RPSBLAST alignment for GI: 254780270 and conserved domain: COG0465

>gnl|CDD|30813 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]. Length = 596
 Score = 39.5 bits (92), Expect = 0.004
 Identities = 39/135 (28%), Positives = 67/135 (49%), Gaps = 24/135 (17%)

Query: 323 KSKTKKNLDFAIRILDQDHFGLEKVKERIIE----------YLAVQMRVIKNKGLILCFV 372
           KSK K  L+  +++   D  G+++ KE + E          Y A+  ++ K   L    V
Sbjct: 134 KSKAKLYLEDQVKVTFADVAGVDEAKEELSELVDFLKNPKKYQALGAKIPKGVLL----V 189

Query: 373 GPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKR 432
           GPPG GKT LA+++A   G  +  +S G  + E         ++G    R+    ++AK+
Sbjct: 190 GPPGTGKTLLAKAVAGEAGVPFFSIS-GSDFVEM--------FVGVGASRVRDLFEQAKK 240

Query: 433 SNP-LLLLDEIDKMG 446
           + P ++ +DEID +G
Sbjct: 241 NAPCIIFIDEIDAVG 255