RPSBLAST alignment for GI: 254780270 and conserved domain: COG1223

>gnl|CDD|31416 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only]. Length = 368
 Score = 46.5 bits (110), Expect = 3e-05
 Identities = 54/239 (22%), Positives = 98/239 (41%), Gaps = 54/239 (22%)

Query: 303 AESSVVRNYLDWLLGVPWDKKSKTKKNLDFAIRILDQDHFGLEKVKER---IIEYLAVQM 359
           +   ++ +   ++L  P ++  +   ++         D  G E+ K +   I+EYL    
Sbjct: 91  SGGGIITSTTIFVLETPREEDREIISDITL------DDVIGQEEAKRKCRLIMEYLENPE 144

Query: 360 RVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSM 419
           R        + F GPPG GKT +A+++A       + +    +  E         ++G  
Sbjct: 145 RFGDWAPKNVLFYGPPGTGKTMMAKALANEAKVPLLLVKATELIGE---------HVGDG 195

Query: 420 PGRIIQSLKRAKRSNP-LLLLDEIDKMGSD-----LRGDPSA---ALL------------ 458
             RI +  +RA+++ P ++ +DE+D +  D     LRGD S    ALL            
Sbjct: 196 ARRIHELYERARKAAPCIVFIDELDAIALDRRYQELRGDVSEIVNALLTELDGIKENEGV 255

Query: 459 ---------EVLDPAQNSSFVDHYLEVEYDLSD---VMFIMTANTLNIPLPLMDRMEII 505
                    E+LDPA  S F +   E+E+ L +    + I+       PLP+   +  +
Sbjct: 256 VTIAATNRPELLDPAIRSRFEE---EIEFKLPNDEERLEILEYYAKKFPLPVDADLRYL 311