982799-855758


Q ss_pred             CCCCHHHCCCEEEEEECCCCHHHHHHHHHHHHH
Q ss_conf             554413117247998258786899989998608
Q gi|254780270|r  492 LNIPLPLMDRMEIIRIAGYTEEEKLQIAKNHLV  524 (820)
Q Consensus       492 ~~i~~~l~drme~i~~~~y~~~ek~~i~~~~l~  524 (820)
                       ++...+.-...++++..-+.+|-..+.++|..
T Consensus       139 -~V~~~~~~~~~~~~l~~L~~~es~~Lf~~~a~  170 (285)
T pfam00931       139 -SVAGRMGGTSKPHEVESLEPEESWELFSNKVF  170 (285)
T ss_pred             -HHHHHCCCCCCEEECCCCCHHHHHHHHHHHHC
T ss_conf             -99987378883476168987999999999846


No 234
>PRK13531 regulatory ATPase RavA; Provisional
Probab=97.41  E-value=4.8e-05  Score=57.01  Aligned_cols=130  Identities=22%  Similarity=0.341  Sum_probs=81.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHH-CCCEEEEECCCCCCHHHHCC------------CCCCCCCCCCHHHHHHHHHC
Q ss_conf             467359986056565027999999770-88249986188888888356------------32001456712899999832
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKAT-GRQYVRMSLGGVYDEADIRG------------HRRTYIGSMPGRIIQSLKRA  430 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al-~r~f~~islgg~~d~~~i~g------------h~~ty~ga~pg~ii~~l~~~  430 (820)
                      ..|.-+.|.|||||+|+.|++.++.++ +-.|...=|.--....|+=|            ..|-.-|-+|    .     
T Consensus        37 lagehvlllGPPGtAKS~larrl~~~~~~a~~FeyLltRFstPeElFGP~si~~Lk~~g~y~R~t~G~LP----~-----  107 (498)
T PRK13531         37 LSGESVFLLGPPGIAKSLIARRLKFAFQHARAFEYLMTRFSTPEEVFGPLSIQALKDEGRYERLTSGYLP----E-----  107 (498)
T ss_pred             HCCCCEEEECCCCHHHHHHHHHHHHHHCCCHHHHHHHHCCCCHHHHCCCCCHHHHHHCCEEEEECCCCCC----C-----
T ss_conf             7289469888995138899999999855740899998746988885383329987117848972267588----6-----


Q ss_pred             CCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCC-C---CCHHHCCCEEEEE
Q ss_conf             78873999933155423117711556655406001681332010352364427999934865-5---4413117247998
Q gi|254780270|r  431 KRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTL-N---IPLPLMDRMEIIR  506 (820)
Q Consensus       431 ~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~-~---i~~~l~drme~i~  506 (820)
                         --+.+||||=|-++..    -++||.++.   -..|++-.-.+++.|  ..+|+..|.+ +   =-.+|.|||=+=-
T Consensus       108 ---A~iaFLDEIfKansAI----LNtLLtilN---Er~f~nG~~~~~vPL--~~li~ASNElP~~~~~L~AlyDRfL~R~  175 (498)
T PRK13531        108 ---AEIVFLDEIWKAGPAI----LNTLLTAIN---ERRFRNGAHEEKIPM--RLLVAASNELPEADSSLEALYDRMLIRL  175 (498)
T ss_pred             ---CEEEHHHHHHHCCHHH----HHHHHHHHH---HHEECCCCCEECCCH--HHHHHCCCCCCCCCCCHHHHHHHHHHHE
T ss_conf             ---6131578786148899----999999864---640347983130446--8864304679999840788887644102


Q ss_pred             ECCCCHHH
Q ss_conf             25878689
Q gi|254780270|r  507 IAGYTEEE  514 (820)
Q Consensus       507 ~~~y~~~e  514 (820)
                      .-+|..++
T Consensus       176 ~v~~v~~~  183 (498)
T PRK13531        176 WLDKVQDK  183 (498)
T ss_pred             ECCCCCCH
T ss_conf             23131676


No 235
>TIGR02858 spore_III_AA stage III sporulation protein AA; InterPro: IPR014217   Proteins in this entry include the stage III sporulation protein AA that is encoded by one of several genes in the spoIIIA locus. This protein is only found in species that are capable of endospore formation..
Probab=97.39  E-value=0.0013  Score=46.27  Aligned_cols=131  Identities=28%  Similarity=0.453  Sum_probs=95.2

Q ss_pred             CCCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCC-
Q ss_conf             3221068899877665201168999999999999842444673599860565650279999997708824998618888-
Q gi|254780270|r  325 KTKKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVY-  403 (820)
Q Consensus       325 ~~~~dl~~a~~iLd~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~-  403 (820)
                      .-++|+-=||+++..-        +.|++||    .+.+..-.=.+++|||=+|||+|-+=||+.+---+-++.+.|++ 
T Consensus        94 v~S~NiRIaRE~~G~A--------~~~~~yL----~d~~~~~~NTLiIsPPq~GKTTlLRDlaR~~StG~~~~~~~g~KV  161 (282)
T TIGR02858        94 VASLNIRIAREVLGAA--------DKILPYL----VDRNGRVLNTLIISPPQCGKTTLLRDLARILSTGISKLGLKGKKV  161 (282)
T ss_pred             CCCCCEEEEEECCCCC--------HHHHHHH----HCCCCCEEEEEEECCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCE
T ss_conf             4642133020005775--------6668877----305894467888868898851048889888607854246899746


Q ss_pred             ---CH-HHHCCC----------CCC-CCCCCCHHHHHHHHHC-CCCCE-EEEEECHHHHHHHCCCCHHHHHHHHCCCCCC
Q ss_conf             ---88-883563----------200-1456712899999832-78873-9999331554231177115566554060016
Q gi|254780270|r  404 ---DE-ADIRGH----------RRT-YIGSMPGRIIQSLKRA-KRSNP-LLLLDEIDKMGSDLRGDPSAALLEVLDPAQN  466 (820)
Q Consensus       404 ---d~-~~i~gh----------~~t-y~ga~pg~ii~~l~~~-~~~np-v~~ldeidk~~~~~~gdp~~allevldp~qn  466 (820)
                         || |||=|.          -|| -..+=|  =-|+|+-+ .+|-| ||.-|||-+. .|     .-||||++.    
T Consensus       162 givDERSEIAgC~~GvPQ~~vG~RtDVLD~CP--KAEGmMM~iRSMSP~Viv~DEIGr~-ED-----~~Al~eA~n----  229 (282)
T TIGR02858       162 GIVDERSEIAGCVNGVPQLDVGIRTDVLDGCP--KAEGMMMLIRSMSPDVIVVDEIGRE-ED-----VEALLEALN----  229 (282)
T ss_pred             EEEECCHHHHHHCCCCCCCCCCCCEEECCCCC--HHHHHHHHHHCCCCCEEEEECCCCH-HH-----HHHHHHHHC----
T ss_conf             99843246565458824144676067517885--3789999997069857998148895-33-----899999861----


Q ss_pred             CCEEEEECCCCCCCCCEEEEEECCCCC
Q ss_conf             813320103523644279999348655
Q gi|254780270|r  467 SSFVDHYLEVEYDLSDVMFIMTANTLN  493 (820)
Q Consensus       467 ~~f~d~y~~~~~dls~v~fi~tan~~~  493 (820)
                                    |.|=-||||---+
T Consensus       230 --------------aGV~~I~TaHg~~  242 (282)
T TIGR02858       230 --------------AGVSVIATAHGRD  242 (282)
T ss_pred             --------------CCCEEEEEECCCC
T ss_conf             --------------6756887640488


No 236
>PRK03731 aroL shikimate kinase II; Reviewed
Probab=97.39  E-value=0.00016  Score=53.08  Aligned_cols=29  Identities=41%  Similarity=0.763  Sum_probs=26.8

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEE
Q ss_conf             99860565650279999997708824998
Q gi|254780270|r  369 LCFVGPPGVGKTSLAQSIAKATGRQYVRM  397 (820)
Q Consensus       369 l~l~gppgvGKts~~~sia~al~r~f~~i  397 (820)
                      |.|+|+||+|||++||.+|+.||.+|+-.
T Consensus         5 I~LiG~mGsGKstiGk~LA~~L~~~fiD~   33 (172)
T PRK03731          5 LFLVGPRGCGKTTVGMALAQALGYRFVDT   33 (172)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEC
T ss_conf             89988999988999999999859997978


No 237
>KOG0480 consensus
Probab=97.39  E-value=0.0035  Score=42.93  Aligned_cols=157  Identities=28%  Similarity=0.419  Sum_probs=92.1

Q ss_pred             HHHHHHHCHHHHHHHHHHHH--HHHHHCC---CCCCCE-EEEECCCCCCHHHHHHHHHHHHCCCEEEE----ECCC----
Q ss_conf             77665201168999999999--9998424---446735-99860565650279999997708824998----6188----
Q gi|254780270|r  336 ILDQDHFGLEKVKERIIEYL--AVQMRVI---KNKGLI-LCFVGPPGVGKTSLAQSIAKATGRQYVRM----SLGG----  401 (820)
Q Consensus       336 iLd~~hyGl~~vK~rile~l--av~~~~~---~~~g~i-l~l~gppgvGKts~~~sia~al~r~f~~i----slgg----  401 (820)
                      .|=-..||.+.||.-|+=.|  .|.|...   +.+|-| +|+||-||+||..+-|+.+.-+-|--+.-    |-.|    
T Consensus       342 Sl~PsIyGhe~VK~GilL~LfGGv~K~a~eg~~lRGDinv~iVGDPgt~KSQfLk~v~~fsPR~vYtsGkaSSaAGLTaa  421 (764)
T KOG0480         342 SLFPSIYGHELVKAGILLSLFGGVHKSAGEGTSLRGDINVCIVGDPGTGKSQFLKAVCAFSPRSVYTSGKASSAAGLTAA  421 (764)
T ss_pred             HHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHCCCCCCEEECCCCCCCCCCEEE
T ss_conf             63762015389986689998478543578986546773189957997138899999865487315850763443464689


Q ss_pred             -CCCHHHHCCCCCCC-CCCCCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCC
Q ss_conf             -88888835632001-4567128999998327887399993315542311771155665540600168133201035236
Q gi|254780270|r  402 -VYDEADIRGHRRTY-IGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYD  479 (820)
Q Consensus       402 -~~d~~~i~gh~~ty-~ga~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~d  479 (820)
                       |+|+.   .+-+|. .||+        +  =.-|.|--+||.|||...-    ..|++|-..  |-          -+-
T Consensus       422 VvkD~e---sgdf~iEAGAL--------m--LADnGICCIDEFDKMd~~d----qvAihEAME--QQ----------tIS  472 (764)
T KOG0480         422 VVKDEE---SGDFTIEAGAL--------M--LADNGICCIDEFDKMDVKD----QVAIHEAME--QQ----------TIS  472 (764)
T ss_pred             EEECCC---CCCEEEECCCE--------E--ECCCCEEEECHHCCCCHHH----HHHHHHHHH--HH----------EEH
T ss_conf             976377---77335534737--------8--8169668831000357076----899999987--51----------000


Q ss_pred             CCCEEEEEE----------CC--------------CCCCCHHHCCCEEEEE--ECCCCHHHHHHHHHH
Q ss_conf             442799993----------48--------------6554413117247998--258786899989998
Q gi|254780270|r  480 LSDVMFIMT----------AN--------------TLNIPLPLMDRMEIIR--IAGYTEEEKLQIAKN  521 (820)
Q Consensus       480 ls~v~fi~t----------an--------------~~~i~~~l~drme~i~--~~~y~~~ek~~i~~~  521 (820)
                      +.|.=.+||          ||              .+++.+||+.|...+.  ++.-....-..||+.
T Consensus       473 IaKAGv~aTLnARtSIlAAANPv~GhYdR~ktl~eNi~msApimSRFDL~FiLlD~~nE~~D~~ia~h  540 (764)
T KOG0480         473 IAKAGVVATLNARTSILAAANPVGGHYDRKKTLRENINMSAPIMSRFDLFFILLDDCNEVVDYAIARH  540 (764)
T ss_pred             HEECCEEEEECCHHHHHHHCCCCCCCCCCCCCHHHHCCCCCHHHHHHCEEEEEECCCCHHHHHHHHHH
T ss_conf             33020688622235555532776774553300665227780454222279999357866777999999


No 238
>PRK13949 shikimate kinase; Provisional
Probab=97.38  E-value=0.00016  Score=53.04  Aligned_cols=29  Identities=31%  Similarity=0.667  Sum_probs=26.9

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEE
Q ss_conf             99860565650279999997708824998
Q gi|254780270|r  369 LCFVGPPGVGKTSLAQSIAKATGRQYVRM  397 (820)
Q Consensus       369 l~l~gppgvGKts~~~sia~al~r~f~~i  397 (820)
                      |.|+|+||.||||+||.+|+.||.+|+-.
T Consensus         4 I~LiG~mGsGKstiGk~La~~l~~~fiD~   32 (169)
T PRK13949          4 IFLVGYMGAGKTTLGKALARELGLSFIDL   32 (169)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEC
T ss_conf             89979999988999999999959997978


No 239
>PRK06964 DNA polymerase III subunit delta'; Validated
Probab=97.37  E-value=0.00078  Score=47.85  Aligned_cols=139  Identities=17%  Similarity=0.233  Sum_probs=84.0

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCE---EEEECCCCCCHHHH-CC-CCCC-CC-------------------
Q ss_conf             444673599860565650279999997708824---99861888888883-56-3200-14-------------------
Q gi|254780270|r  362 IKNKGLILCFVGPPGVGKTSLAQSIAKATGRQY---VRMSLGGVYDEADI-RG-HRRT-YI-------------------  416 (820)
Q Consensus       362 ~~~~g~il~l~gppgvGKts~~~sia~al~r~f---~~islgg~~d~~~i-~g-h~~t-y~-------------------  416 (820)
                      .+.-+.-+.|.||.|+||..+|...|++|-=.-   --.+.|-.+.-.-+ .| |--- ++                   
T Consensus        17 ~~rl~HA~Lf~Gp~G~Gk~~lA~~~A~~llC~~~~~~~~~Cg~C~sC~~~~~~~HPD~~~i~Pe~~~~~~~~~~~~~~~~   96 (342)
T PRK06964         17 RARWPHALLLHGQAGIGKLAFAQHLAQGLLCETPQPNGEPCGTCAACTWFAQGNHPDYRIVRPEALAAEAPGAADDAKAA   96 (342)
T ss_pred             CCCHHEEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEECCCHHCCCCCCCCCHHHHH
T ss_conf             68713057657999867999999999998389999888978677778888627999745534002102233321001011


Q ss_pred             -----C---CCCHH-----HHHHHHH------CCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCC
Q ss_conf             -----5---67128-----9999983------278873999933155423117711556655406001681332010352
Q gi|254780270|r  417 -----G---SMPGR-----IIQSLKR------AKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVE  477 (820)
Q Consensus       417 -----g---a~pg~-----ii~~l~~------~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~  477 (820)
                           |   ..|++     -|+.|.+      .....=|+++|..|+|..    .-++|||-.|-             -|
T Consensus        97 ~~~~~~~~~~~~~~~I~idqiR~l~~~l~~~~~~g~~kVviI~~Ae~mn~----~aaNalLK~LE-------------EP  159 (342)
T PRK06964         97 DADEGGKKTRAPSKEIKIEQVRALLDFCGVGSHRGGARVVVLYPAEALNV----AAANALLKTLE-------------EP  159 (342)
T ss_pred             HHHHHCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEECCHHHHCH----HHHHHHHHHHC-------------CC
T ss_conf             12221012356556454999999999970075458844999827787389----99999999723-------------79


Q ss_pred             CCCCCEEEEEECCCCC-CCHHHCCCEEEEEECCCCHHHHHHHH
Q ss_conf             3644279999348655-44131172479982587868999899
Q gi|254780270|r  478 YDLSDVMFIMTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQIA  519 (820)
Q Consensus       478 ~dls~v~fi~tan~~~-i~~~l~drme~i~~~~y~~~ek~~i~  519 (820)
                      =  .+++||.+++..+ +++.++.|--.+.++.-+.++-..--
T Consensus       160 p--~~~~~iL~~~~~~~llpTI~SRcq~~~~~~~~~~~~~~~L  200 (342)
T PRK06964        160 P--PGVVFLLVSARIDRLLPTILSRCRQWPMTVPAPEAAAAWL  200 (342)
T ss_pred             C--CCEEEEEEECCHHHCCHHHHHCCEEECCCCCCHHHHHHHH
T ss_conf             8--7848999869925483688767643028995999999999


No 240
>PRK12377 putative replication protein; Provisional
Probab=97.35  E-value=0.00067  Score=48.36  Aligned_cols=86  Identities=27%  Similarity=0.436  Sum_probs=49.0

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH---CCCEEEEECCCCCCHHHHCCCCCCCCCC-CCHHHHHHHHHCCCCCEEEEEEC
Q ss_conf             7359986056565027999999770---8824998618888888835632001456-71289999983278873999933
Q gi|254780270|r  366 GLILCFVGPPGVGKTSLAQSIAKAT---GRQYVRMSLGGVYDEADIRGHRRTYIGS-MPGRIIQSLKRAKRSNPLLLLDE  441 (820)
Q Consensus       366 g~il~l~gppgvGKts~~~sia~al---~r~f~~islgg~~d~~~i~gh~~ty~ga-~pg~ii~~l~~~~~~npv~~lde  441 (820)
                      +--+.|+||||||||.||-+|+..+   |+.-..+++..+  -..++.   +|-.. .--++++.+.+    -++.+|||
T Consensus       101 ~~NlIf~G~pGtGKTHLA~AIg~~a~~~G~sVlF~t~~dL--v~~L~~---a~~~g~~~~k~l~~l~~----~dLLIIDE  171 (248)
T PRK12377        101 CTNFVFSGKPGTGKNHLAAAIGNRLLAKGRSVIVVTVPDV--MSRLHE---SYDNGQSGEKFLQELCK----VDLLVLDE  171 (248)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHHHH--HHHHHH---HHHCCCCHHHHHHHHHC----CCEEEEHH
T ss_conf             8608998999987889999999999987996999889999--999999---99848509999999733----89898600


Q ss_pred             HHHHHHHCCCCHHHHHHHHCC
Q ss_conf             155423117711556655406
Q gi|254780270|r  442 IDKMGSDLRGDPSAALLEVLD  462 (820)
Q Consensus       442 idk~~~~~~gdp~~allevld  462 (820)
                      +.-...+  -.-++-|.+|+|
T Consensus       172 lG~~~~s--~~~~~llfqlI~  190 (248)
T PRK12377        172 IGIQRET--KNEQVVLNQIID  190 (248)
T ss_pred             CCCCCCC--HHHHHHHHHHHH
T ss_conf             0578898--679999999999


No 241
>PRK00625 shikimate kinase; Provisional
Probab=97.34  E-value=0.00019  Score=52.47  Aligned_cols=30  Identities=30%  Similarity=0.505  Sum_probs=27.5

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             998605656502799999977088249986
Q gi|254780270|r  369 LCFVGPPGVGKTSLAQSIAKATGRQYVRMS  398 (820)
Q Consensus       369 l~l~gppgvGKts~~~sia~al~r~f~~is  398 (820)
                      |.|+|+||+|||++||.+|+.||++|+-..
T Consensus         3 I~LIG~mGsGKStiGk~LA~~l~~~FvD~D   32 (173)
T PRK00625          3 IFLCGLPTVGKTSFGKALAKFLSLPFFDTD   32 (173)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEECH
T ss_conf             999899999889999999999399957749


No 242
>PRK06835 DNA replication protein DnaC; Validated
Probab=97.34  E-value=0.002  Score=44.82  Aligned_cols=90  Identities=20%  Similarity=0.238  Sum_probs=46.5

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHCC---CEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECH
Q ss_conf             735998605656502799999977088---24998618888888835632001456712899999832788739999331
Q gi|254780270|r  366 GLILCFVGPPGVGKTSLAQSIAKATGR---QYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEI  442 (820)
Q Consensus       366 g~il~l~gppgvGKts~~~sia~al~r---~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~ldei  442 (820)
                      ..=|.|.||+|||||-|+-+||++|=.   ....++.-.+-  ..|+..++.--+. --.+.+.+..    -++.+||++
T Consensus       183 ~~nLlf~G~~G~GKTfLa~~IA~ell~~g~sViy~ta~~L~--~~l~~~~~~~~~~-~~~~~~~l~~----~DLLIIDDL  255 (330)
T PRK06835        183 NENLLFYGNTGTGKTFLSNCIAKELLDRGKTVIYRTSDELI--ENLREIRFNNDND-APELEDLLIN----CDLLIIDDL  255 (330)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHHHHH--HHHHHHHCCCCCC-HHHHHHHHHH----CCEEEEECC
T ss_conf             88669889999988999999999999879949996299999--9999975457644-8999999961----898997210


Q ss_pred             HHHHHHCCCCHHHHHHHHCCCC
Q ss_conf             5542311771155665540600
Q gi|254780270|r  443 DKMGSDLRGDPSAALLEVLDPA  464 (820)
Q Consensus       443 dk~~~~~~gdp~~allevldp~  464 (820)
                      ..-..+  ---.+.|.+++|--
T Consensus       256 G~E~~t--~~~~~~Lf~iIN~R  275 (330)
T PRK06835        256 GTESIT--EFSKTELFNLINKR  275 (330)
T ss_pred             CCCCCC--HHHHHHHHHHHHHH
T ss_conf             345588--68999999999999


No 243
>KOG1970 consensus
Probab=97.33  E-value=0.00089  Score=47.41  Aligned_cols=177  Identities=22%  Similarity=0.267  Sum_probs=94.6

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEE-------CCCCCCHHHHCCCCCCCC
Q ss_conf             1689999999999998424446735998605656502799999977088249986-------188888888356320014
Q gi|254780270|r  344 LEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMS-------LGGVYDEADIRGHRRTYI  416 (820)
Q Consensus       344 l~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~is-------lgg~~d~~~i~gh~~ty~  416 (820)
                      +++||+-..   .|-..+++.++.||+|.||+|+|||+..+-+|+-||-.+..-+       -+-++++++-++  .-|.
T Consensus        91 I~eVk~WL~---~~~~~~~~l~~~iLLltGPsGcGKSTtvkvLskelg~~~~Ew~Npi~~~~~~~~h~~t~~~~--~~~~  165 (634)
T KOG1970          91 ISEVKQWLK---QVAEFTPKLGSRILLLTGPSGCGKSTTVKVLSKELGYQLIEWSNPINLKEPENLHNETSFLM--FPYQ  165 (634)
T ss_pred             HHHHHHHHH---HHHHHCCCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCCCCCCCCHHCC--CCHH
T ss_conf             899999999---99974536676079985798887131999999864802123047766566555455440013--3036


Q ss_pred             CCCC------------HHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEE
Q ss_conf             5671------------2899999832788739999331554231177115566554060016813320103523644279
Q gi|254780270|r  417 GSMP------------GRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVM  484 (820)
Q Consensus       417 ga~p------------g~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~  484 (820)
                      .-|+            |.+-....+..+.--+||+||+--+.-.   |-+-++=|+|-         -|.-  +-..-++
T Consensus       166 s~L~~fesFler~~kyg~l~~~g~~~~~~~~liLveDLPn~~~~---d~~~~f~evL~---------~y~s--~g~~PlI  231 (634)
T KOG1970         166 SQLAVFESFLLRATKYGSLQMSGDDLRTDKKLILVEDLPNQFYR---DDSETFREVLR---------LYVS--IGRCPLI  231 (634)
T ss_pred             HHHHHHHHHHHHHHHHCHHHHCCCCCCCCCEEEEEECCCHHHHH---HHHHHHHHHHH---------HHHH--CCCCCEE
T ss_conf             67899998999987623165313333467507985026144400---36999999999---------9984--5777679


Q ss_pred             EEEEC-CC--CCCCHH-------HCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHH
Q ss_conf             99934-86--554413-------11724799825878689998999860898998625781313228999
Q gi|254780270|r  485 FIMTA-NT--LNIPLP-------LMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGV  544 (820)
Q Consensus       485 fi~ta-n~--~~i~~~-------l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~  544 (820)
                      ||-|- +.  .+.+..       -.-|...|...+-+..    |-|++|- +++...+-....+...+.+
T Consensus       232 f~iTd~~~~g~nnq~rlf~~d~q~~~ri~~IsFNPIa~T----~MKK~L~-ric~~e~~~~s~~k~~~~~  296 (634)
T KOG1970         232 FIITDSLSNGNNNQDRLFPKDIQEEPRISNISFNPIAPT----IMKKFLK-RICRIEANKKSGIKVPDTA  296 (634)
T ss_pred             EEEECCCCCCCCCHHHHCHHHHHHCCCCCEEEECCCCHH----HHHHHHH-HHHHHHCCCCCCCCCCHHH
T ss_conf             998635357876343424265653358524761577679----9999999-9999862666667675067


No 244
>KOG0741 consensus
Probab=97.33  E-value=0.0024  Score=44.10  Aligned_cols=85  Identities=28%  Similarity=0.477  Sum_probs=56.0

Q ss_pred             HHHHH--HHHHHHHCCCCCCC--EEEEECCCCCCHHHHHHHHHHHHCCCEEEEE----CCCCCCHHHHCCCCCCCCCCCC
Q ss_conf             99999--99999842444673--5998605656502799999977088249986----1888888883563200145671
Q gi|254780270|r  349 ERIIE--YLAVQMRVIKNKGL--ILCFVGPPGVGKTSLAQSIAKATGRQYVRMS----LGGVYDEADIRGHRRTYIGSMP  420 (820)
Q Consensus       349 ~rile--~lav~~~~~~~~g~--il~l~gppgvGKts~~~sia~al~r~f~~is----lgg~~d~~~i~gh~~ty~ga~p  420 (820)
                      .+|++  .+-|.+.+.+-+.+  -++|.||||+|||+||--||..-+-||++|-    +-|+...|-            .
T Consensus       517 ~~il~~G~llv~qvk~s~~s~lvSvLl~Gp~~sGKTaLAA~iA~~S~FPFvKiiSpe~miG~sEsaK------------c  584 (744)
T KOG0741         517 TRILDDGKLLVQQVKNSERSPLVSVLLEGPPGSGKTALAAKIALSSDFPFVKIISPEDMIGLSESAK------------C  584 (744)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEECHHHHCCCCHHHH------------H
T ss_conf             7887668899998633466763589986699887688999997527998479737787037466788------------9


Q ss_pred             HHHHHHHHHC-CCCCEEEEEECHHHH
Q ss_conf             2899999832-788739999331554
Q gi|254780270|r  421 GRIIQSLKRA-KRSNPLLLLDEIDKM  445 (820)
Q Consensus       421 g~ii~~l~~~-~~~npv~~ldeidk~  445 (820)
                      --|......| ++.--+|++|+|..+
T Consensus       585 ~~i~k~F~DAYkS~lsiivvDdiErL  610 (744)
T KOG0741         585 AHIKKIFEDAYKSPLSIIVVDDIERL  610 (744)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCHHHH
T ss_conf             99999888763386508998155656


No 245
>PRK05818 DNA polymerase III subunit delta'; Validated
Probab=97.31  E-value=0.0018  Score=45.04  Aligned_cols=173  Identities=14%  Similarity=0.110  Sum_probs=102.0

