HHsearch alignment for GI: 254780270 and conserved domain: pfam00519

>pfam00519 PPV_E1_C Papillomavirus helicase. This protein is a DNA helicase that is required for initiation of viral DNA replication. This protein forms a complex with the E2 protein pfam00508.
Probab=94.99  E-value=0.089  Score=32.26  Aligned_cols=45  Identities=27%  Similarity=0.366  Sum_probs=34.3

Q ss_pred             HHHHHHHHH--HCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEE
Q ss_conf             999999998--424446735998605656502799999977088249
Q gi|254780270|r  351 IIEYLAVQM--RVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYV  395 (820)
Q Consensus       351 ile~lav~~--~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~  395 (820)
T Consensus       245 fi~Fl~alk~fLkg~PKknCivi~GPPnTGKS~F~mSLi~fL~G~Vi  291 (432)
T pfam00519       245 FISFLSALKDFLKGIPKKNCLVIYGPPDTGKSMFCMSLIKFLGGKVI  291 (432)
T ss_pred             HHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCEEE
T ss_conf             99999999999648985246999899996676899999998498699