HHsearch alignment for GI: 254780272 and conserved domain: COG0825

>COG0825 AccA Acetyl-CoA carboxylase alpha subunit [Lipid metabolism].
Probab=96.64  E-value=0.0045  Score=39.86  Aligned_cols=111  Identities=24%  Similarity=0.360  Sum_probs=73.5

Q ss_pred             HCCCCCCEEEEEECCCCCHHH-------HHHHHH---HHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHH
Q ss_conf             115769769999368761467-------899999---9864487348998315566520000246777145544156644
Q gi|254780272|r   68 AENPQKEISLYINSPGGVVTA-------GMAIYD---TMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL  137 (216)
Q Consensus        68 ~~~~~k~I~l~INSpGG~v~~-------glaIyD---~i~~i~~~V~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMi  137 (216)
T Consensus       146 AekF~lPiitfIDT~GAypG~~AEErGQ~eAIA~nL~em~~LkvP~I~iVIGEGgSGGALAi~vad--~V~mle~s~ySV  223 (317)
T COG0825         146 AEKFGLPIITFIDTPGAYPGIGAEERGQSEAIARNLREMARLKVPIISIVIGEGGSGGALAIGVAD--RVLMLENSTYSV  223 (317)
T ss_pred             HHHHCCCEEEEECCCCCCCCCCHHHCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHH--HHHHHHHCEEEE
T ss_conf             998599879995089877885456506289999999998579998799996578752467765778--999988441220


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHHHHHCCCCCEEECC
Q ss_conf             1256666555412899999999999999999998719998999997245858888999975886446045
Q gi|254780272|r  138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGVVDKVLMS  207 (216)
Q Consensus       138 Hqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~~lsa~EA~eyGliD~Ii~~  207 (216)
T Consensus       224 isPEG~A----s---ILWkD---------------~~ka~-eAAe~m----kita~dL~~lgiID~II~E  266 (317)
T COG0825         224 ISPEGCA----S---ILWKD---------------ASKAK-EAAEAM----KITAHDLKELGIIDGIIPE  266 (317)
T ss_pred             CCHHHHH----H---HHHCC---------------HHHHH-HHHHHC----CCCHHHHHHCCCCCEECCC
T ss_conf             4731324----4---55258---------------32429-999982----7878889767975123468