HHsearch alignment for GI: 254780272 and conserved domain: KOG1682

>KOG1682 consensus.
Probab=95.28  E-value=0.2  Score=29.47  Aligned_cols=142  Identities=18%  Similarity=0.234  Sum_probs=80.7

Q ss_pred             CEEEECCCCCH-----HHHHHHHHHHHHHHHCCCCCCEEEEEECC-C-----------------CCHHHH-----HHHHH
Q ss_conf             77998783189-----89999999999974115769769999368-7-----------------614678-----99999
Q gi|254780272|r   43 RIVFVTGQIED-----HMATLICAQLLFLEAENPQKEISLYINSP-G-----------------GVVTAG-----MAIYD   94 (216)
Q Consensus        43 Riifl~g~I~~-----~~a~~iia~Ll~L~~~~~~k~I~l~INSp-G-----------------G~v~~g-----laIyD   94 (216)
T Consensus        43 R~i~l~npKk~NtLSLaM~~~Lq~~ll---~d~d~~dlr~viita~GkifSaGH~LKELt~e~g~d~haevFqtc~dvmn  119 (287)
T KOG1682          43 REITLNNPKKLNTLSLAMMCALQDALL---KDKDNLDLRCVIITAQGKIFSAGHNLKELTNEPGSDIHAEVFQTCTDVMN  119 (287)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHH---HCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCCHHHHHHHHHHHHHHH
T ss_conf             024425843102655999999999985---12444651599993588522465457776247552078999999999999


Q ss_pred             HHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             98644873489983155665200002467771455441566441256666555412899999999999999999998719
Q gi|254780272|r   95 TMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCG  174 (216)
Q Consensus        95 ~i~~i~~~V~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg  174 (216)
T Consensus       120 ~Irn~pVPVia~VNG~AaAAGcQLVaSCD--~vVa~k~SkF~tPG~~vGlFCSTPGvA-----laRavpRkva~~ML~Tg  192 (287)
T KOG1682         120 DIRNLPVPVIAKVNGYAAAAGCQLVASCD--MVVATKNSKFSTPGAGVGLFCSTPGVA-----LARAVPRKVAAYMLMTG  192 (287)
T ss_pred             HHHCCCCCEEEEECCHHHHCCCEEEEEEE--EEEEECCCCCCCCCCCEEEEECCCCHH-----HHHHCCHHHHHHHHHHC
T ss_conf             98649986698854433421554888603--899705764458988545675685066-----76515526779998717


Q ss_pred             CCHHHHHHHHCCCCCCCHHHHHHCCCCCEEECC
Q ss_conf             998999997245858888999975886446045
Q gi|254780272|r  175 KTYEEVEKTLDRDHIMSASEACDWGVVDKVLMS  207 (216)
Q Consensus       175 ~~~e~i~~~~~rD~~lsa~EA~eyGliD~Ii~~  207 (216)
T Consensus       193 ~Pi-------------~~eeAl~sGlvskvVp~  212 (287)
T KOG1682         193 LPI-------------TGEEALISGLVSKVVPA  212 (287)
T ss_pred             CCC-------------CHHHHHHHHHHHHCCCH
T ss_conf             977-------------64999984046514778