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCC-----------CEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHH----
Q ss_conf             46735998605656502799999977088-----------249986188888888356320014567128999998----
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGR-----------QYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLK----  428 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r-----------~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~----  428 (820)
                      .+...|+|.|++|.|+--++...|++|==           -+.++.-|.--|--.+..    .-++...--+..+.    
T Consensus         6 n~~halLl~~~~G~~~~~~~~~~~k~LlC~~~~~PCG~C~sC~~i~~g~HPD~~~i~p----e~~sIkieqir~li~~l~   81 (262)
T PRK05818          6 NKTHPLLLIERKGSFLKPFLYEYLTSIVCTKANGFCKTCESCLKILNGKYNDFYLIFD----QKNPIKKEDALSIINKLN   81 (262)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHCCCCCCEEEEEC----CCCCCCHHHHHHHHHHHH
T ss_conf             8985056644877646999999999862289999998886278675589997799716----645577989999999982


Q ss_pred             HCC-C--CCEEEEEECHHHHHHHCCCCHHHHHHHHC-CCCCCCCEEEEECCCCCCCCCEEEEEECCCC-CCCHHHCCCEE
Q ss_conf             327-8--87399993315542311771155665540-6001681332010352364427999934865-54413117247
Q gi|254780270|r  429 RAK-R--SNPLLLLDEIDKMGSDLRGDPSAALLEVL-DPAQNSSFVDHYLEVEYDLSDVMFIMTANTL-NIPLPLMDRME  503 (820)
Q Consensus       429 ~~~-~--~npv~~ldeidk~~~~~~gdp~~allevl-dp~qn~~f~d~y~~~~~dls~v~fi~tan~~-~i~~~l~drme  503 (820)
                      ... .  .+-|++++..|+|+..    .++|||-.| .|.+                +++||.+++.. .+++..+.|-=
T Consensus        82 ~~s~e~~g~KV~II~~Ae~Mt~~----AANALLKtLEEPp~----------------nt~fIL~t~~~~~LLPTIrSRC~  141 (262)
T PRK05818         82 RPSVESNGKKIYIIYGIEKLNKQ----SANSLLKLIEEPPK----------------NTYGIFTTRNENNILNTILSRCV  141 (262)
T ss_pred             HCCCCCCCCEEEEECCHHHHCHH----HHHHHHHHHCCCCC----------------CEEEEEEECCHHHCCCHHHHHCC
T ss_conf             11400288489998777874999----99999986128987----------------83899973881437308887701


Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             99825878689998999860898998625781313228999999973177410234788879999898
Q gi|254780270|r  504 IIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARK  571 (820)
Q Consensus       504 ~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~  571 (820)
                      -  ..--+ +|+....+...-+       ...+.+.+++..+..++..|...+ ||.+.-.+....-+
T Consensus       142 ~--~~~~~-~~~~~~~~~~~~~-------~~~~~i~~~~~s~de~~~~~~~gs-~~~~l~il~~~i~~  198 (262)
T PRK05818        142 Q--YVVLS-KEKKVPFKVESND-------RYFQYILLSFYSVDEQLQAYNNGS-FSKLKNIIETLINK  198 (262)
T ss_pred             C--CCCCC-HHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHCCCC-HHHHHHHHHHHHHC
T ss_conf             4--46664-3466788887408-------889876410110799998861676-88899999999875


No 246
>KOG2035 consensus
Probab=97.30  E-value=0.01  Score=39.31  Aligned_cols=164  Identities=24%  Similarity=0.370  Sum_probs=103.8

Q ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHHHH-C----------CCEEE-------EECCCCC-----CHHHHCCCCCCCCC
Q ss_conf             244467359986056565027999999770-8----------82499-------8618888-----88883563200145
Q gi|254780270|r  361 VIKNKGLILCFVGPPGVGKTSLAQSIAKAT-G----------RQYVR-------MSLGGVY-----DEADIRGHRRTYIG  417 (820)
Q Consensus       361 ~~~~~g~il~l~gppgvGKts~~~sia~al-~----------r~f~~-------islgg~~-----d~~~i~gh~~ty~g  417 (820)
                      .....=|.|.++||-|.||-+....+-+-| |          |.|..       |+-=.-.     ..|+---|.|    
T Consensus        29 ~~~~d~PHll~yGPSGaGKKTrimclL~elYG~gveklki~~~t~~tpS~kklEistvsS~yHlEitPSDaG~~DR----  104 (351)
T KOG2035          29 SSTGDFPHLLVYGPSGAGKKTRIMCLLRELYGVGVEKLKIETRTFTTPSKKKLEISTVSSNYHLEITPSDAGNYDR----  104 (351)
T ss_pred             CCCCCCCEEEEECCCCCCCHHHHHHHHHHHHCCCCHHEEEEEEEEECCCCCEEEEEEECCCCEEEECHHHCCCCCH----
T ss_conf             1457787078888898872111899999885787245056667886488863799994256517747343375117----


Q ss_pred             CCCHHHHHHHHH-CCCCCE----------EEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEE
Q ss_conf             671289999983-278873----------999933155423117711556655406001681332010352364427999
Q gi|254780270|r  418 SMPGRIIQSLKR-AKRSNP----------LLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFI  486 (820)
Q Consensus       418 a~pg~ii~~l~~-~~~~np----------v~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi  486 (820)
                          -+||.|.| +.-+-|          |+++.|.|+++.+.+    +||=--.         ..|.      |.+=.|
T Consensus       105 ----vViQellKevAQt~qie~~~qr~fKvvvi~ead~LT~dAQ----~aLRRTM---------EkYs------~~~RlI  161 (351)
T KOG2035         105 ----VVIQELLKEVAQTQQIETQGQRPFKVVVINEADELTRDAQ----HALRRTM---------EKYS------SNCRLI  161 (351)
T ss_pred             ----HHHHHHHHHHHHHCCHHHCCCCCEEEEEEECHHHHHHHHH----HHHHHHH---------HHHH------CCCEEE
T ss_conf             ----9999999998741413332666548999803576508899----9999999---------9986------071699


Q ss_pred             EECCCCC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHH
Q ss_conf             9348655-441311724799825878689998999860898998625781313228999999973177410234788879
Q gi|254780270|r  487 MTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERAL  565 (820)
Q Consensus       487 ~tan~~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i  565 (820)
                      ..+|+.+ |-+|++.|--.|.+++.+.+|-..+-.+     .+++     +.+.++++.+..|.++-.     |||.|.|
T Consensus       162 l~cns~SriIepIrSRCl~iRvpaps~eeI~~vl~~-----v~~k-----E~l~lp~~~l~rIa~kS~-----~nLRrAl  226 (351)
T KOG2035         162 LVCNSTSRIIEPIRSRCLFIRVPAPSDEEITSVLSK-----VLKK-----EGLQLPKELLKRIAEKSN-----RNLRRAL  226 (351)
T ss_pred             EEECCCCCCHHHHHHHEEEEECCCCCHHHHHHHHHH-----HHHH-----HCCCCCHHHHHHHHHHHC-----CCHHHHH
T ss_conf             992674302267762205876789987899999999-----9987-----334484999999999706-----4399999


Q ss_pred             H
Q ss_conf             9
Q gi|254780270|r  566 M  566 (820)
Q Consensus       566 ~  566 (820)
                      -
T Consensus       227 l  227 (351)
T KOG2035         227 L  227 (351)
T ss_pred             H
T ss_conf             9


No 247
>pfam01057 Parvo_NS1 Parvovirus non-structural protein NS1. This family also contains the NS2 protein. Parvoviruses encode two non-structural proteins, NS1 and NS2. The mRNA for NS2 contains the coding sequence for the first 87 amino acids of NS1, then by an alternative splicing mechanism mRNA from a different reading frame, encoding the last 78 amino acids, makes up the full length of the NS2 mRNA. NS1, is the major non-structural protein. It is essential for DNA replication. It is an 83-kDa nuclear phosphoprotein. It has DNA helicase and ATPase activity.
Probab=97.30  E-value=0.0054  Score=41.48  Aligned_cols=155  Identities=21%  Similarity=0.247  Sum_probs=93.7

Q ss_pred             CCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCH
Q ss_conf             22106889987766520116899999999999984244467359986056565027999999770882499861888888
Q gi|254780270|r  326 TKKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDE  405 (820)
Q Consensus       326 ~~~dl~~a~~iLd~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~  405 (820)
                      ......+.-++|-...|.=..|..-++-++    .+...|-..+.|.|||.+|||-+|.||+++++.  +.. +-. +++
T Consensus        77 ~~i~~N~~~~l~~~~gy~P~~~g~~l~~w~----~k~~~krN~i~~~Gp~~TGks~la~ai~~~~~~--~g~-v~~-~N~  148 (271)
T pfam01057        77 FDIEENRIYQLLSLNGYNPAEVGQVLLAWL----SKQGGKRNTVWFYGPASTGKTNLAQAIAHAVPL--YGC-VNW-TNE  148 (271)
T ss_pred             CCCCCCHHHHHHHHCCCCHHHHHHHHHHHH----HCCCCCCCEEEEECCCCCCHHHHHHHHHHHCCC--EEE-ECC-CCC
T ss_conf             664417899999984999899999999998----447888756999889876789999999986895--278-517-877


Q ss_pred             HH----HCCCC--CCCCCCCCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCC
Q ss_conf             88----35632--0014567128999998327887399993315542311771155665540600168133201035236
Q gi|254780270|r  406 AD----IRGHR--RTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYD  479 (820)
Q Consensus       406 ~~----i~gh~--~ty~ga~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~d  479 (820)
                      ++    ..++-  -==-|.|+...+..+|..---++|. +|-..|-+.....-|     .++-+  |           . 
T Consensus       149 ~fp~~d~~~~~~~wwee~~~~~~~ve~~r~il~G~~i~-vD~k~k~~~~l~~~P-----viiTs--n-----------~-  208 (271)
T pfam01057       149 NFPFNDCPNKLLIWWEEGLMTVKVVELAKAILGGTDVR-VDQKCKGSVEIEPTP-----VIITS--N-----------H-  208 (271)
T ss_pred             CCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHCCCCCE-EECCCCCCCCCCCCC-----EEEEE--C-----------C-
T ss_conf             88764465478999807887188999999972999625-634789800237997-----89982--7-----------8-


Q ss_pred             CCCEEEEEECCCCC--CCHHHCCCEEEEEECCC
Q ss_conf             44279999348655--44131172479982587
Q gi|254780270|r  480 LSDVMFIMTANTLN--IPLPLMDRMEIIRIAGY  510 (820)
Q Consensus       480 ls~v~fi~tan~~~--i~~~l~drme~i~~~~y  510 (820)
                        ++-++...|...  =..||+|||-.+.+..-
T Consensus       209 --di~~v~~g~~~s~~Ha~~Lk~rm~~~~~~~~  239 (271)
T pfam01057       209 --DITLVVDGNTTSFEHAQPLKDRMYKFNLTKR  239 (271)
T ss_pred             --CEEEEEECCCCCHHHHHHHHHHEEEEEECCC
T ss_conf             --5799986875357777787653689885767


No 248
>KOG1808 consensus
Probab=97.25  E-value=0.00092  Score=47.30  Aligned_cols=138  Identities=28%  Similarity=0.412  Sum_probs=89.1

Q ss_pred             HHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCC-------CHHHHHHHHHC
Q ss_conf             98424446735998605656502799999977088249986188888888356320014567-------12899999832
Q gi|254780270|r  358 QMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSM-------PGRIIQSLKRA  430 (820)
Q Consensus       358 ~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~-------pg~ii~~l~~~  430 (820)
                      ..+.-+.+--=+||.||-|.||||+.+-.|+++|++|+||..---.|-.+.-|   ||+..-       -|..|+||++.
T Consensus       432 ~~~a~~~~~~pillqG~tssGKtsii~~la~~~g~~~vrinnhehtd~qeyig---~y~~~~~g~l~freg~LV~Alr~G  508 (1856)
T KOG1808         432 LARAISSGKFPILLQGPTSSGKTSIIKELARATGKNIVRINNHEHTDLQEYIG---TYVADDNGDLVFREGVLVQALRNG  508 (1856)
T ss_pred             HHHHHHCCCCCEEEECCCCCCCHHHHHHHHHHHCCCCEEHHCCCCCHHHHHHH---HHEECCCCCEEEEHHHHHHHHHHC
T ss_conf             99999658998677547676811599999998546734200246333999986---650078897255346899998708


Q ss_pred             CCCCEEEEEECHHHHHHHCCCCHHHHHHHHCC-------CCCCCCEEEEECCCCCCCCCEEEEEECCCC------C-CCH
Q ss_conf             78873999933155423117711556655406-------001681332010352364427999934865------5-441
Q gi|254780270|r  431 KRSNPLLLLDEIDKMGSDLRGDPSAALLEVLD-------PAQNSSFVDHYLEVEYDLSDVMFIMTANTL------N-IPL  496 (820)
Q Consensus       431 ~~~npv~~ldeidk~~~~~~gdp~~allevld-------p~qn~~f~d~y~~~~~dls~v~fi~tan~~------~-i~~  496 (820)
                          ..++||||-=...    |--.||.-+||       ||-|-.++-|=.        -+-.+|-|..      . +.+
T Consensus       509 ----~~~vlD~lnla~~----dvL~aLnrllddnRel~ipe~~rlv~~h~~--------f~lfatqn~~~~y~grk~lsR  572 (1856)
T KOG1808         509 ----DWIVLDELNLAPH----DVLEALNRLLDDNRELFIPETQRLVKAHPE--------FMLFATQNPPGTYGGRKILSR  572 (1856)
T ss_pred             ----CEEEECCCCCCCH----HHHHHHHHHHHHHCCCCCCCCCEEECCCCC--------HHHHHHCCCCCCCCHHHHHHH
T ss_conf             ----7798402012406----789999840454041256344323224701--------234543077666531566553


Q ss_pred             HHCCCEEEEEECCCCHHH
Q ss_conf             311724799825878689
Q gi|254780270|r  497 PLMDRMEIIRIAGYTEEE  514 (820)
Q Consensus       497 ~l~drme~i~~~~y~~~e  514 (820)
                      ++++|.-.+++---..+|
T Consensus       573 a~~~rf~e~~f~~~~e~e  590 (1856)
T KOG1808         573 ALRNRFIELHFDDIGEEE  590 (1856)
T ss_pred             CCCCCCHHHHHHHCCCHH
T ss_conf             144400235355257145


No 249
>pfam00910 RNA_helicase RNA helicase. This family includes RNA helicases thought to be involved in duplex unwinding during viral RNA replication. Members of this family are found in a variety of single stranded RNA viruses.
Probab=97.22  E-value=0.00033  Score=50.68  Aligned_cols=98  Identities=21%  Similarity=0.417  Sum_probs=50.7

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECHHHHHHH
Q ss_conf             99860565650279999997708824998618888888835632001456712899999832788739999331554231
Q gi|254780270|r  369 LCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSD  448 (820)
Q Consensus       369 l~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~ldeidk~~~~  448 (820)
                      ++|.||||+|||.+++.+|+++.+.+-.            ....+.|....-...-.+.    ...+|+++|++..... 
T Consensus         1 i~l~G~~G~GKS~~a~~la~~~~~~~~~------------~~~~~~Y~~~~~~~~wdgY----~gq~vvi~DD~~~~~~-   63 (105)
T pfam00910         1 IWLYGPPGCGKSTLAKYLARALLDHLGL------------PKKDSVYSRNPDDDFWDGY----TGQPVVIIDDFGQNPD-   63 (105)
T ss_pred             CEEECCCCCCHHHHHHHHHHHHHHHHCC------------CCCCCEEECCCCCCCCCCC----CCCEEEEEECCCCCCC-
T ss_conf             9897999898899999999999998377------------8789779678877656788----9985799965777888-


Q ss_pred             CCCC-HHHHHHHHCCCCCCCCEEEEE--C---CCCCCCCCEEEEEECC
Q ss_conf             1771-155665540600168133201--0---3523644279999348
Q gi|254780270|r  449 LRGD-PSAALLEVLDPAQNSSFVDHY--L---EVEYDLSDVMFIMTAN  490 (820)
Q Consensus       449 ~~gd-p~~allevldp~qn~~f~d~y--~---~~~~dls~v~fi~tan  490 (820)
                        ++ ..+.+.-+.+   +..|.=+.  +   +.+|+ |++ .|+|+|
T Consensus        64 --~~~~~~~~~~lvs---~~p~~~~ma~le~Kg~~f~-s~~-vi~tsN  104 (105)
T pfam00910        64 --GPSDEAELIRLVS---STPYPPPMAALEEKGTPFT-SKF-VIVTSN  104 (105)
T ss_pred             --CCHHHHHHHHHHC---CCCCCCCCCCHHHCCCCCC-CCE-EEEECC
T ss_conf             --6288999998756---9983888667614888446-888-999479


No 250
>PRK09270 frcK putative fructose transport system kinase; Reviewed
Probab=97.19  E-value=0.0019  Score=44.86  Aligned_cols=43  Identities=26%  Similarity=0.549  Sum_probs=35.6

Q ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCC-----EEEEECCCCC
Q ss_conf             244467359986056565027999999770882-----4998618888
Q gi|254780270|r  361 VIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQ-----YVRMSLGGVY  403 (820)
Q Consensus       361 ~~~~~g~il~l~gppgvGKts~~~sia~al~r~-----f~~islgg~~  403 (820)
                      ....+--|+++.||||.|||++|+.+++.|++.     .+.+++-|-+
T Consensus        29 ~~~~rR~lIgIaG~pGSGKSTlA~~l~~~L~~~~~~~~~~~vpmDGFH   76 (230)
T PRK09270         29 AEPQRRTVVGIAGPPGAGKSTLAETLWEALSQQGPELPAIQVPMDGFH   76 (230)
T ss_pred             CCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCEEEECCCCCC
T ss_conf             599971899998999889999999999998623799857997365334


No 251
>PRK09183 transposase/IS protein; Provisional
Probab=97.15  E-value=0.00024  Score=51.68  Aligned_cols=161  Identities=22%  Similarity=0.366  Sum_probs=82.4

Q ss_pred             HCCCCCCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH---CC
Q ss_conf             404158766322106889987766520116899999999999984244467359986056565027999999770---88
Q gi|254780270|r  316 LGVPWDKKSKTKKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKAT---GR  392 (820)
Q Consensus       316 ~~lPW~~~t~~~~dl~~a~~iLd~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al---~r  392 (820)
                      ..+||.+ +-+.+|....+.           +...-+.-||-..+-.  .+.=++|+||||||||.||-+|+...   |.
T Consensus        65 A~fp~~k-tle~fDf~~~~~-----------l~~~~i~~La~~~fi~--~~~Nvil~G~~GtGKThLA~Alg~~A~~~G~  130 (258)
T PRK09183         65 AAFPAVK-TFEEYDFTFATG-----------APQKQLQSLRSLSFIE--RNENIVLLGPSGVGKTHLAIALGYEAVRAGI  130 (258)
T ss_pred             CCCCCCC-CHHHCCCCCCCC-----------CCHHHHHHHHCCCHHH--CCCCEEEECCCCCCHHHHHHHHHHHHHHCCC
T ss_conf             7999987-775556546886-----------2389999882581665--5886799899998689999999999998799


Q ss_pred             CEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEE
Q ss_conf             24998618888888835632001456712899999832788739999331554231177115566554060016813320
Q gi|254780270|r  393 QYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDH  472 (820)
Q Consensus       393 ~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~  472 (820)
                      +-..+++..+-  .+++-.+.      -|+.-+.+++.=..--++++||+.-..-+-  .-+..|.|+++---.+     
T Consensus       131 ~v~f~~~~~L~--~~L~~a~~------~~~~~~~l~r~l~~~dLLIiDdlG~~~~~~--~~~~~lfeli~~Rye~-----  195 (258)
T PRK09183        131 KVRFTTAADLL--LQLSTAQR------QGRYKTTLQRGVMAPRLLIIDEIGYLPFSQ--EEANLFFQVIAKRYEK-----  195 (258)
T ss_pred             EEEEEEHHHHH--HHHHHHHH------CCCHHHHHHHHHCCCCEEEEHHHHCCCCCH--HHHHHHHHHHHHHHCC-----
T ss_conf             39997899999--99999987------685999999874346514431331546888--8999999999998576-----


Q ss_pred             ECCCCCCCCCEEEEEECCCC-----C-------CCHHHCCC----EEEEEECC--CCHHHH
Q ss_conf             10352364427999934865-----5-------44131172----47998258--786899
Q gi|254780270|r  473 YLEVEYDLSDVMFIMTANTL-----N-------IPLPLMDR----MEIIRIAG--YTEEEK  515 (820)
Q Consensus       473 y~~~~~dls~v~fi~tan~~-----~-------i~~~l~dr----me~i~~~~--y~~~ek  515 (820)
                              +  =.|.|.|-.     +       +-.+++||    -++|.+.|  |-..++
T Consensus       196 --------~--S~IiTSn~~~~~W~~~f~~D~~la~AilDRL~H~a~~i~l~GeSyR~k~~  246 (258)
T PRK09183        196 --------G--AMILTSNLPFGQWDQTFAGDAALTSAMLDRLLHHSHVVQIKGESYRLKQK  246 (258)
T ss_pred             --------C--CEEEECCCCHHHHHHHCCCCHHHHHHHHHHHCCCEEEEEECCCCCCHHHH
T ss_conf             --------7--78998899978985651686999999999860461799745877237658


No 252
>PRK06526 transposase; Provisional
Probab=97.13  E-value=0.0003  Score=51.04  Aligned_cols=135  Identities=24%  Similarity=0.388  Sum_probs=71.1

Q ss_pred             HHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH---CCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHH
Q ss_conf             99999999984244467359986056565027999999770---882499861888888883563200145671289999
Q gi|254780270|r  350 RIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKAT---GRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQS  426 (820)
Q Consensus       350 rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al---~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~  426 (820)
                      +.++-||-..+-..  +.=+.|+||||||||.||.+++.+.   |.+-..+.+..+-  .++.-.      ..-|+.-+.
T Consensus        84 ~~i~~La~~~fi~~--~~Nvil~G~~GtGKThLA~Alg~~A~~~G~~v~f~~~~~L~--~~L~~a------~~~g~~~~~  153 (254)
T PRK06526         84 DTIAHLGTLDFVTG--KENVVFLGPPGTGKTHLAIGLGIRACQAGHRVLFATAAQWV--ARLAAA------HHAGRLQDE  153 (254)
T ss_pred             HHHHHHHCCCHHHC--CCCEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEHHHHH--HHHHHH------HHCCCHHHH
T ss_conf             99999863717765--88789989999868999999999999869967998779999--999998------855809999


Q ss_pred             HHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCC-----------CCCC
Q ss_conf             98327887399993315542311771155665540600168133201035236442799993486-----------5544
Q gi|254780270|r  427 LKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANT-----------LNIP  495 (820)
Q Consensus       427 l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~-----------~~i~  495 (820)
                      +++..- -++.++||+--+.-+-  .-+..|++|++---.+.            |   .|.|.|-           -.+-
T Consensus       154 ~~~l~~-~dLLIiDe~g~~~~~~--~~a~~lf~li~~Rye~~------------S---~IiTSn~~~~~W~~~f~D~~la  215 (254)
T PRK06526        154 LVKLGR-IPLLIVDEVGYIPFEA--EAANLFFQLVSSRYERA------------S---LIVTSNKPFGRWGEVFGDDVVA  215 (254)
T ss_pred             HHHHHC-CCEEEEECCCCCCCCH--HHHHHHHHHHHHHHCCC------------C---EEEECCCCHHHHHHHCCCHHHH
T ss_conf             998513-6877650213644788--99999999999997458------------8---6766589866888864868999


Q ss_pred             HHHCCC----EEEEEECCCCH
Q ss_conf             131172----47998258786
Q gi|254780270|r  496 LPLMDR----MEIIRIAGYTE  512 (820)
Q Consensus       496 ~~l~dr----me~i~~~~y~~  512 (820)
                      .+++||    -++|++.|=+.
T Consensus       216 ~AilDRL~H~a~~i~~~G~Sy  236 (254)
T PRK06526        216 AAMIDRLVHHAEVISLKGDSY  236 (254)
T ss_pred             HHHHHHHCCCEEEEEECCCCC
T ss_conf             999998625628998438866


No 253
>PRK03839 putative kinase; Provisional
Probab=97.11  E-value=0.00037  Score=50.30  Aligned_cols=29  Identities=41%  Similarity=0.832  Sum_probs=25.9

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEE
Q ss_conf             59986056565027999999770882499
Q gi|254780270|r  368 ILCFVGPPGVGKTSLAQSIAKATGRQYVR  396 (820)
Q Consensus       368 il~l~gppgvGKts~~~sia~al~r~f~~  396 (820)
                      +|++.|.|||||||+|+-+|+.||-+++.
T Consensus         2 ~I~ITGTPGtGKTTva~~La~~lg~~~i~   30 (180)
T PRK03839          2 IIAITGTPGVGKTTISKLLAEKLGYEYVN   30 (180)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCEEEE
T ss_conf             89997899999899999999976987987


No 254
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional
Probab=97.10  E-value=0.0037  Score=42.76  Aligned_cols=81  Identities=30%  Similarity=0.388  Sum_probs=38.9

Q ss_pred             CCCCEEEEECCCCCCHHH-HHHHHHH-HH--CCCEEEEECCCCCCH--------HHHCCCCCCCCCCCCHHHHHHHHHCC
Q ss_conf             467359986056565027-9999997-70--882499861888888--------88356320014567128999998327
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTS-LAQSIAK-AT--GRQYVRMSLGGVYDE--------ADIRGHRRTYIGSMPGRIIQSLKRAK  431 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts-~~~sia~-al--~r~f~~islgg~~d~--------~~i~gh~~ty~ga~pg~ii~~l~~~~  431 (820)
                      .+..|++||||-|||||+ |||==|+ +|  |++-.-|..---|=.        |+|-|-- -|+-.-|-..-++|.+.+
T Consensus       221 ~~~kvi~lVGPTGVGKTTTiAKLAA~~~l~~~kkVaLIT~DTYRIgAvEQLktYa~Il~iP-v~vv~~~~el~~al~~~~  299 (432)
T PRK12724        221 NQRKVVFFVGPTGSGKTTSIAKLAAKYFLHMGKSVSLYTTDNYRIAAIEQLKRYADTMGMP-FYPVKDIKKFKETLARDG  299 (432)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCC-EEEEECHHHHHHHHHHCC
T ss_conf             7762999989999888999999999999974992799952665377999999999985994-599518999999998569


Q ss_pred             CCCEEEEEECHHHHHHHCC
Q ss_conf             8873999933155423117
Q gi|254780270|r  432 RSNPLLLLDEIDKMGSDLR  450 (820)
Q Consensus       432 ~~npv~~ldeidk~~~~~~  450 (820)
                      |  -|||+|--   |.+++
T Consensus       300 ~--DlILIDTA---GrS~r  313 (432)
T PRK12724        300 S--ELILIDTA---GYSHR  313 (432)
T ss_pred             C--CEEEEECC---CCCCC
T ss_conf             9--99999299---98978


No 255
>KOG0990 consensus
Probab=97.05  E-value=0.0045  Score=42.11  Aligned_cols=183  Identities=22%  Similarity=0.205  Sum_probs=97.8

