HHsearch alignment for GI: 254780271 and conserved domain: cd03295

>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment. ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.12  E-value=0.011  Score=39.27  Aligned_cols=30  Identities=40%  Similarity=0.795  Sum_probs=23.1

Q ss_pred             CCCCCC-EEEEECCCCCHHHHHHHHHHHHCC
Q ss_conf             225683-588407332176999999987185
Q gi|254780271|r  110 ELAKSN-ILLVGPTGCGKTYLAQTLARIIDV  139 (424)
Q Consensus       110 ei~~~N-ILliGPTGvGKTelAr~LAk~l~~  139 (424)
T Consensus        23 ~i~~Ge~~~ilGpSG~GKSTllr~i~gl~~p   53 (242)
T cd03295          23 EIAKGEFLVLIGPSGSGKTTTMKMINRLIEP   53 (242)
T ss_pred             EECCCCEEEEECCCCCHHHHHHHHHHCCCCC
T ss_conf             8869989999999995699999999759999