RPSBLAST alignment for GI: 254780270 and conserved domain: PRK10787

>gnl|CDD|182730 PRK10787, PRK10787, DNA-binding ATP-dependent protease La; Provisional. Length = 784
 Score =  947 bits (2450), Expect = 0.0
 Identities = 449/764 (58%), Positives = 586/764 (76%), Gaps = 1/764 (0%)

Query: 29  PLLPLRDIVVFPYMIVPLFVGREKSVRALDEAMNSHKKIILVTQMNSNDENPIASSVYRI 88
           P+LPLRD+VV+P+M++PLFVGREKS+R L+ AM+  KKI+LV Q  ++ + P  + ++ +
Sbjct: 12  PVLPLRDVVVYPHMVIPLFVGREKSIRCLEAAMDHDKKIMLVAQKEASTDEPGVNDLFTV 71

Query: 89  GTIVDIVQILRLPDGTVKILVEGSVRARIVEYIEREDFLEAITQVLPDPTEDPVELEALS 148
           GT+  I+Q+L+LPDGTVK+LVEG  RARI    +  +   A  + L  PT D  E E L 
Sbjct: 72  GTVASILQMLKLPDGTVKVLVEGLQRARISALSDNGEHFSAKAEYLESPTIDEREQEVLV 131

Query: 149 RSVIAEFSNYIKLNKKISPEVIGITSQIEGFSKLADVIAANLSIKVAERQKILEAVSVKE 208
           R+ I++F  YIKLNKKI PEV+   + I+  ++LAD IAA++ +K+A++Q +LE   V E
Sbjct: 132 RTAISQFEGYIKLNKKIPPEVLTSLNSIDDPARLADTIAAHMPLKLADKQSVLEMSDVNE 191

Query: 209 RLEMLLVFMESEISVLQVEKRIRSRVKRQMEKTQREYYLHEQMKAIQKELDNGEEGRDEI 268
           RLE L+  MESEI +LQVEKRIR+RVK+QMEK+QREYYL+EQMKAIQKEL   ++  DE 
Sbjct: 192 RLEYLMAMMESEIDLLQVEKRIRNRVKKQMEKSQREYYLNEQMKAIQKELGEMDDAPDEN 251

Query: 269 SDFEARISKIRLSKEAREKALSELQKLRQMNPLSAESSVVRNYLDWLLGVPWDKKSKTKK 328
              + +I   ++ KEA+EKA +ELQKL+ M+P+SAE++VVR Y+DW++ VPW+ +SK KK
Sbjct: 252 EALKRKIDAAKMPKEAKEKAEAELQKLKMMSPMSAEATVVRGYIDWMVQVPWNARSKVKK 311

Query: 329 NLDFAIRILDQDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAK 388
           +L  A  ILD DH+GLE+VK+RI+EYLAVQ RV K KG ILC VGPPGVGKTSL QSIAK
Sbjct: 312 DLRQAQEILDTDHYGLERVKDRILEYLAVQSRVNKIKGPILCLVGPPGVGKTSLGQSIAK 371

Query: 389 ATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSD 448
           ATGR+YVRM+LGGV DEA+IRGHRRTYIGSMPG++IQ + +    NPL LLDEIDKM SD
Sbjct: 372 ATGRKYVRMALGGVRDEAEIRGHRRTYIGSMPGKLIQKMAKVGVKNPLFLLDEIDKMSSD 431

Query: 449 LRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLNIPLPLMDRMEIIRIA 508
           +RGDP++ALLEVLDP QN +F DHYLEV+YDLSDVMF+ T+N++NIP PL+DRME+IR++
Sbjct: 432 MRGDPASALLEVLDPEQNVAFSDHYLEVDYDLSDVMFVATSNSMNIPAPLLDRMEVIRLS 491

Query: 509 GYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKI 568
           GYTE+EKL IAK HL+ K +  +ALK+ E  + D  ++ IIR +T EAGVRS ER + K+
Sbjct: 492 GYTEDEKLNIAKRHLLPKQIERNALKKGELTVDDSAIIGIIRYYTREAGVRSLEREISKL 551

Query: 569 ARKAVTKIVKNSDTT-VSINENNLQDYLGVPRYKYGKIEGEDQVGIVTGLAWTEVGGEIL 627
            RKAV +++ +     + IN +NL DYLGV R+ YG+ + E++VG VTGLAWTEVGG++L
Sbjct: 552 CRKAVKQLLLDKSLKHIEINGDNLHDYLGVQRFDYGRADNENRVGQVTGLAWTEVGGDLL 611

Query: 628 TVEGVIMPGKGEITITGNLKEIMKESILAASSYVRSKATTFGIIPSAFNEINIHVHVPEG 687
           T+E   +PGKG++T TG+L E+M+ESI AA + VR++A   GI P  + + +IHVHVPEG
Sbjct: 612 TIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEG 671

Query: 688 ATPKDGPSAGIAMATAIVSIMTCIPVYKNVAMTGELTLRGRVLPIGGLKEKLLAALRAGV 747
           ATPKDGPSAGIAM TA+VS +T  PV  +VAMTGE+TLRG+VLPIGGLKEKLLAA R G+
Sbjct: 672 ATPKDGPSAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGI 731

Query: 748 TKVLIPEENIKDLMDIPENVKNGLEIIPVSFMGEVLKHALLRMP 791
             VLIP EN +DL +IP+NV   L+I PV  + EVL  AL   P
Sbjct: 732 KTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEP 775