Q ss_pred             HCCCCCCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEE
Q ss_conf             40415876632210688998776652011689999999999998424446735998605656502799999977088249
Q gi|254780270|r  316 LGVPWDKKSKTKKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYV  395 (820)
Q Consensus       316 ~~lPW~~~t~~~~dl~~a~~iLd~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~  395 (820)
                      ..+||-+-.....         +.|.++.+++=..+-+|      ....+=|-++|+||||+||||--...|+-|-.+.-
T Consensus        27 ~~~pwvekyrP~~---------l~dv~~~~ei~st~~~~------~~~~~lPh~L~YgPPGtGktsti~a~a~~ly~~~~   91 (360)
T KOG0990          27 YPQPWVEKYRPPF---------LGIVIKQEPIWSTENRY------SGMPGLPHLLFYGPPGTGKTSTILANARDFYSPHP   91 (360)
T ss_pred             CCCCCCCCCCCCH---------HHHHHCCCCHHHHHHHH------CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCC
T ss_conf             6888766889822---------56673377212478886------26888975343489988998736665665058998


Q ss_pred             EEECCCCCCHHHHCCCCCCCCCCCCHHHH--HHHHH--C---CCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCC
Q ss_conf             98618888888835632001456712899--99983--2---78873999933155423117711556655406001681
Q gi|254780270|r  396 RMSLGGVYDEADIRGHRRTYIGSMPGRII--QSLKR--A---KRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSS  468 (820)
Q Consensus       396 ~islgg~~d~~~i~gh~~ty~ga~pg~ii--~~l~~--~---~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~  468 (820)
                      .=|+-=-...|.=||     ++.--.+|.  +....  .   -..=-.++|||-|-|+.+.+    +||=-|.-     .
T Consensus        92 ~~~m~lelnaSd~rg-----id~vr~qi~~fast~~~~~fst~~~fKlvILDEADaMT~~AQ----nALRRvie-----k  157 (360)
T KOG0990          92 TTSMLLELNASDDRG-----IDPVRQQIHLFASTQQPTTYSTHAAFKLVILDEADAMTRDAQ----NALRRVIE-----K  157 (360)
T ss_pred             CHHHHHHHHCCCCCC-----CCCHHHHHHHHHHHCCCEECCCCCCEEEEEECCHHHHHHHHH----HHHHHHHH-----H
T ss_conf             246999864367668-----861478889877641640002467615887334137669899----99999998-----7


Q ss_pred             EEEEECCCCCCCCCEEEEEECCCCC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHH
Q ss_conf             3320103523644279999348655-441311724799825878689998999860898998625781313228999999
Q gi|254780270|r  469 FVDHYLEVEYDLSDVMFIMTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLD  547 (820)
Q Consensus       469 f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~  547 (820)
                      |+.          ++-|+.-+|+++ |.+|++.|---.....-+...-.++-..          -.+.+++..+.+....
T Consensus       158 ~t~----------n~rF~ii~n~~~ki~pa~qsRctrfrf~pl~~~~~~~r~sh----------i~e~e~~~~~~~~~~a  217 (360)
T KOG0990         158 YTA----------NTRFATISNPPQKIHPAQQSRCTRFRFAPLTMAQQTERQSH----------IRESEQKETNPEGYSA  217 (360)
T ss_pred             HCC----------CEEEEEECCCHHHCCCHHHCCCCCCCCCCCCHHHHHHHHHH----------HHHCCHHHCCHHHHHH
T ss_conf             133----------23799861676446814641044578788875442467888----------8715311038788999


No 256
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown]
Probab=97.04  E-value=0.0012  Score=46.54  Aligned_cols=104  Identities=27%  Similarity=0.469  Sum_probs=59.6

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCCC---EEEEECCCCCCHHHHCC----C------CCCCCCCCCHHHHHHHHH-CCCCC
Q ss_conf             9986056565027999999770882---49986188888888356----3------200145671289999983-27887
Q gi|254780270|r  369 LCFVGPPGVGKTSLAQSIAKATGRQ---YVRMSLGGVYDEADIRG----H------RRTYIGSMPGRIIQSLKR-AKRSN  434 (820)
Q Consensus       369 l~l~gppgvGKts~~~sia~al~r~---f~~islgg~~d~~~i~g----h------~~ty~ga~pg~ii~~l~~-~~~~n  434 (820)
                      ..+.||||||||++-+-||+-+---   |--.-.|=+...+||-|    |      ||+-|---+-+ -++|+. ..+|-
T Consensus       140 tLiigpP~~GKTTlLRdiaR~~s~g~~~~l~kkv~IiDersEIag~~~gvpq~~~g~R~dVld~cpk-~~gmmmaIrsm~  218 (308)
T COG3854         140 TLIIGPPQVGKTTLLRDIARLLSDGINQFLPKKVGIIDERSEIAGCLNGVPQHGRGRRMDVLDPCPK-AEGMMMAIRSMS  218 (308)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCHHHCCCCCCCHHHHHHHHHHCCCCHH-HHHHHHHHHHCC
T ss_conf             6996599887077999999986315112677328997150043034358860323221010465617-888999999549


Q ss_pred             E-EEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCC--C-C-CCHH
Q ss_conf             3-99993315542311771155665540600168133201035236442799993486--5-5-4413
Q gi|254780270|r  435 P-LLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANT--L-N-IPLP  497 (820)
Q Consensus       435 p-v~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~--~-~-i~~~  497 (820)
                      | ||+.|||.-.      +-+-|+++.+.-                  .|-.|.||.-  + + |..|
T Consensus       219 PEViIvDEIGt~------~d~~A~~ta~~~------------------GVkli~TaHG~~iedl~krp  262 (308)
T COG3854         219 PEVIIVDEIGTE------EDALAILTALHA------------------GVKLITTAHGNGIEDLIKRP  262 (308)
T ss_pred             CCEEEEECCCCH------HHHHHHHHHHHC------------------CCEEEEEECCCCHHHHHCCH
T ss_conf             957998343647------779999999854------------------85899950441177765081


No 257
>PRK06696 uridine kinase; Validated
Probab=97.03  E-value=0.0032  Score=43.22  Aligned_cols=49  Identities=27%  Similarity=0.392  Sum_probs=40.0

Q ss_pred             HCCCCCCCEEEEECCCCCCHHHHHHHHHHHH---CCCEEEEECCCCCCHHHHC
Q ss_conf             4244467359986056565027999999770---8824998618888888835
Q gi|254780270|r  360 RVIKNKGLILCFVGPPGVGKTSLAQSIAKAT---GRQYVRMSLGGVYDEADIR  409 (820)
Q Consensus       360 ~~~~~~g~il~l~gppgvGKts~~~sia~al---~r~f~~islgg~~d~~~i~  409 (820)
                      +++. +.-++.+-||||-|||++|..+|.+|   |++++++++.|-+.....|
T Consensus        21 ~~p~-rpl~VgIdG~~gSGKTTlA~~La~~L~~~G~~V~~v~~Ddf~~~~~~r   72 (227)
T PRK06696         21 LNLT-RPLRVAIDGITASGKTTFANELAEEIKKRGRPVIRASIDDFHNPKVIR   72 (227)
T ss_pred             CCCC-CCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHH
T ss_conf             5999-868999778998787999999999997469948997154434737777


No 258
>PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional
Probab=97.02  E-value=0.00063  Score=48.54  Aligned_cols=29  Identities=28%  Similarity=0.576  Sum_probs=26.3

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEE
Q ss_conf             99860565650279999997708824998
Q gi|254780270|r  369 LCFVGPPGVGKTSLAQSIAKATGRQYVRM  397 (820)
Q Consensus       369 l~l~gppgvGKts~~~sia~al~r~f~~i  397 (820)
                      +.|+|+||.|||++|+-+|+.||.+|+-.
T Consensus         3 I~LiG~mGaGKTtvGr~LA~~L~~~FvD~   31 (488)
T PRK13951          3 IFLVGMMGSGKSTIGKRISEVLDLQFIDM   31 (488)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEC
T ss_conf             99989999987799999999839795647


No 259
>PRK08181 transposase; Validated
Probab=97.01  E-value=0.00042  Score=49.86  Aligned_cols=126  Identities=25%  Similarity=0.386  Sum_probs=68.5

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHH---CCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEEC
Q ss_conf             67359986056565027999999770---882499861888888883563200145671289999983278873999933
Q gi|254780270|r  365 KGLILCFVGPPGVGKTSLAQSIAKAT---GRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDE  441 (820)
Q Consensus       365 ~g~il~l~gppgvGKts~~~sia~al---~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~lde  441 (820)
                      ++.=++|+||||||||.||-+++...   |.+-..++...+-  .++.-.+.      -|..-+.+++- ..-++++|||
T Consensus       105 ~~~Nvil~Gp~GtGKThLA~Alg~~A~~~G~~V~f~~~~~L~--~~L~~a~~------~~~~~~~~~~l-~~~dLLIiDe  175 (269)
T PRK08181        105 KGANLLLFGPPGGGKSHLAAAIGLALIENGWRVLFTRTTDLV--QKLQVARR------ELQLESAIAKL-DKFDLLILDD  175 (269)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHHHHH--HHHHHHHH------CCCHHHHHHHH-HCCCEEEEHH
T ss_conf             487089989999878899999999999879939997899999--99999775------58399999997-4446012201


Q ss_pred             HHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCC-----------CCCCHHHCCCE----EEEE
Q ss_conf             15542311771155665540600168133201035236442799993486-----------55441311724----7998
Q gi|254780270|r  442 IDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANT-----------LNIPLPLMDRM----EIIR  506 (820)
Q Consensus       442 idk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~-----------~~i~~~l~drm----e~i~  506 (820)
                      +.=+.-+  ..-+..|.++++---.+.            |   .|.|.|-           -.+-.+++||+    ++|+
T Consensus       176 ~G~~~~~--~~~~~~lf~lI~~Rye~~------------S---~IITSn~~~~~W~~~f~D~~la~AiLDRLvH~a~~i~  238 (269)
T PRK08181        176 LAYVTKD--QAETSVLFELISARYERR------------S---ILITANQPFGEWNRVFPDPAMTLAAVDRLVHHATIFE  238 (269)
T ss_pred             CCCCCCC--HHHHHHHHHHHHHHHCCC------------C---EEEECCCCHHHHHHHCCCHHHHHHHHHHHHCCEEEEE
T ss_conf             0566799--899999999999985788------------8---8998899977887753868899999998701528997


Q ss_pred             ECCCCHHHHH
Q ss_conf             2587868999
Q gi|254780270|r  507 IAGYTEEEKL  516 (820)
Q Consensus       507 ~~~y~~~ek~  516 (820)
                      +.|=+.--|-
T Consensus       239 l~GeSyR~k~  248 (269)
T PRK08181        239 MNVESYRRRT  248 (269)
T ss_pred             ECCCCCCCHH
T ss_conf             5587612056


No 260
>KOG1400 consensus
Probab=96.99  E-value=0.0029  Score=43.54  Aligned_cols=106  Identities=20%  Similarity=0.244  Sum_probs=66.4

Q ss_pred             CCEEEEEEEECCCEECCCEEEEEECCCHHHHHHHHHHHHC--CCEEEEEECCCCCCCCCCHHHEECCCEEEEEEEEEECC
Q ss_conf             7636756631782568871430642948999999999972--98499997368677788865602531489999979988
Q gi|254780270|r   24 DGIIYPLLPLRDIVVFPYMIVPLFVGREKSVRALDEAMNS--HKKIILVTQMNSNDENPIASSVYRIGTIVDIVQILRLP  101 (820)
Q Consensus        24 ~~~~LPIlPLrn~VLFPG~vlPL~V~eprsi~aIe~al~~--d~~I~vV~qkD~~~e~p~~edLy~VGTlakI~qi~klp  101 (820)
                      .....|++++-..|+|||+++|+.++.|+-+.+++.....  ++.|.+.+.-+-    +.  ....-+|.+.|-+ -+.|
T Consensus        62 t~~~~p~~~~~~~v~~PgqtLPl~~i~~~~~s~~r~lvs~ar~~~F~vl~r~~v----~~--re~~r~tt~evd~-~R~p  134 (371)
T KOG1400          62 TTNWIPICGQVMAVLFPGQTLPLKFIDPQERSIVRRLVSSARDNGFVVLFRSDV----PE--RESLRYTTTEVDA-YRVP  134 (371)
T ss_pred             CEEEECCCCCEEEEECCCCCCCCHHCCHHHHHHHHHHHHHHCCCCEEEEECCCC----HH--HHHCCCCCEECCC-CCCC
T ss_conf             602631467204686476668600059889999999987611796589850424----67--7634660000035-6560


Q ss_pred             -C--CE--EEEEEEEEEEEEEEEE-EECCCEEEEEEEEECC
Q ss_conf             -9--80--9999997547999988-7079819999998048
Q gi|254780270|r  102 -D--GT--VKILVEGSVRARIVEY-IEREDFLEAITQVLPD  136 (820)
Q Consensus       102 -D--G~--~~ILVeGl~RvkI~ei-~~~~pyl~A~Ve~l~d  136 (820)
                       |  |.  ..+...|..|+++.++ .+..+--.|.++.+|+
T Consensus       135 ~d~Fgn~l~~~~~~G~y~~~vl~lR~qs~g~~e~~~qL~P~  175 (371)
T KOG1400         135 QDNFGNALSMVKAMGRYRCKVLKLRTQSLGRGEAEVQLLPD  175 (371)
T ss_pred             HHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCEEEECCC
T ss_conf             34441020222642641023244113587766634774465


No 261
>PRK06921 hypothetical protein; Provisional
Probab=96.97  E-value=0.0016  Score=45.59  Aligned_cols=89  Identities=18%  Similarity=0.268  Sum_probs=49.4

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHC-C---CEEEEECCCCCCHHHHCCCCCCCCCCCC
Q ss_conf             68999999999999842444673599860565650279999997708-8---2499861888888883563200145671
Q gi|254780270|r  345 EKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATG-R---QYVRMSLGGVYDEADIRGHRRTYIGSMP  420 (820)
Q Consensus       345 ~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~-r---~f~~islgg~~d~~~i~gh~~ty~ga~p  420 (820)
                      .++++-.++|..--.-..+....-|.|.|+||+|||-|+-+||+.|= +   +...++....  -.+|+   .+|-.  .
T Consensus        95 k~a~~~a~eY~~~F~~i~~~~~~~l~f~G~~G~GKThLa~aIa~~Ll~~~~~~Vly~~~~~~--~~~lk---~~~~~--~  167 (265)
T PRK06921         95 KDAYECAVEYVKDFEKIQGCRKNSIALLGQPGSGKTHLLTAAANELMRKKGVPVLYFPFVEG--FGDLK---DDFDL--L  167 (265)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEEEEHHHH--HHHHH---HHHHH--H
T ss_conf             99999999999977876077766279972898988999999999999962971999887999--99999---88888--9


Q ss_pred             HHHHHHHHHCCCCCEEEEEECHHH
Q ss_conf             289999983278873999933155
Q gi|254780270|r  421 GRIIQSLKRAKRSNPLLLLDEIDK  444 (820)
Q Consensus       421 g~ii~~l~~~~~~npv~~ldeidk  444 (820)
                      -..+..+++    -+|.++|.+=|
T Consensus       168 ~~~l~~~~~----~dlLIIDDLfk  187 (265)
T PRK06921        168 EAKLNRMKK----VEVLFIDDLFK  187 (265)
T ss_pred             HHHHHHHHC----CCEEEEECCCC
T ss_conf             999998632----99999822122


No 262
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor.
Probab=96.96  E-value=0.00098  Score=47.12  Aligned_cols=36  Identities=39%  Similarity=0.747  Sum_probs=30.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCH
Q ss_conf             59986056565027999999770882499861888888
Q gi|254780270|r  368 ILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDE  405 (820)
Q Consensus       368 il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~  405 (820)
                      |++.-||||.||||+||.||+.||-+|  ++-|+++.+
T Consensus         1 iIaIdGpagsGKsT~ak~lA~~l~~~~--ldtG~ir~~   36 (147)
T cd02020           1 IIAIDGPAGSGKSTVAKLLAKKLGLPY--LDTGGIRTE   36 (147)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHCCEE--ECCCCCCCH
T ss_conf             988868997898999999999909907--766542548


No 263
>cd01882 BMS1 Bms1.  Bms1 is an essential, evolutionarily conserved, nucleolar protein.  Its depletion interferes with processing of the 35S pre-rRNA at sites A0, A1, and A2, and the formation of 40S subunits.  Bms1, the putative endonuclease Rc11, and the essential U3 small nucleolar RNA form a stable subcomplex that is believed to control an early step in the formation of the 40S subumit.  The C-terminal domain of Bms1 contains a GTPase-activating protein (GAP) that functions intramolecularly.  It is believed that Rc11 activates Bms1 by acting as a guanine-nucleotide exchange factor (GEF) to promote GDP/GTP exchange, and that activated (GTP-bound) Bms1 delivers Rc11 to the preribosomes.
Probab=96.95  E-value=0.0013  Score=46.22  Aligned_cols=107  Identities=30%  Similarity=0.473  Sum_probs=60.7

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHH-H--CCCCCCCCCCCCHHHHHHHHHCCCCCEEEEE
Q ss_conf             446735998605656502799999977088249986188888888-3--5632001456712899999832788739999
Q gi|254780270|r  363 KNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEAD-I--RGHRRTYIGSMPGRIIQSLKRAKRSNPLLLL  439 (820)
Q Consensus       363 ~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~-i--~gh~~ty~ga~pg~ii~~l~~~~~~npv~~l  439 (820)
                      +...-+...+||||||||+|-+|+-+    .|.+-++.-++-.-. +  +-.|-|++-. |--|-..+--|++.+-|+|+
T Consensus        36 epPP~vVavvGPpgvGKtTLiksLvk----~ytk~~l~~i~GPiTvvs~K~rRiTfiEc-~nDi~smiD~AKvADlVLl~  110 (225)
T cd01882          36 EPPPLVVAVVGPPGVGKTTLIKSLVK----NYTKQNISDIKGPITVVTGKKRRLTFIEC-PNDINAMIDIAKVADLVLLL  110 (225)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHH----HHHHCCCCCCCCCEEEEECCCEEEEEEEC-CCHHHHHHHHHHHHHEEEEE
T ss_conf             99996999989899778899999999----98544375578887999468426899974-86099998788764336888


Q ss_pred             ECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCC
Q ss_conf             33155423117711556655406001681332010352364427999934865
Q gi|254780270|r  440 DEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTL  492 (820)
Q Consensus       440 deidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~  492 (820)
                      =.     .+|--+-  --.|.|.=-|.+.|           -+|+-|.|-.|.
T Consensus       111 iD-----~s~GfEm--EtfEfLnilq~hG~-----------PkV~GVltHlD~  145 (225)
T cd01882         111 ID-----ASFGFEM--ETFEFLNILQVHGF-----------PRVMGVLTHLDL  145 (225)
T ss_pred             EC-----CCCCEEE--EHHHHHHHHHHCCC-----------CCEEEEEECCCC
T ss_conf             61-----6655352--08999999997599-----------943788544310


No 264
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism]
Probab=96.90  E-value=0.00066  Score=48.39  Aligned_cols=28  Identities=29%  Similarity=0.701  Sum_probs=24.9

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHCCCEE
Q ss_conf             35998605656502799999977088249
Q gi|254780270|r  367 LILCFVGPPGVGKTSLAQSIAKATGRQYV  395 (820)
Q Consensus       367 ~il~l~gppgvGKts~~~sia~al~r~f~  395 (820)
                      +.+|+.|+|||||||+++-++ .||-+++
T Consensus         1 m~I~ITGTPGvGKTT~~~~L~-~lg~~~i   28 (180)
T COG1936           1 MLIAITGTPGVGKTTVCKLLR-ELGYKVI   28 (180)
T ss_pred             CEEEEECCCCCCHHHHHHHHH-HHCCCEE
T ss_conf             937993799986687999999-8298466


No 265
>KOG0482 consensus
Probab=96.87  E-value=0.0027  Score=43.78  Aligned_cols=155  Identities=26%  Similarity=0.416  Sum_probs=80.1

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHHCCC------CCCCE-EEEECCCCCCHHHHHHHHHHHHCCCEEEEECCC--CCCH-HHH
Q ss_conf             6520116899999999999984244------46735-998605656502799999977088249986188--8888-883
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQMRVIK------NKGLI-LCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGG--VYDE-ADI  408 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~~~~~~------~~g~i-l~l~gppgvGKts~~~sia~al~r~f~~islgg--~~d~-~~i  408 (820)
                      -+.||+++||+-.|-.| |+-.-+.      .+|.| +||.|-|||-|..|-+-|.+.--|--+.-.-|.  |.=- |-.
T Consensus       342 PEIyGheDVKKaLLLlL-VGgvd~~~~dGMKIRGdINicLmGDPGVAKSQLLkyi~rlapRgvYTTGrGSSGVGLTAAVm  420 (721)
T KOG0482         342 PEIYGHEDVKKALLLLL-VGGVDKSPGDGMKIRGDINICLMGDPGVAKSQLLKYISRLAPRGVYTTGRGSSGVGLTAAVM  420 (721)
T ss_pred             HHHCCCHHHHHHHHHHH-HCCCCCCCCCCCEEECCEEEEECCCCCHHHHHHHHHHHHCCCCCCEECCCCCCCCCCCHHHH
T ss_conf             06306167999999995-17888888887666253469963897133899999998507665030388877655111211


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCC-CCEEEEE
Q ss_conf             563200145671289999983278873999933155423117711556655406001681332010352364-4279999
Q gi|254780270|r  409 RGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDL-SDVMFIM  487 (820)
Q Consensus       409 ~gh~~ty~ga~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dl-s~v~fi~  487 (820)
                      |-   .--|-|   +..+=.-+=.-+.+--+||.|||..+-|-    |.-||..- |--+..-  -+|---| -++-.++
T Consensus       421 kD---pvTgEM---~LEGGALVLAD~GICCIDEfDKM~e~DRt----AIHEVMEQ-QTISIaK--AGI~TtLNAR~sILa  487 (721)
T KOG0482         421 KD---PVTGEM---VLEGGALVLADGGICCIDEFDKMDESDRT----AIHEVMEQ-QTISIAK--AGINTTLNARTSILA  487 (721)
T ss_pred             CC---CCCCEE---EECCCEEEECCCCEEEEHHHHHHHHHHHH----HHHHHHHH-HHHHHHH--HCCCCCHHHHHHHHH
T ss_conf             37---777706---86066389716965761233323033357----99999876-5445634--201000505677665


Q ss_pred             ECCC--------------CCCCHHHCCCEEEEEE
Q ss_conf             3486--------------5544131172479982
Q gi|254780270|r  488 TANT--------------LNIPLPLMDRMEIIRI  507 (820)
Q Consensus       488 tan~--------------~~i~~~l~drme~i~~  507 (820)
                      .||.              ++.|++|+.|+.++-+
T Consensus       488 AANPayGRYnprrs~e~NI~LPaALLSRFDll~L  521 (721)
T KOG0482         488 AANPAYGRYNPRRSPEQNINLPAALLSRFDLLWL  521 (721)
T ss_pred             HCCCCCCCCCCCCCHHHHCCCCHHHHHHHHHHHH
T ss_conf             4474334668666966736984889875454642


No 266
>pfam05729 NACHT NACHT domain. This NTPase domain is found in apoptosis proteins as well as those involved in MHC transcription activation. This family is closely related to pfam00931.
Probab=96.85  E-value=0.0068  Score=40.76  Aligned_cols=141  Identities=20%  Similarity=0.326  Sum_probs=68.4

Q ss_pred             EEEEECCCCCCHHHHHHHHHHH--HCC-----CE-EEEECCCCCC-----HHH-HCCCCCCCCCCCCHHHHHHHHHCCCC
Q ss_conf             5998605656502799999977--088-----24-9986188888-----888-35632001456712899999832788
Q gi|254780270|r  368 ILCFVGPPGVGKTSLAQSIAKA--TGR-----QY-VRMSLGGVYD-----EAD-IRGHRRTYIGSMPGRIIQSLKRAKRS  433 (820)
Q Consensus       368 il~l~gppgvGKts~~~sia~a--l~r-----~f-~~islgg~~d-----~~~-i~gh~~ty~ga~pg~ii~~l~~~~~~  433 (820)
                      .+.+.|+||+|||++++-+|-.  -|.     +| ..+++--+..     -.+ |.-+-. ..++.+-..... ....-.
T Consensus         2 ~i~i~G~aG~GKTtll~kl~~~wa~g~~~~~~~~vf~~~~r~~~~~~~~sl~~ll~~~~~-~~~~~~~~~~~~-~~~~~~   79 (165)
T pfam05729         2 TVILQGEAGSGKTTLLQKLALLWAQGKLPQDFDFVFFLPCRELSRSGEASLADLLFSQWP-EPAAPVSEVWAV-ILELPE   79 (165)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCEEEEEEHHHHCCCCCCCHHHHHHHHCC-CCCCCHHHHHHH-HHHCCC
T ss_conf             899982798989999999999998698436972899999567077766899999998767-745763789999-983977


Q ss_pred             CEEEEEECHHHHHHHCCC--C--HHHHHH-HHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCC-CCCHHHCCCEEEEEE
Q ss_conf             739999331554231177--1--155665-5406001681332010352364427999934865-544131172479982
Q gi|254780270|r  434 NPLLLLDEIDKMGSDLRG--D--PSAALL-EVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTL-NIPLPLMDRMEIIRI  507 (820)
Q Consensus       434 npv~~ldeidk~~~~~~g--d--p~~all-evldp~qn~~f~d~y~~~~~dls~v~fi~tan~~-~i~~~l~drme~i~~  507 (820)
                      .-+|+||-+|.+..+..-  +  |...+| .++        +.++    +.-+.|+.-+..... +++.- +..-..+++
T Consensus        80 k~L~ilDGlDE~~~~~~~~~~~~~~~~~l~~ll--------~~~~----lp~~~vliTsRp~~~~~l~~~-~~~~~~~ei  146 (165)
T pfam05729        80 RVLLILDGLDELASDLGQLDGPLPVLTLLSSLL--------RKKL----LPGASLLLTSRPDALRDLRRG-LEEPRYLEV  146 (165)
T ss_pred             CEEEEECCHHHHCCCCCCCCCCCCHHHHHHHHH--------HHCC----CCCCEEEEEECCCHHHHHHHH-CCCCCEEEE
T ss_conf             289996484551444356444577999999998--------4152----788649999680379885776-488718998


Q ss_pred             CCCCHHHHHHHHHHHH
Q ss_conf             5878689998999860
Q gi|254780270|r  508 AGYTEEEKLQIAKNHL  523 (820)
Q Consensus       508 ~~y~~~ek~~i~~~~l  523 (820)
                      .|++.+...+-+++|.
T Consensus       147 ~GFs~~~~~~yi~~~F  162 (165)
T pfam05729       147 LGFSEEDRKQYVRKYF  162 (165)
T ss_pred             CCCCHHHHHHHHHHHC
T ss_conf             8999999999999867


No 267
>PRK10416 cell division protein FtsY; Provisional
Probab=96.84  E-value=0.022  Score=36.82  Aligned_cols=164  Identities=21%  Similarity=0.292  Sum_probs=89.9

