>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system. Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond. Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond. Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

Probab=93.91  E-value=0.038  Score=35.59  Aligned_cols=30  Identities=27%  Similarity=0.639  Sum_probs=23.3

Q ss_pred             CCCCCC-CEEEEECCCCCHHHHHHHHHHHHC
Q ss_conf             522568-358840733217699999998718
Q gi|254780271|r  109 VELAKS-NILLVGPTGCGKTYLAQTLARIID  138 (424)
Q Consensus       109 ~ei~~~-NILliGPTGvGKTelAr~LAk~l~  138 (424)
T Consensus        22 l~i~~Ge~~~iiGpsGsGKSTLl~~i~gl~~   52 (241)
T cd03256          22 LSINPGEFVALIGPSGAGKSTLLRCLNGLVE   52 (241)
T ss_pred             EEECCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             8999998999999998339999999974999