HHsearch alignment for GI: 254780272 and conserved domain: KOG1680

>KOG1680 consensus.
Probab=97.38  E-value=0.0007  Score=44.97  Aligned_cols=140  Identities=19%  Similarity=0.226  Sum_probs=92.9

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHH-------------------HHHHHHHHHCCCCEEEEEECC
Q ss_conf             3189899999999999741157697699993687614678-------------------999999864487348998315
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAG-------------------MAIYDTMQFIKPPISTFCMGQ  110 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~g-------------------laIyD~i~~i~~~V~Ti~~G~  110 (216)
T Consensus        60 al~~~~m~eL~~A~~~~e~D~s~~viV--ltG~gksFcsG~Dl~e~~~~~~~~~~~~~~~~~~~~~~~~~KPvIaainG~  137 (290)
T KOG1680          60 ALCRATMLELAEAFKDFESDDSVGVIV--LTGSGKSFCSGADLKEMKKDEFQDVSDGIFLRVWDLVSRLKKPVIAAINGF  137 (290)
T ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCEEE--EECCCCCCCCCCCHHHHHHCCCCCCCCCCCCCHHHHHHHCCCCEEEEEECE
T ss_conf             115899999999999740467654799--976887523643789875211234454430012566652465513755036


Q ss_pred             CCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCC
Q ss_conf             5665200002467771455441566441256666---5554128999999999999999999987199989999972458
Q gi|254780272|r  111 AASMGSLLLSAGEKGMRFALPNARILLHQPSGGF---SGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD  187 (216)
Q Consensus       111 aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~---~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD  187 (216)
T Consensus       138 AlgGG~ELalmCD--irva~~~Akfg~~~~~~Gi~p~~GGT~rl--------------~r----~vG~s--~Ale~~ltg  195 (290)
T KOG1680         138 ALGGGLELALMCD--IRVAGEGAKFGFFEIRMGIIPSWGGTQRL--------------PR----IVGKS--RALEMILTG  195 (290)
T ss_pred             EECCCHHHHHHCC--EEECCCCCEECCCCCCCCCCCCCCCHHHH--------------HH----HHCHH--HHHHHHHHC
T ss_conf             6436122235313--47526777524644312776477721068--------------87----85767--899999716


Q ss_pred             CCCCHHHHHHCCCCCEEECCCCCCCC
Q ss_conf             58888999975886446045422510
Q gi|254780272|r  188 HIMSASEACDWGVVDKVLMSRIDIEE  213 (216)
Q Consensus       188 ~~lsa~EA~eyGliD~Ii~~~~e~~~  213 (216)
T Consensus       196 ~~~~AqeA~~~GlVn~Vvp~~~~l~e  221 (290)
T KOG1680         196 RRLGAQEAKKIGLVNKVVPSGDALGE  221 (290)
T ss_pred             CCCCHHHHHHCCCEEEEECCHHHHHH
T ss_conf             83647788757852475243067999