Q ss_pred             HHHHHHHHHHCCCCCCHHHHHHHHHHHHHH-HHHHHCCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHCH
Q ss_conf             467899985222478857888889999999-8753110257899999876540415876632210688998776652011
Q gi|254780270|r  266 DEISDFEARISKIRLSKEAREKALSELQKL-RQMNPLSAESSVVRNYLDWLLGVPWDKKSKTKKNLDFAIRILDQDHFGL  344 (820)
Q Consensus       266 ~Ei~el~~Ki~~~~lp~e~~~~~~kEl~rL-~~m~~~s~E~~v~r~Yld~~~~lPW~~~t~~~~dl~~a~~iLd~~hyGl  344 (820)
                      +-+++|++.+-.+.+.-++-.++...|+.- ++-.-.+++                           ..+.         
T Consensus       228 ~~~eeLEe~Li~aDvGv~tt~~ii~~l~~~~~~~~~~~~~---------------------------~l~~---------  271 (499)
T PRK10416        228 DLFEELEEQLLIADVGVETTRKIITNLTEGASRKQLRDAE---------------------------ALYG---------  271 (499)
T ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCHH---------------------------HHHH---------
T ss_conf             9999999999972059999999999999999864799999---------------------------9999---------


Q ss_pred             HHHHHHHHHHHHH--HHHCCCC-CCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCH
Q ss_conf             6899999999999--9842444-673599860565650279999997708824998618888888835632001456712
Q gi|254780270|r  345 EKVKERIIEYLAV--QMRVIKN-KGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPG  421 (820)
Q Consensus       345 ~~vK~rile~lav--~~~~~~~-~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg  421 (820)
                       ..|+.|.+.|.-  ..++-+. +..|+++||--|+|||+-.--+|+-+...-.++-|+.. |         ||-.|   
T Consensus       272 -~l~~~~~~il~~~~~~l~~~~~~P~VIl~vGvNG~GKTTTigKLA~~~~~~gkkVllaA~-D---------TfRaA---  337 (499)
T PRK10416        272 -LLKEEMGEILAKVDEPLNVEGKTPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAG-D---------TFRAA---  337 (499)
T ss_pred             -HHHHHHHHHHHCCCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEE-C---------CCCHH---
T ss_conf             -999999998731044665689998799997478787898999999999977995378840-6---------67568---


Q ss_pred             HHHHHHHHCCCC--CEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCCCCHHHC
Q ss_conf             899999832788--739999331554231177115566554060016813320103523644279999348655441311
Q gi|254780270|r  422 RIIQSLKRAKRS--NPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLNIPLPLM  499 (820)
Q Consensus       422 ~ii~~l~~~~~~--npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~i~~~l~  499 (820)
                      -| .-|..-+..  -||+        +.....||++....-+.-..+..|            +|+.|=||--++...-|+
T Consensus       338 Ai-eQL~~w~~r~~v~vi--------~~~~g~Dpa~V~~dai~~a~~~~~------------DvviiDTAGRl~~~~~LM  396 (499)
T PRK10416        338 AV-EQLQVWGQRNNIPVI--------AQHTGADSASVIFDAIQAAKARNV------------DVLIADTAGRLQNKSHLM  396 (499)
T ss_pred             HH-HHHHHHHCCCCCEEE--------ECCCCCCHHHHHHHHHHHHHHCCC------------CEEEEECCCCCCCCHHHH
T ss_conf             99-999998424573698--------368999979999999999997299------------989985776432609999


Q ss_pred             C
Q ss_conf             7
Q gi|254780270|r  500 D  500 (820)
Q Consensus       500 d  500 (820)
                      +
T Consensus       397 ~  397 (499)
T PRK10416        397 E  397 (499)
T ss_pred             H
T ss_conf             9


No 268
>KOG4658 consensus
Probab=96.83  E-value=0.014  Score=38.27  Aligned_cols=48  Identities=33%  Similarity=0.479  Sum_probs=35.9

Q ss_pred             HCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHH---HCCCEE
Q ss_conf             011689999999999998424446735998605656502799999977---088249
Q gi|254780270|r  342 FGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKA---TGRQYV  395 (820)
Q Consensus       342 yGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~a---l~r~f~  395 (820)
                      -|++..++.+.++|     ..+. ..|+.++|-.|||||+|++.|-+-   .++.|-
T Consensus       161 VG~e~~~ekl~~~L-----~~d~-~~ivgi~GMGGvGKTTL~~qi~N~~~~v~~~Fd  211 (889)
T KOG4658         161 VGLETMLEKLWNRL-----MEDD-VGIVGIYGMGGVGKTTLARQIFNKFDEVGNHFD  211 (889)
T ss_pred             CCHHHHHHHHHHHH-----CCCC-CCEEEEECCCCCCHHHHHHHHHHCCHHHCCCCC
T ss_conf             46889999999984-----0479-968999889703499999998413312235787


No 269
>KOG3347 consensus
Probab=96.81  E-value=0.0011  Score=46.60  Aligned_cols=36  Identities=33%  Similarity=0.650  Sum_probs=30.6

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             446735998605656502799999977088249986
Q gi|254780270|r  363 KNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMS  398 (820)
Q Consensus       363 ~~~g~il~l~gppgvGKts~~~sia~al~r~f~~is  398 (820)
                      ....|=|...|-||||||++|.-||+.+|.+|.-||
T Consensus         4 ~r~~PNILvtGTPG~GKstl~~~lae~~~~~~i~is   39 (176)
T KOG3347           4 ERERPNILVTGTPGTGKSTLAERLAEKTGLEYIEIS   39 (176)
T ss_pred             HHCCCCEEEECCCCCCCHHHHHHHHHHHCCCEEEHH
T ss_conf             113788798679998802599999997398567455


No 270
>KOG1051 consensus
Probab=96.78  E-value=0.013  Score=38.70  Aligned_cols=143  Identities=20%  Similarity=0.262  Sum_probs=81.2

Q ss_pred             CCCCC-HHHHHHHHHHHHHHHHHHHCCHH--HHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHH
Q ss_conf             24788-57888889999999875311025--7899999876540415876632210688998776652011689999999
Q gi|254780270|r  277 KIRLS-KEAREKALSELQKLRQMNPLSAE--SSVVRNYLDWLLGVPWDKKSKTKKNLDFAIRILDQDHFGLEKVKERIIE  353 (820)
Q Consensus       277 ~~~lp-~e~~~~~~kEl~rL~~m~~~s~E--~~v~r~Yld~~~~lPW~~~t~~~~dl~~a~~iLd~~hyGl~~vK~rile  353 (820)
                      ++++. ..++..+++.. ...++++.+|.  +..+.+|.-.+....-.             -.||--+-+.++-=.|+++
T Consensus       136 Eag~~s~~vK~~ve~~~-g~~~~~~~~~~~~~~~L~~~~~dl~p~~~~-------------gk~dPvigr~deeirRvi~  201 (898)
T KOG1051         136 EAGFSSSAVKSAVEQPV-GQFRSPSRGPLWPLLFLENYGTDLTPRARQ-------------GKLDPVIGRHDEEIRRVIE  201 (898)
T ss_pred             HHCCCHHHHHHHHHHCC-CCCCCCCCCCCCCHHHHHHCCCCCCHHHHC-------------CCCCCCCCCCHHHHHHHHH
T ss_conf             95589589999886302-445777767764346787506456724433-------------6878865885288999999


Q ss_pred             HHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHH----------HCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHH
Q ss_conf             999998424446735998605656502799999977----------0882499861888888883563200145671289
Q gi|254780270|r  354 YLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKA----------TGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRI  423 (820)
Q Consensus       354 ~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~a----------l~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~i  423 (820)
                      .|+-++-    +-|  ||||.||||||.++..+|.-          .++++..+++|.+-+.+       .|-|-.-+|+
T Consensus       202 iL~Rr~k----~NP--vLVG~~gvgktaiv~gla~ri~~G~vp~~l~~~~l~~l~~g~l~aGa-------~~rge~E~rl  268 (898)
T KOG1051         202 ILSRKTK----NNP--VLVGEPGVGKTAIVEGLAQRIATGDVPETLKDKKLIALDFGSLVAGA-------KRRGEFEERL  268 (898)
T ss_pred             HHHCCCC----CCC--EEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCEEEEEHHHCCCCC-------CCCHHHHHHH
T ss_conf             9814678----996--69836877721689999987661788853345524898700003586-------4212788999


Q ss_pred             HHHHHHCC--CCCEEEEEECHHHHH
Q ss_conf             99998327--887399993315542
Q gi|254780270|r  424 IQSLKRAK--RSNPLLLLDEIDKMG  446 (820)
Q Consensus       424 i~~l~~~~--~~npv~~ldeidk~~  446 (820)
                      =.-++.++  -..=|.++||+.=+.
T Consensus       269 k~l~k~v~~~~~gvILfigelh~lv  293 (898)
T KOG1051         269 KELLKEVESGGGGVILFLGELHWLV  293 (898)
T ss_pred             HHHHHHHHCCCCCEEEEECCEEEEE
T ss_conf             9999998547986899832143220


No 271
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP). This enzyme is required for the biosynthesis of ADP and is essential for homeostasis of adenosine phosphates.
Probab=96.78  E-value=0.0017  Score=45.35  Aligned_cols=56  Identities=27%  Similarity=0.459  Sum_probs=38.1

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCC
Q ss_conf             99860565650279999997708824998618888888835632001456712899999832788
Q gi|254780270|r  369 LCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRS  433 (820)
Q Consensus       369 l~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~  433 (820)
                      +.|.||||.||++.|+-||+.+|  |+.||.|-+=.+.-=.       ++--|+.++.....|-.
T Consensus         2 i~l~G~PGsGKgTqa~~La~~~~--~~~is~gdlLR~~~~~-------~t~~g~~i~~~~~~G~l   57 (194)
T cd01428           2 ILLLGPPGSGKGTQAERLAKKYG--LPHISTGDLLREEIAS-------GTELGKKAKEYIDSGKL   57 (194)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHC--CEEECHHHHHHHHHHC-------CCHHHHHHHHHHHCCCC
T ss_conf             89989999987999999999979--8467688999999974-------99589999999987997


No 272
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]
Probab=96.72  E-value=0.059  Score=33.62  Aligned_cols=157  Identities=25%  Similarity=0.402  Sum_probs=104.3

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCC-------CHHHHHHHHHCCCCCEEEEEEC
Q ss_conf             998605656502799999977088249986188888888356320014567-------1289999983278873999933
Q gi|254780270|r  369 LCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSM-------PGRIIQSLKRAKRSNPLLLLDE  441 (820)
Q Consensus       369 l~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~-------pg~ii~~l~~~~~~npv~~lde  441 (820)
                      +++.||...||||.-+-+|+-+|++|+||.=---.|-+|--|   |||---       -|..|.||++.    --|.|||
T Consensus       891 ~LiQGpTSSGKTSMI~yla~~tghkfVRINNHEHTdlqeYiG---TyvTdd~G~lsFkEGvLVeAlR~G----yWIVLDE  963 (4600)
T COG5271         891 LLIQGPTSSGKTSMILYLARETGHKFVRINNHEHTDLQEYIG---TYVTDDDGSLSFKEGVLVEALRRG----YWIVLDE  963 (4600)
T ss_pred             EEEECCCCCCCCHHHHHHHHHHCCCEEEECCCCCCHHHHHHH---CEEECCCCCEEEEHHHHHHHHHCC----CEEEEEC
T ss_conf             798668887700499999987376079865855434998743---035068985654010789988568----6799610


Q ss_pred             HHHHHHHCCCCHHHHHHHHCCCCCCCC-EEEEECCCCCCCCCEEEEEECCCC-------CCCHHHCCCEEEEEECCCCHH
Q ss_conf             155423117711556655406001681-332010352364427999934865-------544131172479982587868
Q gi|254780270|r  442 IDKMGSDLRGDPSAALLEVLDPAQNSS-FVDHYLEVEYDLSDVMFIMTANTL-------NIPLPLMDRMEIIRIAGYTEE  513 (820)
Q Consensus       442 idk~~~~~~gdp~~allevldp~qn~~-f~d~y~~~~~dls~v~fi~tan~~-------~i~~~l~drme~i~~~~y~~~  513 (820)
                      +.-.-.    |.--||=-+||-  |.. |.-.--++-..--+.+..||-|..       ..+++.|.|.--++...--.+
T Consensus       964 LNLApT----DVLEaLNRLLDD--NRelfIPETqevV~PHp~F~lFATQNppg~YgGRK~LSrAFRNRFlE~hFddiped 1037 (4600)
T COG5271         964 LNLAPT----DVLEALNRLLDD--NRELFIPETQEVVVPHPNFRLFATQNPPGGYGGRKGLSRAFRNRFLEMHFDDIPED 1037 (4600)
T ss_pred             CCCCCH----HHHHHHHHHHCC--CCCEECCCCCEEECCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHH
T ss_conf             246707----799999986446--64020677552433588736886138986534127777999865676421358578


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCC
Q ss_conf             9998999860898998625781313228999999973177
Q gi|254780270|r  514 EKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFT  553 (820)
Q Consensus       514 ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt  553 (820)
                      |-..|-+.               -+.|...--.+|++-|.
T Consensus      1038 Ele~ILh~---------------rc~iapSyakKiVeVyr 1062 (4600)
T COG5271        1038 ELEEILHG---------------RCEIAPSYAKKIVEVYR 1062 (4600)
T ss_pred             HHHHHHHC---------------CCCCCHHHHHHHHHHHH
T ss_conf             99999963---------------67668799999999998


No 273
>PRK02496 adk adenylate kinase; Provisional
Probab=96.66  E-value=0.0025  Score=44.05  Aligned_cols=58  Identities=28%  Similarity=0.389  Sum_probs=42.6

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCE
Q ss_conf             9986056565027999999770882499861888888883563200145671289999983278873
Q gi|254780270|r  369 LCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNP  435 (820)
Q Consensus       369 l~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~np  435 (820)
                      |.|.||||.||++.|+.||+.+|  |+.||.|-+=- ++++.      ++--|+.++.+...|-.-|
T Consensus         4 iillG~PGSGKgTqa~~L~~~~~--~~his~GdllR-~~~~~------~s~lg~~i~~~i~~G~lvp   61 (185)
T PRK02496          4 LIFLGPPGAGKGTQAVVLAEHLQ--IPHISTGDILR-QAITE------QTPLGIKAQGYVDSGELVP   61 (185)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHC--CEEECHHHHHH-HHHHC------CCHHHHHHHHHHHCCCCCC
T ss_conf             99979999998999999999969--97788889999-99874------9988999999998799677


No 274
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion]
Probab=96.64  E-value=0.05  Score=34.21  Aligned_cols=160  Identities=26%  Similarity=0.346  Sum_probs=87.2

Q ss_pred             CHHHHHHHHHHCCCCCCHHHHHHHHHHHHHH-HHHHHCCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             0467899985222478857888889999999-875311025789999987654041587663221068899877665201
Q gi|254780270|r  265 RDEISDFEARISKIRLSKEAREKALSELQKL-RQMNPLSAESSVVRNYLDWLLGVPWDKKSKTKKNLDFAIRILDQDHFG  343 (820)
Q Consensus       265 ~~Ei~el~~Ki~~~~lp~e~~~~~~kEl~rL-~~m~~~s~E~~v~r~Yld~~~~lPW~~~t~~~~dl~~a~~iLd~~hyG  343 (820)
                      ++-.++|++.+-.+++.-++-+.+..+|++= .+-...                          .|-...+         
T Consensus        66 e~~~eeLE~~Li~aDvg~e~~~~i~~~l~~~~~~~~~~--------------------------~~~~~v~---------  110 (340)
T COG0552          66 EDLLEELEELLIEADVGVETAEEIIEELRKREGKKKKI--------------------------KDEETVK---------  110 (340)
T ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCC--------------------------CCHHHHH---------
T ss_conf             88999999999970246999999999999875102368--------------------------9889999---------


Q ss_pred             HHHHHHHHHHHHHH-------HHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCC
Q ss_conf             16899999999999-------98424446735998605656502799999977088249986188888888356320014
Q gi|254780270|r  344 LEKVKERIIEYLAV-------QMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYI  416 (820)
Q Consensus       344 l~~vK~rile~lav-------~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~  416 (820)
                       +-.++.+.+++..       .....+.+..+++|||--|||||+-.--+|.-|...=.++-|+-. |         |+-
T Consensus       111 -~~l~~~l~~il~~~~~~~~~~~~~~~~~p~Vil~vGVNG~GKTTTIaKLA~~l~~~g~~VllaA~-D---------TFR  179 (340)
T COG0552         111 -EALREALIEILRPVDKVDLPLEIPKEKKPFVILFVGVNGVGKTTTIAKLAKYLKQQGKSVLLAAG-D---------TFR  179 (340)
T ss_pred             -HHHHHHHHHHHCCCCCCCCHHHHCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEEEC-C---------HHH
T ss_conf             -99999999984655444436552358986799999348886371799999999978986999823-3---------478


Q ss_pred             CCCCHHHHHHHHHC-CCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCC
Q ss_conf             56712899999832-788739999331554231177115566554060016813320103523644279999348655
Q gi|254780270|r  417 GSMPGRIIQSLKRA-KRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN  493 (820)
Q Consensus       417 ga~pg~ii~~l~~~-~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~  493 (820)
                      .|   -|=|-=..+ ....|||        +....+||||....-..-.+..+|            +|++|=||--++
T Consensus       180 Aa---AiEQL~~w~er~gv~vI--------~~~~G~DpAaVafDAi~~Akar~~------------DvvliDTAGRLh  234 (340)
T COG0552         180 AA---AIEQLEVWGERLGVPVI--------SGKEGADPAAVAFDAIQAAKARGI------------DVVLIDTAGRLH  234 (340)
T ss_pred             HH---HHHHHHHHHHHHCCEEE--------CCCCCCCCHHHHHHHHHHHHHCCC------------CEEEEECCCCCC
T ss_conf             99---99999999999599278--------259999808999999999997699------------999996755445


No 275
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription]
Probab=96.63  E-value=0.0055  Score=41.44  Aligned_cols=164  Identities=23%  Similarity=0.389  Sum_probs=93.9

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHH--HCCCEEEEECCCCCC---HHHHCCCCCCCCCCCCHHHHHHHHHC--CCCCEEE
Q ss_conf             6735998605656502799999977--088249986188888---88835632001456712899999832--7887399
Q gi|254780270|r  365 KGLILCFVGPPGVGKTSLAQSIAKA--TGRQYVRMSLGGVYD---EADIRGHRRTYIGSMPGRIIQSLKRA--KRSNPLL  437 (820)
Q Consensus       365 ~g~il~l~gppgvGKts~~~sia~a--l~r~f~~islgg~~d---~~~i~gh~~ty~ga~pg~ii~~l~~~--~~~npv~  437 (820)
                      ..| +|+.|-|||||--+++.|.++  ..-||+-+.++-+.+   |+|+-|-..   ||--|--.++++-.  .---.-.
T Consensus       336 ~~p-vll~GEtGtGKe~laraiH~~s~~~gpfvAvNCaAip~~liesELFGy~~---GafTga~~kG~~g~~~~A~gGtl  411 (606)
T COG3284         336 DLP-VLLQGETGTGKEVLARAIHQNSEAAGPFVAVNCAAIPEALIESELFGYVA---GAFTGARRKGYKGKLEQADGGTL  411 (606)
T ss_pred             CCC-EEECCCCCHHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHCCCC---CCCCCCHHCCCCCCCEECCCCCC
T ss_conf             787-68538765568999999985365569837998503447764677744576---56433001066554101578760


Q ss_pred             EEECHHHHHHHCCCCHHHHHHHHCC--------CC-C-------------------CCCEE-EEECCCCCCCCCEEEEEE
Q ss_conf             9933155423117711556655406--------00-1-------------------68133-201035236442799993
Q gi|254780270|r  438 LLDEIDKMGSDLRGDPSAALLEVLD--------PA-Q-------------------NSSFV-DHYLEVEYDLSDVMFIMT  488 (820)
Q Consensus       438 ~ldeidk~~~~~~gdp~~allevld--------p~-q-------------------n~~f~-d~y~~~~~dls~v~fi~t  488 (820)
                      +||||.-|.-..    .|+||.||-        -+ |                   +..|+ |-|+    -|+-.     
T Consensus       412 FldeIgd~p~~~----Qs~LLrVl~e~~v~p~g~~~~~vdirvi~ath~dl~~lv~~g~fredLyy----rL~~~-----  478 (606)
T COG3284         412 FLDEIGDMPLAL----QSRLLRVLQEGVVTPLGGTRIKVDIRVIAATHRDLAQLVEQGRFREDLYY----RLNAF-----  478 (606)
T ss_pred             HHHHHHHCHHHH----HHHHHHHHHHCCEECCCCCCEEEEEEEEECCCCCHHHHHHCCCCHHHHHH----HHCCE-----
T ss_conf             898761141899----99999998618252358852157799983467579999875971487888----74471-----


Q ss_pred             CCCCCCCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             4865544131172479982587868999899986089899862578131322899999997317741023478887999
Q gi|254780270|r  489 ANTLNIPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMK  567 (820)
Q Consensus       489 an~~~i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~  567 (820)
                        .+++ |||++|-+-|                -++-+.+++.+-  .-+.++++++..+. .|-.-.-+|+|.-.|..
T Consensus       479 --~i~l-P~lr~R~d~~----------------~~l~~~~~~~~~--~~~~l~~~~~~~l~-~~~WPGNirel~~v~~~  535 (606)
T COG3284         479 --VITL-PPLRERSDRI----------------PLLDRILKREND--WRLQLDDDALARLL-AYRWPGNIRELDNVIER  535 (606)
T ss_pred             --EECC-CCHHCCCCCH----------------HHHHHHHHHCCC--CCCCCCHHHHHHHH-HCCCCCCHHHHHHHHHH
T ss_conf             --5506-8611046657----------------899999987268--77568999999998-57899828999999999


No 276
>pfam07693 KAP_NTPase KAP family P-loop domain. The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals. Many of the prokaryotic KAP NTPases are encoded in plasmids and tend to undergo disruption to form pseudogenes. A unique feature of all eukaryotic and certain bacterial KAP NTPases is the presence of two or four transmembrane helices inserted into the P-loop NTPase domain. These transmembrane helices anchor KAP NTPases in the membrane such that the P-loop domain is located on the intracellular side.
Probab=96.61  E-value=0.032  Score=35.67  Aligned_cols=51  Identities=20%  Similarity=0.436  Sum_probs=25.9

Q ss_pred             CEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCCCCHHHCCC
Q ss_conf             73999933155423117711556655406001681332010352364427999934865544131172
Q gi|254780270|r  434 NPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLNIPLPLMDR  501 (820)
Q Consensus       434 npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~i~~~l~dr  501 (820)
                      .=|+++|++|-+..+.    +-.+||.+-     .    +    +|+.+|.||..++.-.+-.++..+
T Consensus       161 ~iVviIDDLDRc~p~~----~v~~Le~Ik-----~----~----~d~~n~vfVLa~D~~~v~~al~~~  211 (301)
T pfam07693       161 RIVVIIDDLDRCEPEE----AVELLEAVR-----L----L----FDFPNVVFILAYDEEIIKKAIEHN  211 (301)
T ss_pred             CEEEEECCCCCCCHHH----HHHHHHHHH-----H----H----HCCCCEEEEEECCHHHHHHHHHHH
T ss_conf             7899973655488789----999999999-----9----7----267981899975899999999987


No 277
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional
Probab=96.57  E-value=0.02  Score=37.19  Aligned_cols=77  Identities=16%  Similarity=0.258  Sum_probs=48.1

Q ss_pred             HHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCCCCCC-CCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHC
Q ss_conf             7888889999999875311025789999987654041587663-221068899877665201168999999999999842
Q gi|254780270|r  283 EAREKALSELQKLRQMNPLSAESSVVRNYLDWLLGVPWDKKSK-TKKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRV  361 (820)
Q Consensus       283 e~~~~~~kEl~rL~~m~~~s~E~~v~r~Yld~~~~lPW~~~t~-~~~dl~~a~~iLd~~hyGl~~vK~rile~lav~~~~  361 (820)
                      ..+....+++.-+++.+        --.|+||+..+|-++-.. +.+|+                               
T Consensus       163 ~f~~~~~~~~~~~e~~~--------~~~~~~~~~~~~~~~~~~~~~~~l-------------------------------  203 (407)
T PRK12726        163 DFMQAGRKQFKQVETAH--------LDDITDWFVPYLSGKLAVEDSFDL-------------------------------  203 (407)
T ss_pred             HHHHHHHHHHHHHHHHH--------HHHHHHHHHHHHCCCCCCCCEEEE-------------------------------
T ss_conf             24488999998873101--------534068999975389770320230-------------------------------


Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             444673599860565650279999997708824998618
Q gi|254780270|r  362 IKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLG  400 (820)
Q Consensus       362 ~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islg  400 (820)
                        ..|-|+.||||-|+|||+-.--+|.-+.+.-.++.|.
T Consensus       204 --~~g~VIaLVGvnGvGKTTTiAKLA~~l~~~gkkV~LV  240 (407)
T PRK12726        204 --SNHRIISLIGQTGVGKTTTLVKLGWQLLKQNRTVGFI  240 (407)
T ss_pred             --CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             --3690899989998978999999999999779917999


No 278
>cd03221 ABCF_EF-3 ABCF_EF-3  Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth.  EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site.  The reaction requires ATP hydrolysis.  EF-3 contains two ATP nucleotide binding sequence (NBS) motifs.  NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.
Probab=96.56  E-value=0.01  Score=39.45  Aligned_cols=113  Identities=22%  Similarity=0.255  Sum_probs=63.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHH--HHCCCC-CEEEEEE
Q ss_conf             4673599860565650279999997708824998618888888835632001456712899999--832788-7399993
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSL--KRAKRS-NPLLLLD  440 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l--~~~~~~-npv~~ld  440 (820)
                      .+|.+++++||-|.|||++.+.|+-.+...--.|..++-        ++-.|+.-+-|---|-+  .+|=.. ..+++||
T Consensus        24 ~~ge~~~l~G~NGsGKTTl~~~l~G~~~~~~G~i~~~~~--------~~i~y~~QLSgGqkqr~~la~al~~~p~iliLD   95 (144)
T cd03221          24 NPGDRIGLVGRNGAGKSTLLKLIAGELEPDEGIVTWGST--------VKIGYFEQLSGGEKMRLALAKLLLENPNLLLLD   95 (144)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECCC--------CEEEEEHHCCHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             799999999899984999999984898898509999996--------089987007999999999999972599899995


Q ss_pred             CHHHHHHHCCCCHHH--HHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCCCCHHHCCCEEEEE
Q ss_conf             315542311771155--665540600168133201035236442799993486554413117247998
Q gi|254780270|r  441 EIDKMGSDLRGDPSA--ALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLNIPLPLMDRMEIIR  506 (820)
Q Consensus       441 eidk~~~~~~gdp~~--allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~i~~~l~drme~i~  506 (820)
                      |-     +..-||.+  .+.+.|-                ++.+.+++.| -+++.-..+-||.-+++
T Consensus        96 EP-----t~~LD~~~~~~i~~~l~----------------~~~~tii~vs-Hd~~~~~~~~drii~l~  141 (144)
T cd03221          96 EP-----TNHLDLESIEALEEALK----------------EYPGTVILVS-HDRYFLDQVATKIIELE  141 (144)
T ss_pred             CC-----CCCCCHHHHHHHHHHHH----------------HCCCEEEEEE-CCHHHHHHHCCEEEEEE
T ss_conf             77-----55589999999999999----------------7099999996-79899998799999992


