HHsearch alignment for GI: 254780272 and conserved domain: PRK05654

>PRK05654 acetyl-CoA carboxylase subunit beta; Validated.
Probab=92.91  E-value=0.64  Score=26.28  Aligned_cols=125  Identities=20%  Similarity=0.299  Sum_probs=71.4

Q ss_pred             EECCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHH----------HHHHHHHHCCCCEEEEEE-----CC
Q ss_conf             987831898999999999997411576976999936876146789----------999998644873489983-----15
Q gi|254780272|r   46 FVTGQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAGM----------AIYDTMQFIKPPISTFCM-----GQ  110 (216)
Q Consensus        46 fl~g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~gl----------aIyD~i~~i~~~V~Ti~~-----G~  110 (216)
T Consensus       135 F~GGSmG~~~GEki~~a~e~--A~~~~~PlI~~~~SGGaRMQEGi~SLmQMaKts~A~~~l~~~~lpyI~vlt~PttGGv  212 (288)
T PRK05654        135 FMGGSMGSVVGEKIVRAVER--ALEEKCPLVIFSASGGARMQEGLLSLMQMAKTSAALKRLSEAGLPYISVLTDPTTGGV  212 (288)
T ss_pred             HHCCCCCHHHHHHHHHHHHH--HHHCCCCEEEEECCCCHHHCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCE
T ss_conf             54266457899999999999--9974997899967876333274678998899999999999769968999668985894


Q ss_pred             CCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCC
Q ss_conf             56652000024677714554415664412566665554128999999999999999999987199989999972458588
Q gi|254780272|r  111 AASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIM  190 (216)
Q Consensus       111 aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~~l  190 (216)
T Consensus       213 tASfa~l----gD--iiiaEp~A~Ig-------FAG~R--------V-----------Ieqti~~~-------LP-~~FQ  252 (288)
T PRK05654        213 SASFAML----GD--IIIAEPKALIG-------FAGPR--------V-----------IEQTVREK-------LP-EGFQ  252 (288)
T ss_pred             EEEECCC----CC--EEEEECCCEEE-------ECCCH--------H-----------HHHHCCCC-------CC-CCHH
T ss_conf             4430247----87--79980584587-------31538--------9-----------99850898-------99-7401


Q ss_pred             CHHHHHHCCCCCEEECCCCCCCC
Q ss_conf             88999975886446045422510
Q gi|254780272|r  191 SASEACDWGVVDKVLMSRIDIEE  213 (216)
Q Consensus       191 sa~EA~eyGliD~Ii~~~~e~~~  213 (216)
T Consensus       253 tae~ll~~G~iD~iv~-R~~lk~  274 (288)
T PRK05654        253 RAEFLLEHGAIDMIVH-RRELRD  274 (288)
T ss_pred             HHHHHHHCCCCCEEEC-HHHHHH
T ss_conf             1899997799636645-899999