RPSBLAST alignment for GI: 254780270 and conserved domain: PRK13342

>gnl|CDD|183986 PRK13342, PRK13342, recombination factor protein RarA; Reviewed. Length = 413
 Score = 57.8 bits (141), Expect = 1e-08
 Identities = 26/88 (29%), Positives = 42/88 (47%), Gaps = 20/88 (22%)

Query: 360 RVIKNKGLI-LCFVGPPGVGKTSLAQSIAKATGRQYVRMS--LGGVYDEADIRGHRRTYI 416
           R+I+   L  +   GPPG GKT+LA+ IA AT   +  +S    GV    D+R       
Sbjct: 29  RMIEAGRLSSMILWGPPGTGKTTLARIIAGATDAPFEALSAVTSGV---KDLR------- 78

Query: 417 GSMPGRIIQSLKRAKRS--NPLLLLDEI 442
                 +I+  ++ + +    +L +DEI
Sbjct: 79  -----EVIEEARQRRSAGRRTILFIDEI 101