No 279
>pfam02367 UPF0079 Uncharacterized P-loop hydrolase UPF0079. This uncharacterized family contains a P-loop.
Probab=96.55  E-value=0.0034  Score=42.99  Aligned_cols=31  Identities=29%  Similarity=0.487  Sum_probs=27.5

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHCCC
Q ss_conf             4467359986056565027999999770882
Q gi|254780270|r  363 KNKGLILCFVGPPGVGKTSLAQSIAKATGRQ  393 (820)
Q Consensus       363 ~~~g~il~l~gppgvGKts~~~sia~al~r~  393 (820)
                      -.+|.+++|.|+-|.|||+++|+|+++||-.
T Consensus        12 l~~G~vi~L~G~LGaGKTtfvr~i~~~lg~~   42 (123)
T pfam02367        12 LKAGDVVLLSGDLGAGKTTFVRGLAKGLGIT   42 (123)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHCCCC
T ss_conf             8999799998887788999999999985998


No 280
>PRK09435 arginine/ornithine transport system ATPase; Provisional
Probab=96.53  E-value=0.0067  Score=40.78  Aligned_cols=145  Identities=17%  Similarity=0.292  Sum_probs=73.1

Q ss_pred             CCCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCC
Q ss_conf             32210688998776652011689999999999998424446735998605656502799999977088249986188888
Q gi|254780270|r  325 KTKKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYD  404 (820)
Q Consensus       325 ~~~~dl~~a~~iLd~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d  404 (820)
                      -+...|.++-..++..+-...+....++.-+    +..+.++.++++.||||+||.|+-.+++..+-..=.++++=-|--
T Consensus        12 g~~~alar~itlvEs~~~~~~~~~~~ll~~l----~~~~g~a~~iGiTG~pG~GKStli~~l~~~~~~~g~~v~vlavDP   87 (325)
T PRK09435         12 GDRAALARAITLVESTRPDHRALAQELLDAL----LPHTGNALRIGITGVPGVGKSTFIEALGMHLIEQGHKVAVLAVDP   87 (325)
T ss_pred             CCHHHHHHHHHHHHCCCCHHHHHHHHHHHHH----HHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECC
T ss_conf             9998999999998679912489999999986----301798259974279998688999999999996798589999789


Q ss_pred             H---------------HHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHH---HCCCCCC
Q ss_conf             8---------------883563200145671289999983278873999933155423117711556655---4060016
Q gi|254780270|r  405 E---------------ADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLE---VLDPAQN  466 (820)
Q Consensus       405 ~---------------~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~alle---vldp~qn  466 (820)
                      .               .++-.|-..|+-+||                         +.+.-|--+.+..|   ++|-   
T Consensus        88 sS~~sgGaiLGDr~Rm~~~~~~~~~fiRs~~-------------------------srg~lgg~~~~~~~~~~~~~a---  139 (325)
T PRK09435         88 SSTRTGGSILGDKTRMERLSRHPNAFIRPSP-------------------------SSGTLGGVARKTRETMLLCEA---  139 (325)
T ss_pred             CCCCCCCCHHHHHHHHHHHCCCCCEEEEECC-------------------------CCCCCCCCCHHHHHHHHHHHH---
T ss_conf             9998886101038888761479984884067-------------------------788867733549999999997---


Q ss_pred             CCEEEEECCCCCCCCCEEEEEECCCC--CCC-HHHCCCEEEEEECCCCHH
Q ss_conf             81332010352364427999934865--544-131172479982587868
Q gi|254780270|r  467 SSFVDHYLEVEYDLSDVMFIMTANTL--NIP-LPLMDRMEIIRIAGYTEE  513 (820)
Q Consensus       467 ~~f~d~y~~~~~dls~v~fi~tan~~--~i~-~~l~drme~i~~~~y~~~  513 (820)
                               ..|   +++||-|.-.=  ++. .-+-|..=++.+||+-.+
T Consensus       140 ---------~g~---d~i~iETvGvGQ~e~~v~~~~d~~~~~~~p~~GD~  177 (325)
T PRK09435        140 ---------AGF---DVILVETVGVGQSETAVAGMVDFFLLLQLPGAGDE  177 (325)
T ss_pred             ---------CCC---CEEEEEECCCCHHHHHHHHHCCEEEEEECCCCCCH
T ss_conf             ---------799---98999706777148899874266888835887608


No 281
>PRK00300 gmk guanylate kinase; Provisional
Probab=96.52  E-value=0.0034  Score=43.04  Aligned_cols=33  Identities=21%  Similarity=0.544  Sum_probs=26.8

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEE
Q ss_conf             446735998605656502799999977088249
Q gi|254780270|r  363 KNKGLILCFVGPPGVGKTSLAQSIAKATGRQYV  395 (820)
Q Consensus       363 ~~~g~il~l~gppgvGKts~~~sia~al~r~f~  395 (820)
                      ..+|.+++++||+|||||+|.+-+.+...-.|.
T Consensus         4 ~~~g~livisGPSG~GK~tl~~~L~~~~p~~~~   36 (208)
T PRK00300          4 MRRGLLIVLSAPSGAGKSTLVRALLERDPNDLQ   36 (208)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHCCCCEE
T ss_conf             418838999999988999999999972998689


No 282
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=96.51  E-value=0.048  Score=34.33  Aligned_cols=39  Identities=21%  Similarity=0.293  Sum_probs=24.7

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             446735998605656502799999977088249986188
Q gi|254780270|r  363 KNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGG  401 (820)
Q Consensus       363 ~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg  401 (820)
                      ..+.+++.||||.|+|||+-+--+|.-+..+-.++.|-.
T Consensus        72 ~~~~~vI~lvG~~G~GKTTT~AKLA~~~~~~~~kV~lia  110 (270)
T PRK06731         72 EKEVQTIALIGPTGVGKTTTLAKMAWQFHGKKKTVGFIT  110 (270)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             799818999888989889999999999986799089998


No 283
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  Pentoses include xylose, arabinose, and ribose.  Important hexoses include glucose, galactose, and fructose.  In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=96.50  E-value=0.01  Score=39.41  Aligned_cols=79  Identities=23%  Similarity=0.294  Sum_probs=49.4

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCC----CCHHHHCCCCCCCCCCCCHHHHH--HHHHCCCCCE-E
Q ss_conf             467359986056565027999999770882499861888----88888356320014567128999--9983278873-9
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGV----YDEADIRGHRRTYIGSMPGRIIQ--SLKRAKRSNP-L  436 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~----~d~~~i~gh~~ty~ga~pg~ii~--~l~~~~~~np-v  436 (820)
                      .+|.|++|+||-|-|||++.+.|+-.+.-.--+|.+.|-    .+..+.+-+.-.|+--+.|---|  ++.+|=..|| +
T Consensus        24 ~~Gei~~lvG~nGaGKSTl~~~i~Gl~~p~~G~i~i~G~~i~~~~~~~~~~~gi~~v~qLSgG~~Qrv~iaral~~~p~l  103 (163)
T cd03216          24 RRGEVHALLGENGAGKSTLMKILSGLYKPDSGEILVDGKEVSFASPRDARRAGIAMVYQLSVGERQMVEIARALARNARL  103 (163)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHCCCCEECCCCHHHHHHHHHHHHHHHCCCE
T ss_conf             79989999988998999999999577689857899999999999999999879948946998999999999999729999


Q ss_pred             EEEECH
Q ss_conf             999331
Q gi|254780270|r  437 LLLDEI  442 (820)
Q Consensus       437 ~~ldei  442 (820)
                      ++|||-
T Consensus       104 lilDEP  109 (163)
T cd03216         104 LILDEP  109 (163)
T ss_pred             EEEECC
T ss_conf             999097


No 284
>cd01120 RecA-like_NTPases RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.
Probab=96.49  E-value=0.016  Score=38.00  Aligned_cols=39  Identities=31%  Similarity=0.502  Sum_probs=30.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHH---CCCEEEEECCCCCCHH
Q ss_conf             59986056565027999999770---8824998618888888
Q gi|254780270|r  368 ILCFVGPPGVGKTSLAQSIAKAT---GRQYVRMSLGGVYDEA  406 (820)
Q Consensus       368 il~l~gppgvGKts~~~sia~al---~r~f~~islgg~~d~~  406 (820)
                      ++.+.||||+|||+|+..+|...   +-+.+.++.++-.++-
T Consensus         1 ~~li~g~~g~GKttl~~~~~~~~~~~~~~~~~~~~ee~~~q~   42 (165)
T cd01120           1 LILVFGPTGSGKTTLALQLALNIATKGGKVVYVDIEEEIEEL   42 (165)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCHHHH
T ss_conf             989998999989999999999987639979999866644899


No 285
>cd03114 ArgK-like The function of this protein family is unkown. The protein sequences are similar to the ArgK protein in E. coli. ArgK protein is a membrane ATPase which is required for transporting arginine, ornithine and lysine into the cells by the arginine and ornithine (AO system) and lysine, arginine and ornithine (LAO) transport systems.
Probab=96.48  E-value=0.0083  Score=40.07  Aligned_cols=122  Identities=20%  Similarity=0.334  Sum_probs=57.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHH-HHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECHHHHH
Q ss_conf             599860565650279999997708824998618888888-8356320014567128999998327887399993315542
Q gi|254780270|r  368 ILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEA-DIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMG  446 (820)
Q Consensus       368 il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~-~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~ldeidk~~  446 (820)
                      ++++.||||+|||||-..+.+.+-.+-.++++=-+ |.+ ...      =||.-|-=++.-..+.+  |=.++-.+  -+
T Consensus         1 viGitG~pGaGKStLi~~l~~~~~~~g~~VaVlav-DPsS~~s------gGalLGDRiRm~~~~~~--~~vfiRs~--at   69 (148)
T cd03114           1 VIGITGVPGAGKSTLIDALITALRARGKRVAVLAI-DPSSPFS------GGAILGDRIRMERHASD--PGVFIRSL--AT   69 (148)
T ss_pred             CEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEEE-CCCCCCC------CCCCHHHHHHHHHHCCC--CCEEEEEC--CC
T ss_conf             97625899787899999999999978983799996-8887866------86203235453441579--98368634--66


Q ss_pred             HHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCC--CCC-HHHCCCEEEEEECCCCH
Q ss_conf             3117711556655406001681332010352364427999934865--544-13117247998258786
Q gi|254780270|r  447 SDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTL--NIP-LPLMDRMEIIRIAGYTE  512 (820)
Q Consensus       447 ~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~--~i~-~~l~drme~i~~~~y~~  512 (820)
                      .+..|..+.+..+.++-=.-         ..|   .++||=|.-.-  +.. ..+-|..=++-.|++-.
T Consensus        70 rg~~ggla~~~~~~i~~l~~---------~g~---D~IiIETvGvGQse~~i~~~aD~~i~v~~p~~GD  126 (148)
T cd03114          70 RGFLGGLSRATPEVIRVLDA---------AGF---DVIIVETVGVGQSEVDIASMADTTVVVMAPGAGD  126 (148)
T ss_pred             CCCCCCHHHHHHHHHHHHHH---------CCC---CEEEEECCCCCCCHHHHHHHCCEEEEEECCCCCC
T ss_conf             66542046889999999997---------599---9899974877756026554356699996368873


No 286
>KOG0477 consensus
Probab=96.46  E-value=0.0067  Score=40.78  Aligned_cols=232  Identities=21%  Similarity=0.291  Sum_probs=119.8

Q ss_pred             HHHHCHHHHHHHHHHHHHHHH-HC----CCCCCCE-EEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCC--HHHHCC
Q ss_conf             652011689999999999998-42----4446735-998605656502799999977088249986188888--888356
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQM-RV----IKNKGLI-LCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYD--EADIRG  410 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~~-~~----~~~~g~i-l~l~gppgvGKts~~~sia~al~r~f~~islgg~~d--~~~i~g  410 (820)
                      -..||++.||--+---|.=+. .+    .+.+|-| ++|+|-||+||...-|-+++.-.|-...-..|.-.=  -|..+-
T Consensus       449 PsIyGh~~VK~AvAlaLfGGv~kn~~~khkvRGDinvLL~GDPGTaKSQFLKY~eK~s~RAV~tTGqGASavGLTa~v~K  528 (854)
T KOG0477         449 PSIYGHEDVKRAVALALFGGVPKNPGGKHKVRGDINVLLLGDPGTAKSQFLKYAEKTSPRAVFTTGQGASAVGLTAYVRK  528 (854)
T ss_pred             CHHHCHHHHHHHHHHHHHCCCCCCCCCCCEECCCEEEEEECCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCEEEEEEE
T ss_conf             24314589999999998568756889874451440289846998228999999986275316850677543332688751


Q ss_pred             CCCCCCCCCCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCC--------
Q ss_conf             320014567128999998327887399993315542311771155665540600168133201035236442--------
Q gi|254780270|r  411 HRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSD--------  482 (820)
Q Consensus       411 h~~ty~ga~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~--------  482 (820)
                      |   -|+--|-.=--||.-  .--.|-|+||.|||...-|-..--||=      |-          .+-.||        
T Consensus       529 d---PvtrEWTLEaGALVL--ADkGvClIDEFDKMndqDRtSIHEAME------QQ----------SISISKAGIVtsLq  587 (854)
T KOG0477         529 D---PVTREWTLEAGALVL--ADKGVCLIDEFDKMNDQDRTSIHEAME------QQ----------SISISKAGIVTSLQ  587 (854)
T ss_pred             C---CCCCEEEECCCEEEE--CCCCEEEEEHHHHHCCCCCCHHHHHHH------HC----------CHHHHHHHHHHHHH
T ss_conf             7---865303651672897--268537741211204011015999987------51----------20144666899887


Q ss_pred             --EEEEEECCCC--------------CCCHHHCCCEEEEEECCCC----HHHHHH--HHHHH--HHHHHHHHHCCCCCCC
Q ss_conf             --7999934865--------------5441311724799825878----689998--99986--0898998625781313
Q gi|254780270|r  483 --VMFIMTANTL--------------NIPLPLMDRMEIIRIAGYT----EEEKLQ--IAKNH--LVKKVLTEHALKQEEC  538 (820)
Q Consensus       483 --v~fi~tan~~--------------~i~~~l~drme~i~~~~y~----~~ek~~--i~~~~--l~p~~~~~~~~~~~~~  538 (820)
                        +..|++||-.              +...|.+.|..|.-+---+    .+||+.  +...|  .-|+-.++-|+.+.++
T Consensus       588 ArctvIAAanPigGRY~~s~tFaqNV~ltePIlSRFDiLcVvkD~vd~~~De~lA~fVV~Sh~r~hp~~~~~~~~~e~~~  667 (854)
T KOG0477         588 ARCTVIAAANPIGGRYNPSLTFAQNVDLTEPILSRFDILCVVKDTVDPVQDEKLAKFVVGSHVRHHPSNKEEDGLEEPQM  667 (854)
T ss_pred             HHHHHHEECCCCCCCCCCCCCHHHCCCCCCCHHHHCCEEEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             55443000277777568751143305544441211132456403558136788999998767404876444676543234


Q ss_pred             C-----CCHHHHHHHHHCCCCCCHHH-HHHH----HHHHHHHHHHHHHHCCCCCEECCCHHHHHHHH
Q ss_conf             2-----28999999973177410234-7888----79999898765421178520127967867530
Q gi|254780270|r  539 C-----ISDGVLLDIIRLFTHEAGVR-SFER----ALMKIARKAVTKIVKNSDTTVSINENNLQDYL  595 (820)
Q Consensus       539 ~-----~~~~~i~~ii~~Yt~EaGvR-~l~r----~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~l  595 (820)
                      .     ++.+++++.|. |.+|- || .|..    .+.+++-..-.+-..  ...+-||...++-.+
T Consensus       668 ~~~v~~ipq~lLrkyI~-yar~~-v~PkL~q~d~~K~s~vya~lRkES~~--tGs~piTvRHieS~i  730 (854)
T KOG0477         668 PARVEPIPQELLRKYII-YAREK-VRPKLNQMDMDKISSVYADLRKESMA--TGSLPITVRHIESMI  730 (854)
T ss_pred             CCCCCCCHHHHHHHHHH-HHHHH-CCCCCCCCCHHHHHHHHHHHHHHCCC--CCCCHHHHHHHHHHH
T ss_conf             56666683999999999-99975-25001011378899999999761556--688503399999999


No 287
>PRK04220 2-phosphoglycerate kinase; Provisional
Probab=96.45  E-value=0.079  Score=32.68  Aligned_cols=99  Identities=19%  Similarity=0.266  Sum_probs=63.7

Q ss_pred             HHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHH-HHHHHHHHHHCHHHHHH
Q ss_conf             99852224788578888899999998753110257899999876540415876632210688-99877665201168999
Q gi|254780270|r  271 FEARISKIRLSKEAREKALSELQKLRQMNPLSAESSVVRNYLDWLLGVPWDKKSKTKKNLDF-AIRILDQDHFGLEKVKE  349 (820)
Q Consensus       271 l~~Ki~~~~lp~e~~~~~~kEl~rL~~m~~~s~E~~v~r~Yld~~~~lPW~~~t~~~~dl~~-a~~iLd~~hyGl~~vK~  349 (820)
                      |...+-.++++++..-.+-+|+++.=.-.                     +...-..-+|.+ +.+.|-+.-|  +++-+
T Consensus        22 l~rslt~~gi~~~~A~~ia~ei~~~L~~~---------------------~~~~i~~~el~~~v~~~l~~~~~--~~~a~   78 (306)
T PRK04220         22 LARSLTAAGMKPDLAYEIASEIEEELKKE---------------------GITKITKEELRRRVYYKLIEKDY--EEIAE   78 (306)
T ss_pred             HHHHHHHHCCCHHHHHHHHHHHHHHHHHC---------------------CCEEECHHHHHHHHHHHHHHHCC--HHHHH
T ss_conf             99999980898889999999999999865---------------------77163599999999999998440--99999


Q ss_pred             HHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEE
Q ss_conf             9999999998424446735998605656502799999977088249
Q gi|254780270|r  350 RIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYV  395 (820)
Q Consensus       350 rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~  395 (820)
                         -|+..+.+.....+-|+++.|.+||||++||-.+|.-||.+-+
T Consensus        79 ---rY~~~r~~r~~~~pliILigGtsGvGKSTlA~~LA~rLgI~~v  121 (306)
T PRK04220         79 ---KYLLWRRIRKSKEPIIILIGGASGVGTSTIAFELASRLGIRSV  121 (306)
T ss_pred             ---HHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCEE
T ss_conf             ---9999999853699879998589988789999999997098834


No 288
>KOG1942 consensus
Probab=96.45  E-value=0.0028  Score=43.63  Aligned_cols=51  Identities=35%  Similarity=0.371  Sum_probs=29.0

Q ss_pred             CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCC
Q ss_conf             4413117247998258786899989998608989986257813132289999999731774
Q gi|254780270|r  494 IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTH  554 (820)
Q Consensus       494 i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~  554 (820)
                      ||.-|+||+-+|..-.|+.+|-.+|.+.-          .+.+.+.++++++..+.+--|+
T Consensus       351 ip~dllDRl~Iirt~~y~~~e~r~Ii~~R----------a~~E~l~~~e~a~~~l~~~gt~  401 (456)
T KOG1942         351 IPPDLLDRLLIIRTLPYDEEEIRQIIKIR----------AQVEGLQVEEEALDLLAEIGTS  401 (456)
T ss_pred             CCHHHHHHEEEEEECCCCHHHHHHHHHHH----------HHHHCCEECHHHHHHHHHHCCC
T ss_conf             99778612667860369989999999998----------7651423228899998760541


No 289
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]
Probab=96.44  E-value=0.0027  Score=43.79  Aligned_cols=56  Identities=25%  Similarity=0.405  Sum_probs=37.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCC
Q ss_conf             59986056565027999999770882499861888888883563200145671289999983278
Q gi|254780270|r  368 ILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKR  432 (820)
Q Consensus       368 il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~  432 (820)
                      -+++.||||.|||++|+-||+.+  ++..+|.|-+--++--.+       +--|+-++..+..+.
T Consensus         2 riiilG~pGaGK~T~A~~La~~~--~i~hlstgd~~r~~~~~~-------t~lg~~~k~~i~~g~   57 (178)
T COG0563           2 RILILGPPGAGKSTLAKKLAKKL--GLPHLDTGDILRAAIAER-------TELGEEIKKYIDKGE   57 (178)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHC--CCCEECCCCCCCHHHCCC-------CHHHHHHHHHHHCCC
T ss_conf             79998999998899999999976--997855220111100323-------689999999987589


No 290
>pfam01768 Birna_VP4 Birnavirus VP4 protein. VP4 is a viral protease. The large RNA segment of birnaviruses codes for a polyprotein (N-VP2-VP4-VP3-C).
Probab=96.44  E-value=0.0052  Score=41.60  Aligned_cols=65  Identities=35%  Similarity=0.388  Sum_probs=48.4

Q ss_pred             CEEE-CCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEEEECCEEEEECCHHHHHHHHHHCCCCEE
Q ss_conf             1474-4888847888730689999999998368887561066368503025000656899999997099699
Q gi|254780270|r  680 IHVH-VPEGATPKDGPSAGIAMATAIVSIMTCIPVYKNVAMTGELTLRGRVLPIGGLKEKLLAALRAGVTKV  750 (820)
Q Consensus       680 iHih-~p~Ga~pKDGPSAGi~i~tal~S~~~~~~v~~~iAmTGEitl~G~VlpiGGi~eK~laA~raGi~~v  750 (820)
                      |-+- .|.|.+  -|||+-++|.  +++-+.+-.|+. .|||||+.=. .|.||-|+.-|..|||+-|+.-+
T Consensus       179 i~v~k~~~~pi--~G~S~qLai~--l~~~~~~~gVP~-~afTG~l~~~-sv~~I~gv~iKa~aAh~lGLpL~  244 (264)
T pfam01768       179 IVVSKIPAGPI--MGPSAQLAIY--ALVDDIKEGVPR-MAFTGELVGD-SVGEICGVDIKLIAAHELGLPLL  244 (264)
T ss_pred             EEEEECCCCCC--CCCHHHHHHH--HHHHHHCCCCCE-EEEEEEECCC-CEEEEECCCHHHHHHHHCCCCCC
T ss_conf             68751347875--5843455699--987510048872-8885102377-35404030122333554288511


No 291
>TIGR00368 TIGR00368 Mg chelatase homolog; InterPro: IPR004482   This family of bacterial proteins are variously described as 'hypothetical protein yifB', 'competence protein', 'hypothetical protein' or 'Mg chelatase-related protein'. These proteins are a subset of the magnesium chelatase, ChlI subunit family and either belong to or show significant homology to the non-peptidase homologs of the MEROPS peptidase family S16 (lon protease family, clan SF), IPR001984 from INTERPRO. .
Probab=96.44  E-value=0.0015  Score=45.62  Aligned_cols=22  Identities=50%  Similarity=0.841  Sum_probs=18.0

Q ss_pred             CCEEEEECCCCCCHHHHHHHHH
Q ss_conf             7359986056565027999999
Q gi|254780270|r  366 GLILCFVGPPGVGKTSLAQSIA  387 (820)
Q Consensus       366 g~il~l~gppgvGKts~~~sia  387 (820)
                      |-=|.|+||||+|||-+|+-+.
T Consensus       213 GHNlll~GPPGsGKTmla~r~~  234 (505)
T TIGR00368       213 GHNLLLLGPPGSGKTMLASRLQ  234 (505)
T ss_pred             CCCEEEECCCCCCHHHHHHHHH
T ss_conf             5643767824962689998751


No 292
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism]
Probab=96.42  E-value=0.024  Score=36.65  Aligned_cols=76  Identities=20%  Similarity=0.317  Sum_probs=46.5

Q ss_pred             HHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEE-----EEC-CCCCCHHHHC--------CCCCCCC
Q ss_conf             9999999984244467359986056565027999999770882499-----861-8888888835--------6320014
Q gi|254780270|r  351 IIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVR-----MSL-GGVYDEADIR--------GHRRTYI  416 (820)
Q Consensus       351 ile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~-----isl-gg~~d~~~i~--------gh~~ty~  416 (820)
                      +++|++   .+.....-|+.+.|||||||.++|+-++.+|.|.+..     +.+ |...+-+.++        |---||=
T Consensus        70 ~~~~l~---~~~~~~pfIIgiaGsvavGKST~ar~L~~ll~~~~~~~~v~lvpmDGFhy~n~~L~~~glm~rKGfPeSyD  146 (283)
T COG1072          70 LLRFLG---TNNQQRPFIIGIAGSVAVGKSTTARILQALLSRWPESPKVDLVTMDGFHYPNAVLDERGLMARKGFPESYD  146 (283)
T ss_pred             HHHHHC---CCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCCCC
T ss_conf             999834---66888887999605766557789999999996388987337871454546767752212200189985356


Q ss_pred             CCCCHHHHHHHHH
Q ss_conf             5671289999983
Q gi|254780270|r  417 GSMPGRIIQSLKR  429 (820)
Q Consensus       417 ga~pg~ii~~l~~  429 (820)
                      -+-==+++..+|.
T Consensus       147 ~~~ll~fl~~vK~  159 (283)
T COG1072         147 VAALLRFLSDVKA  159 (283)
T ss_pred             HHHHHHHHHHHHC
T ss_conf             8999999999965


No 293
>PRK00771 signal recognition particle protein Srp54; Provisional
Probab=96.38  E-value=0.1  Score=31.89  Aligned_cols=106  Identities=25%  Similarity=0.334  Sum_probs=66.5

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCC-CCEEEEEE
Q ss_conf             44467359986056565027999999770882499861888888883563200145671289999983278-87399993
Q gi|254780270|r  362 IKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKR-SNPLLLLD  440 (820)
Q Consensus       362 ~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~-~npv~~ld  440 (820)
                      +..++.++.|||.-|+|||+-+--+|.-+.++..++-|... |         ||-   |+-+=|--.-+.. .-|++   
T Consensus        93 ~~~kP~Vim~vGlqGsGKTTT~aKLA~~~kk~g~kv~lvaa-D---------t~R---paA~eQL~~la~~~~v~~~---  156 (433)
T PRK00771         93 ILLKPQTILLVGLQGSGKTTTAAKLARYFQKKGLKVGVICA-D---------TWR---PGAYEQLKQLCEKINVPFY---  156 (433)
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEC-C---------CCC---HHHHHHHHHHHHHCCCCCC---
T ss_conf             66898589997378897899999999999977994678506-7---------883---6899999999986388731---


Q ss_pred             CHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCCCCHHHCCCE
Q ss_conf             31554231177115566554060016813320103523644279999348655441311724
Q gi|254780270|r  441 EIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLNIPLPLMDRM  502 (820)
Q Consensus       441 eidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~i~~~l~drm  502 (820)
                           +.....||.+..-+-+.     .|.+      |   +|++|=||--+++...|.+-|
T Consensus       157 -----~~~~~~dp~~i~~~a~~-----~~k~------~---DvviiDTAGRl~~d~~Lm~El  199 (433)
T PRK00771        157 -----GDPKEKDAVKIVKEGLE-----KLKK------V---DVIIVDTAGRHKLEKDLIEEM  199 (433)
T ss_pred             -----CCCCCCCHHHHHHHHHH-----HHCC------C---CEEEEECCCCCCCCHHHHHHH
T ss_conf             -----78899999999999999-----8456------9---889997765210409999999


