HHsearch alignment for GI: 254780271 and conserved domain: cd03248

>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules. Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells. Subsequently, virus-infected or malignantly transformed cells can be eliminated. TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes.
Probab=93.44  E-value=0.055  Score=34.49  Aligned_cols=29  Identities=31%  Similarity=0.507  Sum_probs=23.4

Q ss_pred             CCCCC-CEEEEECCCCCHHHHHHHHHHHHC
Q ss_conf             22568-358840733217699999998718
Q gi|254780271|r  110 ELAKS-NILLVGPTGCGKTYLAQTLARIID  138 (424)
Q Consensus       110 ei~~~-NILliGPTGvGKTelAr~LAk~l~  138 (424)
T Consensus        36 ~i~~Ge~vaIvG~sGsGKSTL~~ll~gl~~   65 (226)
T cd03248          36 TLHPGEVTALVGPSGSGKSTVVALLENFYQ   65 (226)
T ss_pred             EECCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             982999999999999849999999964546