RPSBLAST alignment for GI: 254780270 and conserved domain: COG2802

>gnl|CDD|32634 COG2802, COG2802, Uncharacterized protein, similar to the N-terminal domain of Lon protease [General function prediction only]. Length = 221
 Score = 72.3 bits (177), Expect = 5e-13
 Identities = 42/198 (21%), Positives = 82/198 (41%), Gaps = 11/198 (5%)

Query: 29  PLLPLRDIVVFPYMIVPLFVGREKSVRALDEAMNSHKKI-ILVTQMNSNDENPIASSVYR 87
           PL PL   V+ P  ++PL +   + +  +   +   ++  +++          +   +  
Sbjct: 13  PLFPLPGAVLLPGGLLPLNIFEPRYLAMVRTCLAEGRRFGVVLIDRGREVGGGLPPELSD 72

Query: 88  IGTIVDIVQILRLPDGTVKILVEGSVRARIVEYI-EREDFLEAITQVLPDPTEDPVELEA 146
           +G +  I +   L DG   ILV G  R R++E + + + +  A     PD   DP   E 
Sbjct: 73  VGCLARITEFEELGDGRYLILVRGGQRFRVLEELADDDPYRRARVPFWPDLPSDPDGAEE 132

Query: 147 LSRSVIAEFSNYIKLNKKISPEVIGITSQIEGFSK-----LADVIAANLSIKVAERQKIL 201
           + R + A          +   + + + +  E + +     LA+ +   L    AE+Q +L
Sbjct: 133 VDRRLDALLMRAA----RAYLQRLELLADWESYERASNADLANRLYMLLPFDPAEKQALL 188

Query: 202 EAVSVKERLEMLLVFMES 219
           EA  +  R E L+  +E 
Sbjct: 189 EAPDLPTRAERLIRLLEQ 206