No 294
>PRK07263 consensus
Probab=96.34  E-value=0.11  Score=31.71  Aligned_cols=41  Identities=22%  Similarity=0.280  Sum_probs=32.0

Q ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHHH----HCCCEEEEECCC
Q ss_conf             24446735998605656502799999977----088249986188
Q gi|254780270|r  361 VIKNKGLILCFVGPPGVGKTSLAQSIAKA----TGRQYVRMSLGG  401 (820)
Q Consensus       361 ~~~~~g~il~l~gppgvGKts~~~sia~a----l~r~f~~islgg  401 (820)
                      .+=.+|..+-+.|.||+|||++|-.||.-    -|.+...+||==
T Consensus       198 ~Gl~~GdLiviaaRPsmGKTa~alnia~~iA~~~~~~V~~fSlEM  242 (453)
T PRK07263        198 TGLHPDQLIILAARPAVGKTAFVLNIAQNVGTKQKKTVAIFSLEM  242 (453)
T ss_pred             CCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             289978689997278884789999999999985598289992469


No 295
>TIGR03263 guanyl_kin guanylate kinase. Members of this family are the enzyme guanylate kinase, also called GMP kinase. This enzyme transfers a phosphate from ATP to GMP, yielding ADP and GDP.
Probab=96.30  E-value=0.0059  Score=41.18  Aligned_cols=33  Identities=30%  Similarity=0.634  Sum_probs=24.5

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             735998605656502799999977088249986
Q gi|254780270|r  366 GLILCFVGPPGVGKTSLAQSIAKATGRQYVRMS  398 (820)
Q Consensus       366 g~il~l~gppgvGKts~~~sia~al~r~f~~is  398 (820)
                      |.++.|+||+|+|||+|.+-+.+-...-+.-+|
T Consensus         1 G~livl~GpsG~GK~tl~~~l~~~~~~~~~~vs   33 (180)
T TIGR03263         1 GLLIVISGPSGVGKSTLVKALLEEDPNLKFSIS   33 (180)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEE
T ss_conf             939999899988999999999976899448870


No 296
>PRK07261 topology modulation protein; Provisional
Probab=96.28  E-value=0.0051  Score=41.71  Aligned_cols=29  Identities=21%  Similarity=0.449  Sum_probs=26.2

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEE
Q ss_conf             99860565650279999997708824998
Q gi|254780270|r  369 LCFVGPPGVGKTSLAQSIAKATGRQYVRM  397 (820)
Q Consensus       369 l~l~gppgvGKts~~~sia~al~r~f~~i  397 (820)
                      ++.+|+||.|||++|+-+|+.+|.|++-+
T Consensus         3 I~IiG~sGsGKSTlAr~L~~~~~ip~~~L   31 (171)
T PRK07261          3 IAIIGYSGSGKSTLARFLGQHYNCPVLHL   31 (171)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEE
T ss_conf             99988999868999999999879797970


No 297
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.26  E-value=0.0038  Score=42.67  Aligned_cols=78  Identities=33%  Similarity=0.442  Sum_probs=47.6

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCH----HHHCCCCCCCCCCCCHHHHH--HHHHCCCC-CEE
Q ss_conf             467359986056565027999999770882499861888888----88356320014567128999--99832788-739
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDE----ADIRGHRRTYIGSMPGRIIQ--SLKRAKRS-NPL  436 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~----~~i~gh~~ty~ga~pg~ii~--~l~~~~~~-npv  436 (820)
                      .+|.+++++||-|.|||++.+.|+-.+...--.|.+.|..-.    .++|- +--|+.-+-|---|  ++.++=.. -++
T Consensus        23 ~~Ge~~~i~G~nGaGKSTLl~~l~gl~~~~~G~i~~~g~~~~~~~~~~~~~-~i~~v~QLSgGqkqrv~iA~al~~~p~i  101 (157)
T cd00267          23 KAGEIVALVGPNGSGKSTLLRAIAGLLKPTSGEILIDGKDIAKLPLEELRR-RIGYVPQLSGGQRQRVALARALLLNPDL  101 (157)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHH-CCCCCCCCCHHHHHHHHHHHHHHCCCCE
T ss_conf             799799998788999899999995884799628999999999799999994-0608766886999999999999709999


Q ss_pred             EEEECH
Q ss_conf             999331
Q gi|254780270|r  437 LLLDEI  442 (820)
Q Consensus       437 ~~ldei  442 (820)
                      ++|||.
T Consensus       102 lilDEP  107 (157)
T cd00267         102 LLLDEP  107 (157)
T ss_pred             EEEECC
T ss_conf             999698


No 298
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism]
Probab=96.24  E-value=0.0078  Score=40.29  Aligned_cols=42  Identities=31%  Similarity=0.449  Sum_probs=34.0

Q ss_pred             HHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEE
Q ss_conf             999998424446735998605656502799999977088249
Q gi|254780270|r  354 YLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYV  395 (820)
Q Consensus       354 ~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~  395 (820)
                      |+--+...+-..+-|+++=|+|||||||||..||.-||..-+
T Consensus        77 Y~lwR~ir~~~~p~IILIGGasGVGkStIA~ElA~rLgI~~v  118 (299)
T COG2074          77 YLLWRRIRKMKRPLIILIGGASGVGKSTIAGELARRLGIRSV  118 (299)
T ss_pred             HHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCEE
T ss_conf             999999861578759996178877725799999997298610


No 299
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism]
Probab=96.21  E-value=0.0047  Score=41.98  Aligned_cols=56  Identities=29%  Similarity=0.516  Sum_probs=38.5

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCC-CCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEE
Q ss_conf             59986056565027999999770882499861888-8888835632001456712899999832788739
Q gi|254780270|r  368 ILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGV-YDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPL  436 (820)
Q Consensus       368 il~l~gppgvGKts~~~sia~al~r~f~~islgg~-~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv  436 (820)
                      ++..-||||.|||++++-||+-||.+|  +|-|-+ |+-|.=+           |+=+..+-+....||=
T Consensus         2 ~ItIsG~pGsG~TTva~~lAe~~gl~~--vsaG~iFR~~A~e~-----------gmsl~ef~~~AE~~p~   58 (179)
T COG1102           2 VITISGLPGSGKTTVARELAEHLGLKL--VSAGTIFREMARER-----------GMSLEEFSRYAEEDPE   58 (179)
T ss_pred             EEEECCCCCCCCHHHHHHHHHHHCCCE--EECCHHHHHHHHHC-----------CCCHHHHHHHHHCCCH
T ss_conf             799617999970279999999829715--62127999999983-----------9999999998751921


No 300
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT). Cm-inactivating enzyme; modifies the primary (C-3) hydroxyl of the antibiotic. Related structurally to shikimate kinase II.
Probab=96.20  E-value=0.014  Score=38.44  Aligned_cols=39  Identities=18%  Similarity=0.425  Sum_probs=35.0

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCC
Q ss_conf             673599860565650279999997708824998618888
Q gi|254780270|r  365 KGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVY  403 (820)
Q Consensus       365 ~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~  403 (820)
                      .|.||.|.|++--||||||+.|-..+.+||.-+|+-...
T Consensus         1 ~G~II~LNG~SSSGKSsiAraLQ~~l~~p~~h~~vD~f~   39 (175)
T cd00227           1 TGRIIILNGGSSAGKSSIARALQSVLAEPWLHFGVDSFI   39 (175)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEHHHHH
T ss_conf             974999868998988999999998476756884185898


No 301
>PRK04040 adenylate kinase; Provisional
Probab=96.18  E-value=0.011  Score=39.17  Aligned_cols=44  Identities=25%  Similarity=0.427  Sum_probs=33.7

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECC-----------CCCCHHHHC
Q ss_conf             73599860565650279999997708824998618-----------888888835
Q gi|254780270|r  366 GLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLG-----------GVYDEADIR  409 (820)
Q Consensus       366 g~il~l~gppgvGKts~~~sia~al~r~f~~islg-----------g~~d~~~i~  409 (820)
                      +.+..++|-|||||||+.+-..+-|.-.|.-++.|           ++.|..|+|
T Consensus         2 ~k~VvvtGiPGvGKTTv~~~~~~~l~~~~~~vn~G~~M~e~A~~~glv~~RDemR   56 (189)
T PRK04040          2 MKVVVVTGVPGVGKTTVLNKALEKLKEDYKIVNFGDVMLEVAKEEGLVEHRDEMR   56 (189)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEHHHHHHHHHHHCCCCCCHHHHC
T ss_conf             4189997589887899999999972358759867799999999817734778874


No 302
>PRK08118 topology modulation protein; Reviewed
Probab=96.18  E-value=0.0057  Score=41.32  Aligned_cols=29  Identities=21%  Similarity=0.456  Sum_probs=26.2

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEE
Q ss_conf             99860565650279999997708824998
Q gi|254780270|r  369 LCFVGPPGVGKTSLAQSIAKATGRQYVRM  397 (820)
Q Consensus       369 l~l~gppgvGKts~~~sia~al~r~f~~i  397 (820)
                      ++.+|+||.|||++|+-+|+.+|.|++-+
T Consensus         4 I~IiG~~GsGKSTlAr~L~~~~~ip~~~L   32 (167)
T PRK08118          4 IILIGSGGSGKSTLARQLGEKLNIPVHHL   32 (167)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEC
T ss_conf             99988999879999999999889697964


No 303
>pfam03308 ArgK ArgK protein. The ArgK protein acts as an ATPase enzyme and as a kinase, and phosphorylates periplasmic binding proteins involved in the LAO (lysine, arginine, ornithine)/AO transport systems.
Probab=96.18  E-value=0.012  Score=39.00  Aligned_cols=114  Identities=23%  Similarity=0.344  Sum_probs=59.4

Q ss_pred             HCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCC------------C---HHHHCCCCCCCCCCCCHHHH
Q ss_conf             42444673599860565650279999997708824998618888------------8---88835632001456712899
Q gi|254780270|r  360 RVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVY------------D---EADIRGHRRTYIGSMPGRII  424 (820)
Q Consensus       360 ~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~------------d---~~~i~gh~~ty~ga~pg~ii  424 (820)
                      +..+.++.++++.||||+||.|+--.+...+-.+-.++++=-|-            |   -.++-.|.+.|+-+||    
T Consensus        23 ~~~~g~a~~iGiTG~PGaGKStli~~l~~~~~~~g~~vaVlAvDPSS~~sgGaiLGDr~RM~~~~~~~~vfiRs~~----   98 (267)
T pfam03308        23 MPLTGRAHRVGITGVPGAGKSTLIEALGMELRRRGHRVAVLAVDPSSPFTGGSILGDRTRMQRLAVDPGAFIRSSP----   98 (267)
T ss_pred             HHHCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCHHHHHHHCCCCCEEEEECC----
T ss_conf             7435995599876899887999999999999968986899997899988886300107777650589985886457----


Q ss_pred             HHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHH---HCCCCCCCCEEEEECCCCCCCCCEEEEEECCCC--CCC-HHH
Q ss_conf             99983278873999933155423117711556655---406001681332010352364427999934865--544-131
Q gi|254780270|r  425 QSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLE---VLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTL--NIP-LPL  498 (820)
Q Consensus       425 ~~l~~~~~~npv~~ldeidk~~~~~~gdp~~alle---vldp~qn~~f~d~y~~~~~dls~v~fi~tan~~--~i~-~~l  498 (820)
                                           +.+.-|--+.+.-|   ++|-            ..|   ++.||-|--.=  ++. .-+
T Consensus        99 ---------------------srg~lGGls~~t~~~i~llea------------aGf---D~IivETVGVGQsE~~v~~~  142 (267)
T pfam03308        99 ---------------------SRGALGGLSRATREAILLLDA------------AGF---DVIIIETVGVGQSEVDIANM  142 (267)
T ss_pred             ---------------------CCCCCCCCCHHHHHHHHHHHH------------CCC---CEEEEECCCCCCCCHHHHHH
T ss_conf             ---------------------788888714769999999997------------799---99999247777530355541


Q ss_pred             CCCEEEEEECCCCHH
Q ss_conf             172479982587868
Q gi|254780270|r  499 MDRMEIIRIAGYTEE  513 (820)
Q Consensus       499 ~drme~i~~~~y~~~  513 (820)
                      -|-+=++.+||.-.+
T Consensus       143 aD~~llv~~Pg~GDe  157 (267)
T pfam03308       143 ADTFVLVTIPGGGDD  157 (267)
T ss_pred             CCEEEEEECCCCCHH
T ss_conf             576899955887608


No 304
>pfam03969 AFG1_ATPase AFG1-like ATPase. This family of proteins contains a P-loop motif and are predicted to be ATPases.
Probab=96.15  E-value=0.051  Score=34.12  Aligned_cols=176  Identities=22%  Similarity=0.285  Sum_probs=93.6

Q ss_pred             HHHHHHHHCCCC-CCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHCHHH
Q ss_conf             789998522247-8857888889999999875311025789999987654041587663221068899877665201168
Q gi|254780270|r  268 ISDFEARISKIR-LSKEAREKALSELQKLRQMNPLSAESSVVRNYLDWLLGVPWDKKSKTKKNLDFAIRILDQDHFGLEK  346 (820)
Q Consensus       268 i~el~~Ki~~~~-lp~e~~~~~~kEl~rL~~m~~~s~E~~v~r~Yld~~~~lPW~~~t~~~~dl~~a~~iLd~~hyGl~~  346 (820)
                      ++.|..+++... -++.++..+.+++++|..-               +.. -++...+.-      .++           
T Consensus         4 ~~~Y~~~v~~g~l~~D~~Q~~a~~~L~~L~~~---------------l~~-~~~~~~~~~------~~~-----------   50 (361)
T pfam03969         4 PQRYTAQLQRGAIFPDVAQANAVPALDRLYQR---------------LQA-ADFVRQSGA------GGK-----------   50 (361)
T ss_pred             HHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHH---------------HHH-CCCCCCCCH------HHH-----------
T ss_conf             99999998679999998999999999999999---------------971-556555523------444-----------


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC-CEEEEE----CCCCCCH-HHHCCCCCCCCCCCC
Q ss_conf             9999999999998424446735998605656502799999977088-249986----1888888-883563200145671
Q gi|254780270|r  347 VKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGR-QYVRMS----LGGVYDE-ADIRGHRRTYIGSMP  420 (820)
Q Consensus       347 vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r-~f~~is----lgg~~d~-~~i~gh~~ty~ga~p  420 (820)
                              + ..+........-|-+.|+.|.|||-|--..-.++.- .=-|+.    +-.+|++ ..++|.      .-|
T Consensus        51 --------~-~~~~~~~~~~kGlYl~G~VGrGKTmLMDlFy~~lp~~~K~R~HFh~FM~~vH~~l~~~~~~------~dp  115 (361)
T pfam03969        51 --------L-WGRKRSHQPVRGLYLWGGVGRGKTHLMDSFFESLPGERKRRTHFHRFMFRVHDELTTLQGG------DDP  115 (361)
T ss_pred             --------H-HCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHCC------CCC
T ss_conf             --------3-1578879999868988998886999999999867753444566789999999999997667------763


Q ss_pred             HHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCC-C------
Q ss_conf             289999983278873999933155423117711556655406001681332010352364427999934865-5------
Q gi|254780270|r  421 GRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTL-N------  493 (820)
Q Consensus       421 g~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~-~------  493 (820)
                        |-...++--..-.|+.|||.-      --|++.||+=       ..+-+.+    |+ ..|..|+|.|.. +      
T Consensus       116 --l~~va~~l~~~~~lLCfDEFq------V~DIaDAMIL-------~rLf~~L----f~-~gvvlV~TSN~~P~~LY~~G  175 (361)
T pfam03969       116 --LPIAADRFANEARLLCFDEFE------VDDIGDAMIL-------GRLFEAL----FA-RGVSLVATSNTAPEQLYRNG  175 (361)
T ss_pred             --HHHHHHHHHHCCCEEEEEEEE------ECCHHHHHHH-------HHHHHHH----HH-CCCEEEEECCCCHHHHHCCC
T ss_conf             --899999997258779976356------1678889999-------9999999----97-79789980899989983687


Q ss_pred             ------CCH--HHCCCEEEEEECCCC
Q ss_conf             ------441--311724799825878
Q gi|254780270|r  494 ------IPL--PLMDRMEIIRIAGYT  511 (820)
Q Consensus       494 ------i~~--~l~drme~i~~~~y~  511 (820)
                            +|.  -|.++++|+++.|-+
T Consensus       176 LqR~~FlPfI~ll~~~~~v~~l~~~~  201 (361)
T pfam03969       176 LNRQRFLPAIDLLESHFEVVRVDGPV  201 (361)
T ss_pred             CCHHHHHHHHHHHHHHCEEEEECCCC
T ss_conf             41778899999999867899815987


No 305
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport.  These families are characterised by the fact that the ABC subunit is made up of duplicated, fused ABC modules (ABC2).  No known transmembrane proteins or domains are associated with these proteins.
Probab=96.12  E-value=0.013  Score=38.64  Aligned_cols=91  Identities=29%  Similarity=0.349  Sum_probs=48.4

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHCC-----------------CEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHH
Q ss_conf             6735998605656502799999977088-----------------24998618888888835632001456712899999
Q gi|254780270|r  365 KGLILCFVGPPGVGKTSLAQSIAKATGR-----------------QYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSL  427 (820)
Q Consensus       365 ~g~il~l~gppgvGKts~~~sia~al~r-----------------~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l  427 (820)
                      +|.++.+.||-|-|||++-|+|+-++.-                 ++..+......+  .+-|..+.     --++...+
T Consensus        20 ~g~~~iItGpN~sGKSt~Lr~i~l~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~lSgg~~~-----~~~l~~~l   92 (162)
T cd03227          20 EGSLTIITGPNGSGKSTILDAIGLALGGAQSATRRRSGVKAGCIVAAVSAELIFTRL--QLSGGEKE-----LSALALIL   92 (162)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHHCCCCCHHHEEEEEECCC--CCCCCHHH-----HHHHHHHH
T ss_conf             986899989987757999999999999863267752555427764023057664120--00542999-----99999999


Q ss_pred             HHCCC-CCEEEEEECHHHHHHHCCC-CHHHHHHHHCC
Q ss_conf             83278-8739999331554231177-11556655406
Q gi|254780270|r  428 KRAKR-SNPLLLLDEIDKMGSDLRG-DPSAALLEVLD  462 (820)
Q Consensus       428 ~~~~~-~npv~~ldeidk~~~~~~g-dp~~allevld  462 (820)
                      ..+.. ..++++|||+.+=.....| .-+.|++|.++
T Consensus        93 ~~~~~~~~~lillDE~~~Gtd~~~~~~l~~~i~~~~~  129 (162)
T cd03227          93 ALASLKPRPLYILDEIDRGLDPRDGQALAEAILEHLV  129 (162)
T ss_pred             HHCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             8542489848996365579998899999999999997


No 306
>PRK10646 putative ATPase; Provisional
Probab=96.11  E-value=0.0092  Score=39.75  Aligned_cols=30  Identities=27%  Similarity=0.534  Sum_probs=27.2

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCC
Q ss_conf             467359986056565027999999770882
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQ  393 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~  393 (820)
                      ..|.+++|.|+-|.|||+++|.|+++||.+
T Consensus        26 ~~g~vi~L~G~LGaGKTtf~r~i~~~lg~~   55 (153)
T PRK10646         26 DGATVIYLYGDLGAGKTTFSRGFLQALGHQ   55 (153)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHCCCC
T ss_conf             999799998888789999999999984997


No 307
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional
Probab=96.11  E-value=0.0065  Score=40.89  Aligned_cols=40  Identities=25%  Similarity=0.331  Sum_probs=32.4

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCC
Q ss_conf             4673599860565650279999997708824998618888
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVY  403 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~  403 (820)
                      ..|.++|++||-|.|||+|-|.|+-.+.-.--.|.+.|..
T Consensus        35 ~~Ge~~~l~GpNGaGKTTLlr~l~Gl~~p~~G~I~~~g~~   74 (214)
T PRK13543         35 DAGEALLVQGDNGAGKTTLLRVLAGLLHVESGQIQIDGKT   74 (214)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECCEE
T ss_conf             1898999999999879999999976977884199999999


No 308
>PTZ00088 adenylate kinase 1; Provisional
Probab=96.09  E-value=0.0089  Score=39.85  Aligned_cols=59  Identities=24%  Similarity=0.446  Sum_probs=40.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCE
Q ss_conf             59986056565027999999770882499861888888883563200145671289999983278873
Q gi|254780270|r  368 ILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNP  435 (820)
Q Consensus       368 il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~np  435 (820)
                      .|.|.||||.||++.|+-+|+-+|-++  ||.|-+     +|-+-+.  ++--|+-++.++..|-.=|
T Consensus         2 ~iillGpPGsGKgT~a~~l~~~~~~~h--iStGdl-----lR~~i~~--~t~lg~~ik~~i~~G~LVp   60 (225)
T PTZ00088          2 KIVLFGAPGVGKGTFAEILSKKEKLKH--INMGNI-----LRDEIKK--ESNIGKEIHKVVRSGNLVA   60 (225)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCEE--ECHHHH-----HHHHHHC--CCHHHHHHHHHHHCCCCCC
T ss_conf             799989999987999999999879906--878999-----9999973--9988999999997798466


No 309
>PRK00023 cmk cytidylate kinase; Provisional
Probab=96.06  E-value=0.0079  Score=40.23  Aligned_cols=32  Identities=34%  Similarity=0.613  Sum_probs=29.3

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEE
Q ss_conf             46735998605656502799999977088249
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYV  395 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~  395 (820)
                      .+.+|+..=||.|.||+|+||-+|+.||-.|.
T Consensus         2 ~~~iIIaIDGpagSGKST~ak~lA~~L~~~yl   33 (225)
T PRK00023          2 MKAPVIAIDGPAGSGKGTVAKILAKKLGFHYL   33 (225)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEE
T ss_conf             98978996589867878999999999398876


No 310
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB.  This alignment contains the C-terminal domain, which is the ATPase.
Probab=96.06  E-value=0.047  Score=34.39  Aligned_cols=100  Identities=22%  Similarity=0.345  Sum_probs=56.0

Q ss_pred             HHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCC----------CC
Q ss_conf             99999999998424446735998605656502799999977088249986188888888356320014----------56
Q gi|254780270|r  349 ERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYI----------GS  418 (820)
Q Consensus       349 ~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~----------ga  418 (820)
                      ..+.+||.-.   -..+..| +++||+|.|||++.++++..+....-.+   -+.|..|+.=+....+          +.
T Consensus        12 ~~~~~~L~~~---v~~~~nI-lIsG~tGSGKTTll~al~~~i~~~~riv---tiEd~~El~l~~~~~v~l~~~~~~~~~~   84 (186)
T cd01130          12 PLQAAYLWLA---VEARKNI-LISGGTGSGKTTLLNALLAFIPPDERII---TIEDTAELQLPHPNWVRLVTRPGNVEGS   84 (186)
T ss_pred             HHHHHHHHHH---HHCCCCE-EEECCCCCCHHHHHHHHHHHCCCCCCEE---EECCCHHHCCCCCCEEEEEEECCCCCCC
T ss_conf             9999999999---9859989-9989999989999999996133456459---8415354047777568888604645786


Q ss_pred             CCHHHHHHHHHCCCCCE-EEEEECHHHHHHHCCCCHHHHHHHHCC
Q ss_conf             71289999983278873-999933155423117711556655406
Q gi|254780270|r  419 MPGRIIQSLKRAKRSNP-LLLLDEIDKMGSDLRGDPSAALLEVLD  462 (820)
Q Consensus       419 ~pg~ii~~l~~~~~~np-v~~ldeidk~~~~~~gdp~~allevld  462 (820)
                      ..=-.-++++.+--+|| .+++.|+       ||.-+.++++...
T Consensus        85 ~~~~~~~li~~aLR~~pd~iivGEi-------R~~Ea~~~l~a~~  122 (186)
T cd01130          85 GEVTMADLLRSALRMRPDRIIVGEV-------RGGEALDLLQAMN  122 (186)
T ss_pred             CEECHHHHHHHHCCCCCCEEECCCC-------CCHHHHHHHHHHH
T ss_conf             5034999988736689973731756-------8399999999997


No 311
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only]
Probab=96.05  E-value=0.14  Score=30.70  Aligned_cols=180  Identities=22%  Similarity=0.326  Sum_probs=112.8

Q ss_pred             HHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCC
Q ss_conf             52011689999999999998424446735998605656502799999977088249986188888888356320014567
Q gi|254780270|r  340 DHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSM  419 (820)
Q Consensus       340 ~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~  419 (820)
                      +--|.+.+|+.+++-.  ........+.-.+|.|.-|+||.|+.|.+-...+-+.-|  |=-|+ -.+|        -++
T Consensus        61 ~l~Gvd~qk~~L~~NT--~~F~~G~pANnVLLwGaRGtGKSSLVKA~~~e~~~~glr--LVEV~-k~dl--------~~L  127 (287)
T COG2607          61 DLVGVDRQKEALVRNT--EQFAEGLPANNVLLWGARGTGKSSLVKALLNEYADEGLR--LVEVD-KEDL--------ATL  127 (287)
T ss_pred             HHHCCHHHHHHHHHHH--HHHHCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCE--EEEEC-HHHH--------HHH
T ss_conf             8727318999999989--999728865236776377777479999999998741770--79976-8888--------657


Q ss_pred             CHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHH-HHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHH
Q ss_conf             128999998327887399993315542311771155-66554060016813320103523644279999348655-4413
Q gi|254780270|r  420 PGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSA-ALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLP  497 (820)
Q Consensus       420 pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~-allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~  497 (820)
                      | .|+.-|+..... =+++.|.+   |-+ .||-+. +|=-+||-           ++.=-=.+|+|-+|.|--. ||+-
T Consensus       128 p-~l~~~Lr~~~~k-FIlFcDDL---SFe-~gd~~yK~LKs~LeG-----------~ve~rP~NVl~YATSNRRHLl~e~  190 (287)
T COG2607         128 P-DLVELLRARPEK-FILFCDDL---SFE-EGDDAYKALKSALEG-----------GVEGRPANVLFYATSNRRHLLPED  190 (287)
T ss_pred             H-HHHHHHHCCCCE-EEEEECCC---CCC-CCCHHHHHHHHHHCC-----------CCCCCCCEEEEEEECCCCCCCCHH
T ss_conf             9-999999618860-89995677---777-781389999998538-----------855688707999715875336276


Q ss_pred             HCCCEEEE-EE-CCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHH
Q ss_conf             11724799-82-587868999899986089899862578131322899999997317741023
Q gi|254780270|r  498 LMDRMEII-RI-AGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGV  558 (820)
Q Consensus       498 l~drme~i-~~-~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGv  558 (820)
                      ..|+.--- ++ ++=+.+||+...-+         .||.-.-...+.+.-..||.+|..-.|+
T Consensus       191 ~~dn~~~~~eih~~eaveEKlSlSDR---------FGLwL~F~~~~Q~~YL~~V~~~a~~~~l  244 (287)
T COG2607         191 MKDNEGSTGEIHPSEAVEEKLSLSDR---------FGLWLSFYPCDQDEYLKIVDHYAKHFGL  244 (287)
T ss_pred             HHHCCCCCCCCCHHHHHHHHHCHHHH---------CCEEECCCCCCHHHHHHHHHHHHHHCCC
T ss_conf             64277840235806778776254642---------3404503687889999999999998599


