HHsearch alignment for GI: 254780272 and conserved domain: PRK03580

>PRK03580 carnitinyl-CoA dehydratase; Provisional.
Probab=97.54  E-value=0.002  Score=42.10  Aligned_cols=142  Identities=21%  Similarity=0.243  Sum_probs=85.4

Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCCEEEEE-ECCC-------CCHHH--------------HHHHHHHHHHCCCCEEEE
Q ss_conf             8318989999999999974115769769999-3687-------61467--------------899999986448734899
Q gi|254780272|r   49 GQIEDHMATLICAQLLFLEAENPQKEISLYI-NSPG-------GVVTA--------------GMAIYDTMQFIKPPISTF  106 (216)
Q Consensus        49 g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~I-NSpG-------G~v~~--------------glaIyD~i~~i~~~V~Ti  106 (216)
T Consensus        25 NAl~~~m~~~l~~al~~~~---~d~~vrvvvltg~G~~~FcaG~Dl~~~~~~~~~~~~~~~~~~~~~~~l~~~~kPvIaa  101 (262)
T PRK03580         25 NAIDAKTSFAMGEVFLNFR---DDPELRVAIITGAGEKFFSAGWDLKAAAEGEAPDADFGPGGFAGLTEIFDLDKPVIAA  101 (262)
T ss_pred             CCCCHHHHHHHHHHHHHHH---HCCCCEEEEEECCCCCEECCCCHHHHHHCCCCCCHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             7799999999999999986---1999659999669996042671076653478643134266789999998199999999


Q ss_pred             EECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCC
Q ss_conf             83155665200002467771455441566441256666555412899999999999999999998719998999997245
Q gi|254780272|r  107 CMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR  186 (216)
Q Consensus       107 ~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~r  186 (216)
T Consensus       102 V~G~a~GgG~~LalacD--~~ia~~~a~f~~pe~~lGl~p---~~g~~~----~--------l~r~iG~--~~A~~l~lt  162 (262)
T PRK03580        102 VNGYAFGGGFELALAAD--FIVCADNASFALPEAKLGIVP---DSGGVL----R--------LPKRLPP--AIVNEMLMT  162 (262)
T ss_pred             ECCEEEEHHHHHHHHCC--EEEECCCCCEECHHHCCCCCC---CCCHHH----H--------HHHHHHH--HHHHHHHHC
T ss_conf             86866618699988527--024147876515776036788---854999----9--------9999709--999999871


Q ss_pred             CCCCCHHHHHHCCCCCEEECCCCCCCC
Q ss_conf             858888999975886446045422510
Q gi|254780272|r  187 DHIMSASEACDWGVVDKVLMSRIDIEE  213 (216)
Q Consensus       187 D~~lsa~EA~eyGliD~Ii~~~~e~~~  213 (216)
T Consensus       163 g~~~~a~eA~~~Glv~~vv~~-~~l~~  188 (262)
T PRK03580        163 GRRMDAEEALRWGLVNRVVSQ-AELMD  188 (262)
T ss_pred             CCCCCHHHHHHCCCEEEECCH-HHHHH
T ss_conf             898759999887991054384-69999