RPSBLAST alignment for GI: 254780270 and conserved domain: TIGR02653

>gnl|CDD|131701 TIGR02653, Lon_rel_chp, conserved hypothetical protein. This model describes a protein family of unknown function, about 690 residues in length, in which some members show C-terminal sequence similarity to Pfam model pfam05362, which is the Lon protease C-terminal proteolytic domain, from MEROPS family S16. However, the annotated catalytic sites of E. coli Lon protease are not conserved in members of this family. Members have a motif GP[RK][GS]TGKS, similar to the ATP-binding P-loop motif GxxGxGK[ST]. Length = 675
 Score = 70.3 bits (172), Expect = 2e-12
 Identities = 45/182 (24%), Positives = 82/182 (45%), Gaps = 5/182 (2%)

Query: 587 NENNLQDYLGVPRYKYGKI--EGEDQVGIVTGLAWTEVGG-EILTVEGVIMPGKGEITIT 643
           NE+  + ++ VP     K+   G  + G+V  +   E G   +   E  +  G G+ +++
Sbjct: 469 NESLEEFFVSVPEQGGSKLIPAGPPKPGVVYAVTQNESGKVGLYRFEVQVSAGSGKHSVS 528

Query: 644 GNLKEI-MKESILAASSYVRSKATTFGIIPSAFNEINIHVHVPEGATPKDGPSAGIAMAT 702
           G       KESI  A  Y +          + F+E + H+HV +         A +A   
Sbjct: 529 GLGSNTTAKESIRVAFDYFKGNLVRISA-SAKFSEHDYHLHVVDLHNTGPSTEASLAALI 587

Query: 703 AIVSIMTCIPVYKNVAMTGELTLRGRVLPIGGLKEKLLAALRAGVTKVLIPEENIKDLMD 762
           A+ S +   PV + + + G +T+ G + P+  L   L  A+ +G  +VLIP  + +D+  
Sbjct: 588 ALCSALLKRPVQEQMVILGSMTIGGVINPVQDLAGSLQLAMDSGAKRVLIPMSSARDIPT 647

Query: 763 IP 764
           +P
Sbjct: 648 VP 649