No 312
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK). Members of this family have been identified as one of the subunits of NADH:Ubiquinone oxioreductase (complex I), a multi-protein complex located in the inner mitochondrial membrane. The main function of the complex is to transport electrons from NADH to ubiquinone, which is accompanied by the translocation of protons from the mitochondrial matrix to the inter membrane space.
Probab=96.05  E-value=0.0052  Score=41.60  Aligned_cols=28  Identities=29%  Similarity=0.490  Sum_probs=25.5

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEE
Q ss_conf             5998605656502799999977088249
Q gi|254780270|r  368 ILCFVGPPGVGKTSLAQSIAKATGRQYV  395 (820)
Q Consensus       368 il~l~gppgvGKts~~~sia~al~r~f~  395 (820)
                      |||.-|+-|+||||+++.+|+.+|-++.
T Consensus         1 iI~IEGnIG~GKTTl~~~La~~l~~~~~   28 (219)
T cd02030           1 VITVDGNIASGKGKLAKELAEKLGMKYF   28 (219)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHCCCCC
T ss_conf             9899678567999999999998598210


No 313
>PRK05636 replicative DNA helicase; Provisional
Probab=96.03  E-value=0.12  Score=31.17  Aligned_cols=39  Identities=26%  Similarity=0.426  Sum_probs=30.2

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHH----HCCCEEEEECC
Q ss_conf             4446735998605656502799999977----08824998618
Q gi|254780270|r  362 IKNKGLILCFVGPPGVGKTSLAQSIAKA----TGRQYVRMSLG  400 (820)
Q Consensus       362 ~~~~g~il~l~gppgvGKts~~~sia~a----l~r~f~~islg  400 (820)
                      +=.+|..+-+.|-||+|||++|-.||..    -|.+...+||=
T Consensus       263 Gl~~G~LiIiAARPsmGKTalAlnia~n~A~~~g~~v~~fSLE  305 (507)
T PRK05636        263 GLRGGQMIIVAARPGVGKSTIALDFMRSASIKNNKASVIFSLE  305 (507)
T ss_pred             CCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             8883567999737878668999999999998769937997156


No 314
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]
Probab=95.98  E-value=0.0081  Score=40.15  Aligned_cols=39  Identities=31%  Similarity=0.433  Sum_probs=33.3

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             467359986056565027999999770882499861888
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGV  402 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~  402 (820)
                      .+|.+.|++||-|.|||+|-|+|+.-|.-.--.|-|.|.
T Consensus        26 ~~G~i~~iiGpNG~GKSTLLk~l~~~l~p~~G~V~l~g~   64 (258)
T COG1120          26 PKGEITGILGPNGSGKSTLLKCLAGLLKPKSGEVLLDGK   64 (258)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCC
T ss_conf             599799998998889999999986567888877999997


No 315
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway. The reaction carried out by this enzyme is a key regulatory point in CoA biosynthesis.
Probab=95.98  E-value=0.017  Score=37.65  Aligned_cols=35  Identities=23%  Similarity=0.375  Sum_probs=29.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCC-----CEEEEECCCC
Q ss_conf             5998605656502799999977088-----2499861888
Q gi|254780270|r  368 ILCFVGPPGVGKTSLAQSIAKATGR-----QYVRMSLGGV  402 (820)
Q Consensus       368 il~l~gppgvGKts~~~sia~al~r-----~f~~islgg~  402 (820)
                      ||+..|+||.|||++|+.|++.|++     ...-||+-|-
T Consensus         1 IIGIaG~sgSGKST~a~~l~~~l~~~~~~~~v~ii~~D~f   40 (220)
T cd02025           1 IIGIAGSVAVGKSTTARVLQALLSRWPDHPNVELITTDGF   40 (220)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCC
T ss_conf             9897889987799999999998600269994899978787


No 316
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes. SRP recognizes N-terminal sighnal sequences of newly synthesized polypeptides at the ribosome. The SRP-polypeptide complex is then targeted to the membrane by an interaction between SRP and its cognated receptor (SR). In mammals, SRP consists of six protein subunits and a 7SL RNA. One of these subunits is a 54 kd protein (SRP54), which is a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 is a multidomain protein that consists of an N-terminal domain, followed by a central G (GTPase) domain and a C-terminal M domain.
Probab=95.97  E-value=0.0058  Score=41.25  Aligned_cols=24  Identities=38%  Similarity=0.515  Sum_probs=18.0

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             359986056565027999999770
Q gi|254780270|r  367 LILCFVGPPGVGKTSLAQSIAKAT  390 (820)
Q Consensus       367 ~il~l~gppgvGKts~~~sia~al  390 (820)
                      +|+.|+||+||||||-.--+|.-+
T Consensus         1 ~Vi~lvGptGvGKTTTiaKLA~~~   24 (173)
T cd03115           1 TVILLVGLQGVGKTTTAAKLALYL   24 (173)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             999998999998899999999999


No 317
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis]
Probab=95.95  E-value=0.0082  Score=40.14  Aligned_cols=16  Identities=44%  Similarity=0.482  Sum_probs=9.6

Q ss_pred             CCEEEEEEEEECCCCC
Q ss_conf             9819999998048888
Q gi|254780270|r  124 EDFLEAITQVLPDPTE  139 (820)
Q Consensus       124 ~pyl~A~Ve~l~d~~~  139 (820)
                      .+|.+|+|+.++|+-.
T Consensus       291 GDf~~adve~L~DPcP  306 (1077)
T COG5192         291 GDFRMADVEVLIDPCP  306 (1077)
T ss_pred             CCCCHHHHHHCCCCCC
T ss_conf             6521100211478999


No 318
>PRK09825 idnK D-gluconate kinase; Provisional
Probab=95.94  E-value=0.01  Score=39.49  Aligned_cols=32  Identities=22%  Similarity=0.393  Sum_probs=29.2

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEE
Q ss_conf             46735998605656502799999977088249
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYV  395 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~  395 (820)
                      .+|.-+.+.|+-|.|||++|+.+|+.||-+|.
T Consensus         1 ~~~~a~VVmGVsGsGKSTvg~~LA~~L~~~fi   32 (176)
T PRK09825          1 MAGESYILMGVSGSGKSLIGSKIAALFSAKFI   32 (176)
T ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHCCCEE
T ss_conf             99857999828989989999999999598776


No 319
>PRK09361 radB DNA repair and recombination protein RadB; Provisional
Probab=95.94  E-value=0.015  Score=38.07  Aligned_cols=28  Identities=36%  Similarity=0.635  Sum_probs=23.5

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             4467359986056565027999999770
Q gi|254780270|r  363 KNKGLILCFVGPPGVGKTSLAQSIAKAT  390 (820)
Q Consensus       363 ~~~g~il~l~gppgvGKts~~~sia~al  390 (820)
                      =..|.|..++||||+|||++|-.+|.+.
T Consensus        20 i~~G~itei~G~pG~GKTtl~lq~a~~~   47 (224)
T PRK09361         20 IERGTITQIYGPPGSGKTNICIQLAVEA   47 (224)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             8888799998999985999999999999


No 320
>PRK09302 circadian clock protein KaiC; Reviewed
Probab=95.93  E-value=0.0072  Score=40.55  Aligned_cols=31  Identities=32%  Similarity=0.359  Sum_probs=23.7

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHH-HHHHHCC
Q ss_conf             444673599860565650279999-9977088
Q gi|254780270|r  362 IKNKGLILCFVGPPGVGKTSLAQS-IAKATGR  392 (820)
Q Consensus       362 ~~~~g~il~l~gppgvGKts~~~s-ia~al~r  392 (820)
                      +=.+|...++.||||+|||++|-. ++.|+.|
T Consensus       262 Gl~~GsstLi~Gp~GtGKTtla~qFl~~~a~~  293 (501)
T PRK09302        262 GFFRGSIILVSGATGTGKTLLVSKFAEAACRR  293 (501)
T ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHHHC
T ss_conf             97589469998899988899999999999865


No 321
>pfam00448 SRP54 SRP54-type protein, GTPase domain. This family includes relatives of the G-domain of the SRP54 family of proteins.
Probab=95.91  E-value=0.0065  Score=40.87  Aligned_cols=39  Identities=21%  Similarity=0.306  Sum_probs=24.2

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH---CCCEEEEECCCCCC
Q ss_conf             7359986056565027999999770---88249986188888
Q gi|254780270|r  366 GLILCFVGPPGVGKTSLAQSIAKAT---GRQYVRMSLGGVYD  404 (820)
Q Consensus       366 g~il~l~gppgvGKts~~~sia~al---~r~f~~islgg~~d  404 (820)
                      +.|++|+||+||||||-.--+|.-+   |++-.-|+.-.-|-
T Consensus         1 P~vi~lvGptGvGKTTTiaKLAa~~~~~~~~V~lit~Dt~R~   42 (196)
T pfam00448         1 PNVILLVGLQGSGKTTTIAKLAAYLKKQGKKVLLVAADTFRA   42 (196)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCH
T ss_conf             969999899999889999999999997799289997587768


No 322
>PRK04182 cytidylate kinase; Provisional
Probab=95.90  E-value=0.0092  Score=39.74  Aligned_cols=28  Identities=39%  Similarity=0.699  Sum_probs=27.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEE
Q ss_conf             5998605656502799999977088249
Q gi|254780270|r  368 ILCFVGPPGVGKTSLAQSIAKATGRQYV  395 (820)
Q Consensus       368 il~l~gppgvGKts~~~sia~al~r~f~  395 (820)
                      +||+-||+|.|||++|+-+|+-||-+|+
T Consensus         2 ~ItI~g~~GSGk~tIak~LA~~lg~~~~   29 (178)
T PRK04182          2 RITISGPPGSGKTTVARLLAEKLGLKLV   29 (178)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCEEE
T ss_conf             8999589988879999999999599387


No 323
>pfam00437 GSPII_E Type II/IV secretion system protein. This family contains both type II and type IV pathway secretion proteins from bacteria. VirB11 ATPase is a subunit of the Agrobacterium tumefaciens transfer DNA (T-DNA) transfer system, a type IV secretion pathway required for delivery of T-DNA and effector proteins to plant cells during infection.
Probab=95.89  E-value=0.044  Score=34.58  Aligned_cols=100  Identities=22%  Similarity=0.391  Sum_probs=56.4

Q ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHH--HCCCCCCCCCCCCH--HH
Q ss_conf             999999999998424446735998605656502799999977088249986188888888--35632001456712--89
Q gi|254780270|r  348 KERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEAD--IRGHRRTYIGSMPG--RI  423 (820)
Q Consensus       348 K~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~--i~gh~~ty~ga~pg--~i  423 (820)
                      -+.+.+||....   ..+| -++++||+|.|||++.+++...+..+-.||-.  +.|..|  +.+.....+.+-.+  -.
T Consensus       125 ~~~~~~~L~~~v---~~~~-~ilIsG~TGSGKTT~l~all~~i~~~~~riit--iED~~El~l~~~~~v~l~~~~~~~t~  198 (283)
T pfam00437       125 DADIAEFLRQAV---QARG-NILVSGGTGSGKTTLLYALLNEINTDDERIVT--IEDPVEIQLEGPNQVQLNTRLAGVTF  198 (283)
T ss_pred             HHHHHHHHHHHH---HCCC-EEEEECCCCCCHHHHHHHHHHHCCCCCCCEEE--ECCCCEECCCCCCEEEEEECCCCCCH
T ss_conf             599999999999---8197-59998899998899999999840877762787--33785231798878999855887699


Q ss_pred             HHHHHHCCCCCE-EEEEECHHHHHHHCCCCHHHHHHHH
Q ss_conf             999983278873-9999331554231177115566554
Q gi|254780270|r  424 IQSLKRAKRSNP-LLLLDEIDKMGSDLRGDPSAALLEV  460 (820)
Q Consensus       424 i~~l~~~~~~np-v~~ldeidk~~~~~~gdp~~allev  460 (820)
                      -++++.+--++| +|++.||       ||..+..+|..
T Consensus       199 ~~ll~~~LR~~PD~IivGEi-------R~~Ea~~~l~a  229 (283)
T pfam00437       199 ADLLRAALRQRPDRIMVGEI-------RDGETADILRA  229 (283)
T ss_pred             HHHHHHHHCCCCCEEEECCC-------CCHHHHHHHHH
T ss_conf             99999963889998975786-------99899999999


No 324
>COG2766 PrkA Putative Ser protein kinase [Signal transduction mechanisms]
Probab=95.88  E-value=0.033  Score=35.54  Aligned_cols=195  Identities=25%  Similarity=0.427  Sum_probs=109.5

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC-CEEEEECCC----CCC-------HH
Q ss_conf             652011689999999999998424446735998605656502799999977088-249986188----888-------88
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGR-QYVRMSLGG----VYD-------EA  406 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r-~f~~islgg----~~d-------~~  406 (820)
                      ++-|||++.=++|..|.+-........-.||.|.||-|-||.|++..+-+.|.+ |..+..-+|    |++       +-
T Consensus        76 ~~ffG~eesI~~~v~~~~~aa~~le~~kqiL~LlGPVggGKSsl~e~lk~~~e~~pi~~~~~~~~~sPv~e~PL~Lf~pd  155 (649)
T COG2766          76 NDFFGMEESIEQIVGYFKHAAQGLEERKQILYLLGPVGGGKSSLAERLKRLMERVPIYDLDANGKGSPVHESPLHLFPPD  155 (649)
T ss_pred             HHHCCHHHHHHHHHHHHHHHHHCCCHHHHHHEEECCCCCCHHHHHHHHHHHHHHCCCEECCCCCCCCCCCCCCCCCCCHH
T ss_conf             65416899999999987524402116665530435678766789999998765278400366667688767886047977


Q ss_pred             H-------HCCCCCCCC-CCCCHHHHHHHHH----------CCCCCEEEE------------------------EECHHH
Q ss_conf             8-------356320014-5671289999983----------278873999------------------------933155
Q gi|254780270|r  407 D-------IRGHRRTYI-GSMPGRIIQSLKR----------AKRSNPLLL------------------------LDEIDK  444 (820)
Q Consensus       407 ~-------i~gh~~ty~-ga~pg~ii~~l~~----------~~~~npv~~------------------------ldeidk  444 (820)
                      .       --|-+|-|+ |.|+---...|..          +-..+|.++                        .| |-|
T Consensus       156 ~l~~~l~~~ygi~~~~~~~~lsP~~~~rL~~E~~gdi~~~~Vv~~~~S~~r~~gIg~~eP~D~~nQD~s~L~G~Vd-i~k  234 (649)
T COG2766         156 HLADDLEHEYGIRRRRLEGDLSPWARKRLDHEYGGDIEKFAVVKLNPSILRRIGIGKTEPGDENNQDISALTGKVD-ISK  234 (649)
T ss_pred             HHHHHHHHHCCCHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEEEECCHHCCCEEEECCCCCCCCCCHHHHHCCCC-HHH
T ss_conf             7656654021624554158888778999887738740126888851122205302344899999834667604110-887


Q ss_pred             HHHHCCCCHHH------------HHH--------------HHCCCCCCCCEE-EEEC-CCCCCCCCEEEEEECCCC----
Q ss_conf             42311771155------------665--------------540600168133-2010-352364427999934865----
Q gi|254780270|r  445 MGSDLRGDPSA------------ALL--------------EVLDPAQNSSFV-DHYL-EVEYDLSDVMFIMTANTL----  492 (820)
Q Consensus       445 ~~~~~~gdp~~------------all--------------evldp~qn~~f~-d~y~-~~~~dls~v~fi~tan~~----  492 (820)
                      +..--+.||-+            .|+              .+|--+|-.+|. +.=+ -+|||   =+.++.-|..    
T Consensus       235 L~~yge~DP~Aysy~Gal~~aNrGl~ef~Em~K~~~k~L~~lLtaTQEg~~k~~~~~~~i~~d---~lIvahsNesE~q~  311 (649)
T COG2766         235 LEHYGESDPRAYSYSGALCRANRGLMEFVEMFKAPIKVLHPLLTATQEGNYKGTEGIGAIPFD---GLIVAHSNESEWQT  311 (649)
T ss_pred             HHHCCCCCCHHHCCCCHHHCCCCHHHHHHHHHHCCHHHHHHHHCCCCCCCCCCCCCCCCCCCC---CEEEEECCCHHHHH
T ss_conf             865166882231444311004421789999972749999987353423755788876765667---60784167288887


Q ss_pred             ---C-CCHHHCCCEEEEEECC---CCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHH
Q ss_conf             ---5-4413117247998258---7868999899986089899862578131322899999
Q gi|254780270|r  493 ---N-IPLPLMDRMEIIRIAG---YTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLL  546 (820)
Q Consensus       493 ---~-i~~~l~drme~i~~~~---y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~  546 (820)
                         | -..+++||.-++++|=   ++.+.|+-       -|.+.+..+..  ..+...+|+
T Consensus       312 fk~n~~nEAf~dRi~~v~vPY~L~vseE~kIY-------EKll~~s~ls~--~h~APhTL~  363 (649)
T COG2766         312 FKNNKNNEAFLDRIYKVKVPYCLRVSEEAKIY-------EKLLQNSELSD--AHCAPHTLE  363 (649)
T ss_pred             HHCCCCHHHHHHHEEEEECCEEEEECHHHHHH-------HHHHCCCCCCC--CCCCCHHHH
T ss_conf             50387348887410465455012321888999-------99825466665--665805899


No 325
>PRK11545 gntK gluconate kinase 1; Provisional
Probab=95.87  E-value=0.012  Score=38.97  Aligned_cols=33  Identities=21%  Similarity=0.454  Sum_probs=29.5

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEE
Q ss_conf             446735998605656502799999977088249
Q gi|254780270|r  363 KNKGLILCFVGPPGVGKTSLAQSIAKATGRQYV  395 (820)
Q Consensus       363 ~~~g~il~l~gppgvGKts~~~sia~al~r~f~  395 (820)
                      +....|+-+.|+-|.|||++|+.+|+.||.+|.
T Consensus         5 ~~~~~iiVVMGVsGsGKSTig~~LA~~l~~~fi   37 (177)
T PRK11545          5 NHDHHIYVLMGVSGSGKSAVASAVAHQLHAAFL   37 (177)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHCCCEE
T ss_conf             788759999847989999999999998199855


No 326
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional
Probab=95.86  E-value=0.011  Score=39.24  Aligned_cols=32  Identities=31%  Similarity=0.667  Sum_probs=29.6

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEE
Q ss_conf             46735998605656502799999977088249
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYV  395 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~  395 (820)
                      .++||+++=||-|.||+|+||-+|+.||-.|.
T Consensus       282 ~~~~IIAIDGPAgSGKSTvAK~lA~~L~~~yL  313 (512)
T PRK13477        282 KRRPIIAIDGPAGAGKSTVTRAVAKKLGLLYL  313 (512)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEE
T ss_conf             78877998678757878999999998199686


No 327
>PRK00279 adk adenylate kinase; Reviewed
Probab=95.83  E-value=0.0079  Score=40.27  Aligned_cols=55  Identities=35%  Similarity=0.540  Sum_probs=35.5

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCC
Q ss_conf             9986056565027999999770882499861888888883563200145671289999983278
Q gi|254780270|r  369 LCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKR  432 (820)
Q Consensus       369 l~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~  432 (820)
                      +.|.||||.||++.|+-||+.+|  |..||.|.+=- +++.-      ++--|+.++.++..|.
T Consensus         3 iillG~PGsGKgTqa~~la~~~~--~~~is~GdllR-~~i~~------~s~~g~~i~~~~~~G~   57 (215)
T PRK00279          3 LILLGPPGAGKGTQAKFIAEKYG--IPHISTGDMLR-AAIKA------GTELGKEAKSYMDAGE   57 (215)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHC--CEEECHHHHHH-HHHHC------CCHHHHHHHHHHHCCC
T ss_conf             99989999987999999999869--91786889999-99873------9988999999997798


No 328
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]
Probab=95.83  E-value=0.0071  Score=40.61  Aligned_cols=39  Identities=28%  Similarity=0.481  Sum_probs=33.5

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             467359986056565027999999770882499861888
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGV  402 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~  402 (820)
                      .+|.|.|++||-|+||||+-|+|+-.+...--+|.++|-
T Consensus        27 ~~Geiv~llG~NGaGKTTlLkti~Gl~~~~~G~I~~~G~   65 (237)
T COG0410          27 ERGEIVALLGRNGAGKTTLLKTIMGLVRPRSGRIIFDGE   65 (237)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECCE
T ss_conf             689889998999888899999985898788706998983


No 329
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional
Probab=95.79  E-value=0.014  Score=38.34  Aligned_cols=126  Identities=25%  Similarity=0.343  Sum_probs=61.6

Q ss_pred             EEECCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHCCCEEECCCCC---CCCCCCCHHHHHHHHHHHHH
Q ss_conf             997489972443256899999999999999998886299855742078147448888---47888730689999999998
Q gi|254780270|r  632 VIMPGKGEITITGNLKEIMKESILAASSYVRSKATTFGIIPSAFNEINIHVHVPEGA---TPKDGPSAGIAMATAIVSIM  708 (820)
Q Consensus       632 ~~~~g~g~l~lTG~lg~vmkES~~~A~s~~k~~~~~~~~~~~~~~~~diHih~p~Ga---~pKDGPSAGi~i~tal~S~~  708 (820)
                      .+|. .|++.-.|.--+++..   =|..||+.+...+.. ...+...||-..-|.+.   .|..||+.      | +..+
T Consensus       236 aVM~-~G~Ivq~GtpeeI~~~---Pa~~yV~~F~~~v~~-~~~~~a~~i~~~~~~~~~~~~~~~~~~~------a-l~~m  303 (400)
T PRK10070        236 AIMQ-NGEVVQVGTPDEILNN---PANDYVRTFFRGVDI-SQVFSAKDIARRTPNGLIRKTPGFGPRS------A-LKLL  303 (400)
T ss_pred             EEEE-CCEEEEECCHHHHHHC---CCCHHHHHHHCCCCH-HHCEEHHHHHCCCCCCEEECCCCCCHHH------H-HHHH
T ss_conf             9998-9889997288999867---998689987554778-7702398962468752131488869999------9-9999


Q ss_pred             HCCCCCCCCEEEEEEEECCEEEEECCHHHHHHHHHHCCCCEEECCHHHHHHHHHCCHHHH-CCCEEEECCCHHHHHHHHH
Q ss_conf             368887561066368503025000656899999997099699803677550776148877-0979998193999888760
Q gi|254780270|r  709 TCIPVYKNVAMTGELTLRGRVLPIGGLKEKLLAALRAGVTKVLIPEENIKDLMDIPENVK-NGLEIIPVSFMGEVLKHAL  787 (820)
Q Consensus       709 ~~~~v~~~iAmTGEitl~G~VlpiGGi~eK~laA~raGi~~viiP~~N~~d~~~ip~~~~-~~l~~~~v~~~~evl~~al  787 (820)
                      ....++.-+-....=.+.|-|.    + +.+..|...+           +.+.   +... +-..+.+-..+.|++..+.
T Consensus       304 ~~~~~~~~~vvd~~~~~~G~v~----~-~~~~~~~~~~-----------~~~~---~~~~~~~~~v~~~~~l~~~~~~~~  364 (400)
T PRK10070        304 QDEDREYGYVIERGNKFVGAVS----I-DSLKAALTQQ-----------QGLD---AALIDAPLAVDAQTPLSELLSHVG  364 (400)
T ss_pred             HHCCCCEEEEECCCCEEEEEEE----H-HHHHHHHHCC-----------CCHH---HHHHCCCCCCCCCCCHHHHHHHHH
T ss_conf             8559867999869980889988----9-9999776337-----------7636---675058842399998999999997


Q ss_pred             C
Q ss_conf             2
Q gi|254780270|r  788 L  788 (820)
Q Consensus       788 ~  788 (820)
                      .
T Consensus       365 ~  365 (400)
T PRK10070        365 Q  365 (400)
T ss_pred             H
T ss_conf             2


No 330
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism]
Probab=95.77  E-value=0.008  Score=40.20  Aligned_cols=141  Identities=21%  Similarity=0.317  Sum_probs=71.3

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHCCCEEE-EECCC------CCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEE
Q ss_conf             359986056565027999999770882499-86188------88888835632001456712899999832788739999
Q gi|254780270|r  367 LILCFVGPPGVGKTSLAQSIAKATGRQYVR-MSLGG------VYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLL  439 (820)
Q Consensus       367 ~il~l~gppgvGKts~~~sia~al~r~f~~-islgg------~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~l  439 (820)
                      |.+.|.|+||+|||+.|+..|++|.-+-.+ ++|+-      ..||+.=.-| -+|.-+.--+-.. +..+-..|-..+-
T Consensus         2 pLiIlTGyPgsGKTtfakeLak~L~~~i~~vi~l~kdy~~~i~~DEslpi~k-e~yres~~ks~~r-lldSalkn~~VIv   79 (261)
T COG4088           2 PLIILTGYPGSGKTTFAKELAKELRQEIWRVIHLEKDYLRGILWDESLPILK-EVYRESFLKSVER-LLDSALKNYLVIV   79 (261)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHHEECCCCCCHHH-HHHHHHHHHHHHH-HHHHHHCCEEEEE
T ss_conf             5699826999880178999999999720011213201454123313240379-9999999888999-9999863649997


Q ss_pred             ECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCCCCHHHCCCEEEEEECCCCHHHHHHHH
Q ss_conf             33155423117711556655406001681332010352364427999934865544131172479982587868999899
Q gi|254780270|r  440 DEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLNIPLPLMDRMEIIRIAGYTEEEKLQIA  519 (820)
Q Consensus       440 deidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~i~~~l~drme~i~~~~y~~~ek~~i~  519 (820)
                      |...=. +++|-+     |..+--+-|.+|-=-|+-.|.|+                                       
T Consensus        80 DdtNYy-ksmRrq-----L~ceak~~~tt~ciIyl~~plDt---------------------------------------  114 (261)
T COG4088          80 DDTNYY-KSMRRQ-----LACEAKERKTTWCIIYLRTPLDT---------------------------------------  114 (261)
T ss_pred             ECCCHH-HHHHHH-----HHHHHHHCCCCEEEEEECCCHHH---------------------------------------
T ss_conf             063288-899999-----99999863786599997268899---------------------------------------


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHH
Q ss_conf             98608989986257813132289999999731774102347888
Q gi|254780270|r  520 KNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFER  563 (820)
Q Consensus       520 ~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r  563 (820)
                             .++.| -.. .=-+++++++.++..|---.+-|-.++
T Consensus       115 -------c~rrN-~er-gepip~Evl~qly~RfEePn~~~rWDs  149 (261)
T COG4088         115 -------CLRRN-RER-GEPIPEEVLRQLYDRFEEPNPDRRWDS  149 (261)
T ss_pred             -------HHHHH-CCC-CCCCCHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             -------98860-247-999989999999996149997765567


