HHsearch alignment for GI: 254780272 and conserved domain: COG0616

>COG0616 SppA Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion].
Probab=99.48  E-value=2.8e-13  Score=104.31  Aligned_cols=163  Identities=23%  Similarity=0.231  Sum_probs=118.0

Q ss_pred             EEEECCCCCHHH-------HHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCC--CEEEEEECCCCCC
Q ss_conf             799878318989-------9999999999741157697699993687614678999999864487--3489983155665
Q gi|254780272|r   44 IVFVTGQIEDHM-------ATLICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKP--PISTFCMGQAASM  114 (216)
Q Consensus        44 iifl~g~I~~~~-------a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~glaIyD~i~~i~~--~V~Ti~~G~aaS~  114 (216)
T Consensus        63 vi~~~G~I~~~~~~~~~~~~~~~~~~l~~~~~~~~vk~vvL~inSPGG~v~as~~i~~~l~~l~~~~PV~v~v~~~AASG  142 (317)
T COG0616          63 VIHVEGAIVAGGGPLRFIGGDDIEEILRAARADPSVKAVVLRINSPGGSVVASELIARALKRLRAKKPVVVSVGGYAASG  142 (317)
T ss_pred             EEEEEEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCCCCH
T ss_conf             99745465348776344667779999999850899873899998949846899999999998753298999988732028


Q ss_pred             CCCCCCCCCCCCEEECCCHHH------HHHHHHHHH------------HHHHHH------------HHHHHHHHHHHHHH
Q ss_conf             200002467771455441566------441256666------------555412------------89999999999999
Q gi|254780272|r  115 GSLLLSAGEKGMRFALPNARI------LLHQPSGGF------------SGQASD------------IERHAQDIVKIKRR  164 (216)
Q Consensus       115 aslIl~aG~~g~R~~~pns~i------MiHqps~~~------------~G~~~d------------i~~~a~el~~~~~~  164 (216)
T Consensus       143 GY~IA~aAd--~I~a~p~si~GSIGVi~~~~~~~~l~~k~Gv~~~~~~ag~~k~~~~~~~~~t~e~~~~~q~~~~e~y~~  220 (317)
T COG0616         143 GYYIALAAD--KIVADPSSITGSIGVISGAPNFEELLEKLGVEKEVITAGEYKDILSPFRPLTEEEREILQKEIDETYDE  220 (317)
T ss_pred             HHHHHHCCC--EEEECCCCCCCCCCEEEECCCHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             999984078--798779860213501774566899998659860344232421114533336989999999999999999


Q ss_pred             HHHHHHHHCCCCHHHHHHHHCCCCCCCHHHHHHCCCCCEEECCCC
Q ss_conf             999999871999899999724585888899997588644604542
Q gi|254780272|r  165 LNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGVVDKVLMSRI  209 (216)
Q Consensus       165 l~~i~a~~Tg~~~e~i~~~~~rD~~lsa~EA~eyGliD~Ii~~~~  209 (216)
T Consensus       221 F~~~V~~~R~~~~~~~-~~~a~g~v~~g~~A~~~gLVDelg~~~~  264 (317)
T COG0616         221 FVDKVAEGRGLSDEAV-DKLATGRVWTGQQALELGLVDELGGLDD  264 (317)
T ss_pred             HHHHHHCCCCCCCHHH-HHHHCCCEECHHHHCCCCCHHHHCCHHH
T ss_conf             9999972679970156-7873576864666242444276467889