RPSBLAST alignment for GI: 254780270 and conserved domain: KOG0726

>gnl|CDD|35945 KOG0726, KOG0726, KOG0726, 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones]. Length = 440
 Score = 39.5 bits (92), Expect = 0.004
 Identities = 26/91 (28%), Positives = 47/91 (51%), Gaps = 12/91 (13%)

Query: 358 QMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIG 417
           +M +   KG+IL   G PG GKT LA+++A  T   ++R+    +  +         Y+G
Sbjct: 213 EMGIKPPKGVILY--GEPGTGKTLLAKAVANQTSATFLRVVGSELIQK---------YLG 261

Query: 418 SMPGRIIQSLKRAKRSNP-LLLLDEIDKMGS 447
             P  + +  + A+   P ++ +DEID +G+
Sbjct: 262 DGPKLVRELFRVAEEHAPSIVFIDEIDAIGT 292