No 331
>PRK05595 replicative DNA helicase; Provisional
Probab=95.75  E-value=0.19  Score=29.80  Aligned_cols=40  Identities=35%  Similarity=0.434  Sum_probs=31.7

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHH--HH--CCCEEEEECCC
Q ss_conf             444673599860565650279999997--70--88249986188
Q gi|254780270|r  362 IKNKGLILCFVGPPGVGKTSLAQSIAK--AT--GRQYVRMSLGG  401 (820)
Q Consensus       362 ~~~~g~il~l~gppgvGKts~~~sia~--al--~r~f~~islgg  401 (820)
                      +=.+|..+-+.|.||+|||++|-.||.  |+  |.+...+||==
T Consensus       197 Gl~~GdLiiiaaRP~mGKTa~alnia~~~a~~~g~~V~~fSlEM  240 (444)
T PRK05595        197 GFQKGDMILIAARPSMGKTTFALNIAEYAALREGKSVVIFSLEM  240 (444)
T ss_pred             CCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             99857779998579898079999999999986699379995889


No 332
>pfam00625 Guanylate_kin Guanylate kinase.
Probab=95.74  E-value=0.031  Score=35.80  Aligned_cols=29  Identities=21%  Similarity=0.484  Sum_probs=23.5

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHCCCEE
Q ss_conf             35998605656502799999977088249
Q gi|254780270|r  367 LILCFVGPPGVGKTSLAQSIAKATGRQYV  395 (820)
Q Consensus       367 ~il~l~gppgvGKts~~~sia~al~r~f~  395 (820)
                      ..++|+||.|+|||+|.+.+.+.+.-.|.
T Consensus         2 klivl~GPSG~GK~tl~~~L~~~~~~~~~   30 (182)
T pfam00625         2 RPIVLSGPSGVGKSHIKKALLDEYPEKFG   30 (182)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHCCCCEE
T ss_conf             86999898999999999999984866734


No 333
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional
Probab=95.74  E-value=0.064  Score=33.35  Aligned_cols=58  Identities=24%  Similarity=0.421  Sum_probs=31.3

Q ss_pred             HCHHHHHHHHHHHHHHHHHCC----CCCCCEEEEECCCCCCHHHH-HHHHHH-HHC---CCEEEEEC
Q ss_conf             011689999999999998424----44673599860565650279-999997-708---82499861
Q gi|254780270|r  342 FGLEKVKERIIEYLAVQMRVI----KNKGLILCFVGPPGVGKTSL-AQSIAK-ATG---RQYVRMSL  399 (820)
Q Consensus       342 yGl~~vK~rile~lav~~~~~----~~~g~il~l~gppgvGKts~-~~sia~-al~---r~f~~isl  399 (820)
                      ..+++.-..++..|+-+.-..    -.+|-|+.||||.|||||+- ||-=|+ +|.   ++..-|+.
T Consensus       320 ~~~~~a~~~ll~~La~~Lpv~~~d~~~~gGv~AlvGpTGvGKTTT~aKlAa~~~~~~g~~~valit~  386 (557)
T PRK12727        320 TELHRGRGLMLGLLSKRLPVAPVDPLERGGVIALVGPTGAGKTTTIAKLAQRFAAQHAPRDVALVTT  386 (557)
T ss_pred             CCHHHHHHHHHHHHHHHCCCCCCCHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             7888999999999996287777751540764787437776731179999999999739981899972


No 334
>pfam07931 CPT Chloramphenicol phosphotransferase-like protein. The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT) expressed by Streptomyces venezuelae. Chloramphenicol (Cm) is a metabolite produced by this bacterium that can inhibit ribosomal peptidyl transferase activity and therefore protein production. By transferring a phosphate group to the C-3 hydroxyl group of Cm, CPT inactivates this potentially lethal metabolite.
Probab=95.73  E-value=0.014  Score=38.32  Aligned_cols=36  Identities=19%  Similarity=0.431  Sum_probs=33.5

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             735998605656502799999977088249986188
Q gi|254780270|r  366 GLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGG  401 (820)
Q Consensus       366 g~il~l~gppgvGKts~~~sia~al~r~f~~islgg  401 (820)
                      |.||.|.|++--||||||+.|-..+..||.-+|+-.
T Consensus         1 G~II~LNG~SSsGKSsiAraLQ~~l~~p~~h~~vD~   36 (174)
T pfam07931         1 GRIILLNGGSSSGKSSIARALQDILDGPWLHFGVDA   36 (174)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEHHH
T ss_conf             919997489988879999999984747467642858


No 335
>COG1855 ATPase (PilT family) [General function prediction only]
Probab=95.73  E-value=0.013  Score=38.60  Aligned_cols=70  Identities=27%  Similarity=0.462  Sum_probs=45.8

Q ss_pred             HHHHHHHHHCCCCCCCCCCCCHHHHHHH--HHHHHHHCHHH-HHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHH
Q ss_conf             9999876540415876632210688998--77665201168-99999999999984244467359986056565027999
Q gi|254780270|r  308 VRNYLDWLLGVPWDKKSKTKKNLDFAIR--ILDQDHFGLEK-VKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQ  384 (820)
Q Consensus       308 ~r~Yld~~~~lPW~~~t~~~~dl~~a~~--iLd~~hyGl~~-vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~  384 (820)
                      +|||==.+..=||+..    +.|...|-  .+.-++|||.+ +|||+.|-         ..  -++..||||-|||+.|.
T Consensus       217 lrn~RIvIarPPfSd~----~EITavRPvvk~~ledY~L~dkl~eRL~er---------ae--GILIAG~PGaGKsTFaq  281 (604)
T COG1855         217 LRNYRIVIARPPFSDR----WEITAVRPVVKLSLEDYGLSDKLKERLEER---------AE--GILIAGAPGAGKSTFAQ  281 (604)
T ss_pred             ECCEEEEEECCCCCCC----EEEEEEEEEEEEEHHHCCCCHHHHHHHHHH---------HC--CEEEECCCCCCHHHHHH
T ss_conf             4357999945998776----289997136996055428798999998864---------16--46995699997468999


Q ss_pred             HHHHHHCC
Q ss_conf             99977088
Q gi|254780270|r  385 SIAKATGR  392 (820)
Q Consensus       385 sia~al~r  392 (820)
                      ++|+-+.+
T Consensus       282 AlAefy~~  289 (604)
T COG1855         282 ALAEFYAS  289 (604)
T ss_pred             HHHHHHHH
T ss_conf             99999986


No 336
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]
Probab=95.72  E-value=0.023  Score=36.69  Aligned_cols=130  Identities=25%  Similarity=0.394  Sum_probs=77.0

Q ss_pred             HCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCE-EEE
Q ss_conf             4244467359986056565027999999770882499861888888883563200145671289999983278873-999
Q gi|254780270|r  360 RVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNP-LLL  438 (820)
Q Consensus       360 ~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~np-v~~  438 (820)
                      ...........+.||||+|||.+++.+|.. +..|  .+..|-.+.+-       |.|.-.-+....+..+...+| ++.
T Consensus        12 ~~~~~~~~~v~~~g~~~~~~t~~~~~~a~~-~~~~--~~~~~~~~~~~-------~~~~~~~~~~~~~~~a~~~~~~ii~   81 (494)
T COG0464          12 KLGIEPPKGVLLHGPPGTGKTLLARALANE-GAEF--LSINGPEILSK-------YVGESELRLRELFEEAEKLAPSIIF   81 (494)
T ss_pred             HHCCCCCCCCCCCCCCCCCHHHHHHHHHHC-CCCC--CCCCCCHHHHH-------HCCHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             706676421000368876503665676512-5410--13565224322-------2051089999998999863976364


Q ss_pred             EECHHHHHHHCCCC-------HHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCC-CCCHH-----HCCCEEEE
Q ss_conf             93315542311771-------1556655406001681332010352364427999934865-54413-----11724799
Q gi|254780270|r  439 LDEIDKMGSDLRGD-------PSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTL-NIPLP-----LMDRMEII  505 (820)
Q Consensus       439 ldeidk~~~~~~gd-------p~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~-~i~~~-----l~drme~i  505 (820)
                      +||+|.+......+       -.+.|+...|.-.             ... |+-+...|.. .+.+.     ..||.-.+
T Consensus        82 ~d~~~~~~~~~~~~~~~~~~~v~~~l~~~~d~~~-------------~~~-v~~~~~~~~~~~~~~a~~~~~~~~~~~~~  147 (494)
T COG0464          82 IDEIDALAPKRSSDQGEVERRVVAQLLALMDGLK-------------RGQ-VIVIGATNRPDGLDPAKRRPGRFDREIEV  147 (494)
T ss_pred             ECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCC-------------CCC-EEEEECCCCCCCHHHHHHCCHHHHHHHHH
T ss_conf             0443321234444421045789998998764246-------------563-46741344532112777531376788763


Q ss_pred             EECCCCHH
Q ss_conf             82587868
Q gi|254780270|r  506 RIAGYTEE  513 (820)
Q Consensus       506 ~~~~y~~~  513 (820)
                      .++.....
T Consensus       148 ~~~~~~~~  155 (494)
T COG0464         148 NLPDEAGR  155 (494)
T ss_pred             CCCCHHCC
T ss_conf             36541014


No 337
>PRK04328 hypothetical protein; Provisional
Probab=95.71  E-value=0.017  Score=37.77  Aligned_cols=38  Identities=18%  Similarity=0.275  Sum_probs=28.6

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHH-HHHHHC--CCEEEEEC
Q ss_conf             444673599860565650279999-997708--82499861
Q gi|254780270|r  362 IKNKGLILCFVGPPGVGKTSLAQS-IAKATG--RQYVRMSL  399 (820)
Q Consensus       362 ~~~~g~il~l~gppgvGKts~~~s-ia~al~--r~f~~isl  399 (820)
                      +=.+|.+.++.||||+|||.+|-. +++.+.  .+...+|+
T Consensus        20 Glp~gs~~Lv~G~pGtGKT~la~qFl~~g~~~GE~~lyis~   60 (250)
T PRK04328         20 GIPERNVVLLSGGPGTGKSIFSQQFLWNGLQMGEPGIYVAL   60 (250)
T ss_pred             CCCCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             98799699998289999899999999999876997799997


No 338
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate. The resulting product gluconate-6-phoshate is an important precursor of gluconate metabolism. GntK acts as a dimmer composed of two identical subunits.
Probab=95.71  E-value=0.011  Score=39.23  Aligned_cols=30  Identities=23%  Similarity=0.575  Sum_probs=26.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEE
Q ss_conf             599860565650279999997708824998
Q gi|254780270|r  368 ILCFVGPPGVGKTSLAQSIAKATGRQYVRM  397 (820)
Q Consensus       368 il~l~gppgvGKts~~~sia~al~r~f~~i  397 (820)
                      ++...|+.|.|||++|+.+|+.+|-+|++=
T Consensus         1 liiv~GvsGsGKSTia~~La~~lg~~~i~~   30 (150)
T cd02021           1 IIVVMGVSGSGKSTVGKALAERLGAPFIDG   30 (150)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHCCCEECC
T ss_conf             989991899999999999999719956415


No 339
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed
Probab=95.70  E-value=0.2  Score=29.66  Aligned_cols=44  Identities=30%  Similarity=0.434  Sum_probs=28.0

Q ss_pred             HHHHHHHHHHHHHHHHHCC-CCCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             1689999999999998424-4467359986056565027999999
Q gi|254780270|r  344 LEKVKERIIEYLAVQMRVI-KNKGLILCFVGPPGVGKTSLAQSIA  387 (820)
Q Consensus       344 l~~vK~rile~lav~~~~~-~~~g~il~l~gppgvGKts~~~sia  387 (820)
                      +.++.+.|-.++.-.+... -..|.-++++|||-|||.||--.++
T Consensus       193 l~~l~~~i~~ll~~~~~g~~l~~G~~v~i~G~PN~GKSSL~N~L~  237 (445)
T PRK05291        193 LEELIAELEKLLASAKQGELLREGLKVVIAGRPNVGKSSLLNALL  237 (445)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHH
T ss_conf             999999999999998741786359869988999876899999985


No 340
>cd01394 radB RadB. The archaeal protein radB shares similarity radA, the archaeal functional homologue to the bacterial RecA. The precise function of radB is unclear.
Probab=95.67  E-value=0.027  Score=36.24  Aligned_cols=28  Identities=39%  Similarity=0.675  Sum_probs=24.0

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             4467359986056565027999999770
Q gi|254780270|r  363 KNKGLILCFVGPPGVGKTSLAQSIAKAT  390 (820)
Q Consensus       363 ~~~g~il~l~gppgvGKts~~~sia~al  390 (820)
                      =..|.|..+.|+||+|||+|+-.+|...
T Consensus        16 i~~G~it~i~G~pG~GKStl~lq~a~~~   43 (218)
T cd01394          16 VERGTVTQVYGPPGTGKTNIAIQLAVET   43 (218)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             8788799998999984999999999998


No 341
>PRK07667 uridine kinase; Provisional
Probab=95.65  E-value=0.038  Score=35.11  Aligned_cols=51  Identities=20%  Similarity=0.292  Sum_probs=37.1

Q ss_pred             HHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH---CCCEEEEECCCCCCHH
Q ss_conf             999984244467359986056565027999999770---8824998618888888
Q gi|254780270|r  355 LAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKAT---GRQYVRMSLGGVYDEA  406 (820)
Q Consensus       355 lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al---~r~f~~islgg~~d~~  406 (820)
                      |-|+.-.+..+ -|+...|+.|-|||++|..|++.|   |.++..+++-+-....
T Consensus         4 ~~~~~~~~~~r-~iIgIaG~sgSGKTTla~~L~~~l~~~~~~v~v~~~Dd~~~~~   57 (190)
T PRK07667          4 INVMKKHKENR-FILGIDGLSRSGKTTFVANLKENMKQEGIPFHIFHIDDHIVER   57 (190)
T ss_pred             HHHHHHCCCCE-EEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCH
T ss_conf             78998575986-9999779897889999999999986659837999666242658


No 342
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE).  They are clustered together phylogenetically.  MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all.  An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport.  The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.
Probab=95.65  E-value=0.012  Score=38.74  Aligned_cols=39  Identities=26%  Similarity=0.467  Sum_probs=32.4

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             467359986056565027999999770882499861888
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGV  402 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~  402 (820)
                      .+|.++++.||-|.|||++.+.|+--+.-.--.|-+.|.
T Consensus        28 ~~Ge~~~iiG~sGsGKTTll~~i~Gl~~p~~G~I~~~g~   66 (218)
T cd03255          28 EKGEFVAIVGPSGSGKSTLLNILGGLDRPTSGEVRVDGT   66 (218)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCE
T ss_conf             699899999999986999999996699999649999999


No 343
>pfam00406 ADK Adenylate kinase.
Probab=95.63  E-value=0.011  Score=39.10  Aligned_cols=56  Identities=29%  Similarity=0.541  Sum_probs=40.7

Q ss_pred             EECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCE
Q ss_conf             86056565027999999770882499861888888883563200145671289999983278873
Q gi|254780270|r  371 FVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNP  435 (820)
Q Consensus       371 l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~np  435 (820)
                      |.||||.||++.|+-+|+.+|  |+.||.|-+-- ++++      -++--|+.|+.+..+|..=|
T Consensus         1 i~G~PGsGKgTqa~~La~~~~--~~~is~GdllR-~~~~------~~s~~g~~i~~~i~~G~lvp   56 (186)
T pfam00406         1 LLGPPGAGKGTQAERIVQKYG--IVHLSTGDLLR-AEVK------SGTELGKEAKEYMDKGELVP   56 (186)
T ss_pred             CCCCCCCCHHHHHHHHHHHHC--CEEECHHHHHH-HHHH------CCCHHHHHHHHHHHCCCCCC
T ss_conf             918898985999999999859--90676999999-9986------28879999999998699543


No 344
>pfam06745 KaiC KaiC. This family represents a conserved region within bacterial and archaeal proteins, most of which are hypothetical. More than one copy is sometimes found in each protein. This family includes KaiC, which is one of the Kai proteins among which direct protein-protein association may be a critical process in the generation of circadian rhythms in cyanobacteria.
Probab=95.62  E-value=0.021  Score=37.05  Aligned_cols=39  Identities=28%  Similarity=0.392  Sum_probs=29.9

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHH-H-HH--CCCEEEEECC
Q ss_conf             44467359986056565027999999-7-70--8824998618
Q gi|254780270|r  362 IKNKGLILCFVGPPGVGKTSLAQSIA-K-AT--GRQYVRMSLG  400 (820)
Q Consensus       362 ~~~~g~il~l~gppgvGKts~~~sia-~-al--~r~f~~islg  400 (820)
                      +=.+|.+.++.||||+|||.+|...+ + |+  |.+.+.+|+.
T Consensus        15 Gi~~gs~~LI~G~pGsGKT~la~qfl~~ga~~~ge~~lYis~e   57 (231)
T pfam06745        15 GIPEGRVVLITGGPGTGKTIFGLQFLYNGALEYGEPGVYVTLE   57 (231)
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             9829969999858972599999999999998658968999813


No 345
>pfam05272 VirE Virulence-associated protein E. This family contains several bacterial virulence-associated protein E like proteins.
Probab=95.60  E-value=0.21  Score=29.40  Aligned_cols=159  Identities=17%  Similarity=0.262  Sum_probs=82.4

Q ss_pred             HHHCCCCCCCCCCCCHHHHHHHHHHHHHHCHHHHH--HHHHHH--H-HH-HHHCCCCC-CCEEEEECCCCCCHHHHHHHH
Q ss_conf             65404158766322106889987766520116899--999999--9-99-98424446-735998605656502799999
Q gi|254780270|r  314 WLLGVPWDKKSKTKKNLDFAIRILDQDHFGLEKVK--ERIIEY--L-AV-QMRVIKNK-GLILCFVGPPGVGKTSLAQSI  386 (820)
Q Consensus       314 ~~~~lPW~~~t~~~~dl~~a~~iLd~~hyGl~~vK--~rile~--l-av-~~~~~~~~-g~il~l~gppgvGKts~~~si  386 (820)
                      ||-+|+|.-..       +....| .+++|-++-.  ..+...  + || +.+.|..+ -.+++|+|+.|.||||..+.+
T Consensus         1 yl~sl~WDG~~-------Ri~~l~-~~~~g~~d~~~~~~~~~~wligaVaR~~~pG~k~d~vlvL~G~QG~gKStf~~~L   72 (198)
T pfam05272         1 YLESLEWDGIP-------RIETLF-IDYLGAEDSLYTREVSKLFLIGAVARVYEPGCKFDHVLILQGAQGSGKSTFLKKL   72 (198)
T ss_pred             CCCCCCCCCCC-------HHHHHH-HHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHH
T ss_conf             98568768811-------799999-9962999759999999999999999997789767767899889867899999997


Q ss_pred             HHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCC
Q ss_conf             97708824998618888888835632001456712899999832788739999331554231177115566554060016
Q gi|254780270|r  387 AKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQN  466 (820)
Q Consensus       387 a~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn  466 (820)
                      +.    .|+.=++....|       .         -.+..|..    +=++-|||++-++.   .| .++ +--+=..+.
T Consensus        73 ~~----~~~~d~~~~~~~-------k---------D~~~~l~~----~wi~el~El~~~~k---~~-~~~-lK~fls~~~  123 (198)
T pfam05272        73 GG----EWFTDSIRSFEG-------K---------DAYEKLQG----VWIVEIAELDGFSK---AE-VEA-IKAFITRTV  123 (198)
T ss_pred             HH----HHCCCCCCCCCC-------C---------HHHHHHHH----HHHHHHHHHHHCCH---HH-HHH-HHHHHCCHH
T ss_conf             37----751565557677-------3---------89999998----78732598751365---32-999-999845413


Q ss_pred             CCEEEEECCCCCC-CCCEEEEEECCCCC-CCHHH-CCCEEEEEECC
Q ss_conf             8133201035236-44279999348655-44131-17247998258
Q gi|254780270|r  467 SSFVDHYLEVEYD-LSDVMFIMTANTLN-IPLPL-MDRMEIIRIAG  509 (820)
Q Consensus       467 ~~f~d~y~~~~~d-ls~v~fi~tan~~~-i~~~l-~drme~i~~~~  509 (820)
                      .+|+=-|=.-+.+ --+..||.|.|..+ ...|= --|.=+|+++.
T Consensus       124 d~~R~pY~~~~~~~pR~~vfigTtN~~~~L~D~TGnRRF~pi~v~~  169 (198)
T pfam05272       124 DSFRAPYGRRAESFPRQCVFVGTTNRDEFLKDPTGNRRFWPVKVGK  169 (198)
T ss_pred             HCCHHCCCCCCEECCEEEEEEEECCCCCCCCCCCCCEEEEEEEECC
T ss_conf             1231022356400654799999638876557999981689999688


No 346
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), also known as guanylate kinase (GKase), catalyzes the reversible phosphoryl transfer from adenosine triphosphate (ATP) to guanosine monophosphate (GMP) to yield adenosine diphosphate (ADP) and guanosine diphosphate (GDP). It plays an essential role in the biosynthesis of guanosine triphosphate (GTP). This enzyme is also important for the activation of some antiviral and anticancer agents, such as acyclovir, ganciclovir, carbovir, and thiopurines.
Probab=95.60  E-value=0.013  Score=38.50  Aligned_cols=50  Identities=16%  Similarity=0.355  Sum_probs=30.4

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCC--CCHHHHCCCCCCCCC
Q ss_conf             59986056565027999999770882499861888--888883563200145
Q gi|254780270|r  368 ILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGV--YDEADIRGHRRTYIG  417 (820)
Q Consensus       368 il~l~gppgvGKts~~~sia~al~r~f~~islgg~--~d~~~i~gh~~ty~g  417 (820)
                      +++++||+|+|||+|.+-+.+.+...|.+.----.  ..+.|+.|..+-+|.
T Consensus         1 livi~GPSG~GK~tl~~~L~~~~~~~~~~~vs~TTR~~r~~E~~G~dY~Fvs   52 (137)
T cd00071           1 LIVLSGPSGVGKSTLLKRLLEEFDPNFGFSVSHTTRKPRPGEVDGVDYHFVS   52 (137)
T ss_pred             CEEEECCCCCCHHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCCCCEEEEEC
T ss_conf             9999999988999999999851987768756603789988877896789867


No 347
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea.  This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily.  The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.60  E-value=0.014  Score=38.40  Aligned_cols=38  Identities=24%  Similarity=0.447  Sum_probs=27.6

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             46735998605656502799999977088249986188
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGG  401 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg  401 (820)
                      .+|.++|++||-|.|||++.+.||--+.----+|-+.|
T Consensus        48 ~~GE~~~ivG~SGsGKSTLLr~i~GL~~p~~G~I~~~G   85 (269)
T cd03294          48 REGEIFVIMGLSGSGKSTLLRCINRLIEPTSGKVLIDG   85 (269)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECC
T ss_conf             89999999989984899999999759999975999999


No 348
>pfam01745 IPT Isopentenyl transferase. Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid.
Probab=95.59  E-value=0.034  Score=35.45  Aligned_cols=77  Identities=25%  Similarity=0.418  Sum_probs=58.5

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEE---------EEECCCCC-CHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEE
Q ss_conf             5998605656502799999977088249---------98618888-8888356320014567128999998327887399
Q gi|254780270|r  368 ILCFVGPPGVGKTSLAQSIAKATGRQYV---------RMSLGGVY-DEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLL  437 (820)
Q Consensus       368 il~l~gppgvGKts~~~sia~al~r~f~---------~islgg~~-d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~  437 (820)
                      +..++||-|+|||++|-++|+.+|-|.+         .++.|.-+ ..+|+.|.||-|....|  +.++...++..|-. 
T Consensus         3 l~~I~GpT~~GKT~~ai~lA~~~g~~iis~D~~Q~y~el~igs~rp~~~El~gT~RiYL~~R~--l~~Gii~a~eA~~~-   79 (232)
T pfam01745         3 LYLIWGATCTGKTAEAIALAKETGWPVIVLDRVQCCSQLATGSGRPLPAELQGTRRIYLDNRP--LSEGIIDAEEAHDR-   79 (232)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEECHHHHHHCCCCCCCCCCHHHHCCCCEEEECCCC--CCCCCCCHHHHHHH-
T ss_conf             689978877771699999999959977962034430011367789997996575269861673--43466488999999-


Q ss_pred             EEECHHHHHH
Q ss_conf             9933155423
Q gi|254780270|r  438 LLDEIDKMGS  447 (820)
Q Consensus       438 ~ldeidk~~~  447 (820)
                      |++|++...+
T Consensus        80 Li~~V~~~~~   89 (232)
T pfam01745        80 LIAEVTSHKD   89 (232)
T ss_pred             HHHHHHCCCC
T ss_conf             9999960466


No 349
>PRK06904 replicative DNA helicase; Validated
Probab=95.53  E-value=0.22  Score=29.37  Aligned_cols=42  Identities=19%  Similarity=0.260  Sum_probs=31.4

Q ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHH--H--HCCCEEEEECCCC
Q ss_conf             2444673599860565650279999997--7--0882499861888
Q gi|254780270|r  361 VIKNKGLILCFVGPPGVGKTSLAQSIAK--A--TGRQYVRMSLGGV  402 (820)
Q Consensus       361 ~~~~~g~il~l~gppgvGKts~~~sia~--a--l~r~f~~islgg~  402 (820)
                      .+=.+|..+-+.|-||+|||++|-.||.  |  -+++...+||==-
T Consensus       216 ~Gl~~g~LiViAaRPsmGKTa~alnia~n~A~~~~~~V~~fSLEM~  261 (472)
T PRK06904        216 AGLQPSDLIIVAARPSMGKTTFAMNLCENAAMASEKPVLVFSLEMP  261 (472)
T ss_pred             CCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             5887575799973798756899999999999955995799778799


No 350
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]
Probab=95.52  E-value=0.016  Score=37.96  Aligned_cols=47  Identities=32%  Similarity=0.434  Sum_probs=33.4

Q ss_pred             HHHHHCCC-CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             99984244-467359986056565027999999770882499861888
Q gi|254780270|r  356 AVQMRVIK-NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGV  402 (820)
Q Consensus       356 av~~~~~~-~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~  402 (820)
                      ||..++=+ .+|.++||.||-|.|||++-+.||---.----+|.++|-
T Consensus        20 al~~isl~i~~Gef~tlLGPSGcGKTTlLR~IAGfe~p~~G~I~l~g~   67 (352)
T COG3842          20 AVDDISLDIKKGEFVTLLGPSGCGKTTLLRMIAGFEQPSSGEILLDGE   67 (352)
T ss_pred             EEECCEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCE
T ss_conf             773214454488689998998888899999996777888865999999


No 351
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional
Probab=95.51  E-value=0.014  Score=38.37  Aligned_cols=39  Identities=36%  Similarity=0.517  Sum_probs=31.2

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             467359986056565027999999770882499861888
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGV  402 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~  402 (820)
                      .+|.++|++||-|.|||++.+.||--+.----.|.+.|.
T Consensus        25 ~~Ge~~~lvGpnGaGKSTLl~~i~Gl~~p~~G~I~~~G~   63 (255)
T PRK11248         25 ESGELLVVLGPSGCGKTTLLNLIAGFVPPQHGSITLDGK   63 (255)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCC
T ss_conf             699899999999846999999997599889971857996


No 352
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional
Probab=95.51  E-value=0.018  Score