HHsearch alignment for GI: 254780272 and conserved domain: PRK05862

>PRK05862 enoyl-CoA hydratase; Provisional.
Probab=97.82  E-value=0.00038  Score=46.62  Aligned_cols=142  Identities=18%  Similarity=0.240  Sum_probs=88.7

Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCCEE-EEEECCC------CCHHH-------------HHHHHHHHHHCCCCEEEEEE
Q ss_conf             8318989999999999974115769769-9993687------61467-------------89999998644873489983
Q gi|254780272|r   49 GQIEDHMATLICAQLLFLEAENPQKEIS-LYINSPG------GVVTA-------------GMAIYDTMQFIKPPISTFCM  108 (216)
Q Consensus        49 g~I~~~~a~~iia~Ll~L~~~~~~k~I~-l~INSpG------G~v~~-------------glaIyD~i~~i~~~V~Ti~~  108 (216)
T Consensus        26 Nal~~~m~~el~~~~~~~~~d---~~vrvvvl~g~g~~FcaG~Dl~~~~~~~~~~~~~~~~~~~~~~l~~~~kPvIaav~  102 (257)
T PRK05862         26 NALNDALMDELGAALAAFDAD---EGIGAIVITGSEKAFAAGADIKEMADLSFMDVYKGDYITNWEKVARIRKPVIAAVA  102 (257)
T ss_pred             CCCCHHHHHHHHHHHHHHHHC---CCCEEEEEECCCCCEECCCCHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             898999999999999999859---99359999889983146878577435661557777799999999858999899976


Q ss_pred             CCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCC
Q ss_conf             15566520000246777145544156644125666655541289999999999999999999871999899999724585
Q gi|254780272|r  109 GQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH  188 (216)
Q Consensus       109 G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~  188 (216)
T Consensus       103 G~a~GgG~~lal~cD--~~ia~~~a~f~~p~~~~Gl~---p~~g~-~~---~l~r--------~iG~--~~a~~llltg~  163 (257)
T PRK05862        103 GYALGGGCELAMMCD--IIIAADTAKFGQPEIKLGVL---PGMGG-SQ---RLTR--------AVGK--AKAMDLCLTGR  163 (257)
T ss_pred             CEEECCHHHHHHHCC--EEECCCCCEEECHHHCCCCC---CCCCH-HH---HHHH--------HHHH--HHHHHHHHHCC
T ss_conf             886042458877345--31304786371544204668---88459-99---9999--------9879--99999998289


Q ss_pred             CCCHHHHHHCCCCCEEECCCCCCCC
Q ss_conf             8888999975886446045422510
Q gi|254780272|r  189 IMSASEACDWGVVDKVLMSRIDIEE  213 (216)
Q Consensus       189 ~lsa~EA~eyGliD~Ii~~~~e~~~  213 (216)
T Consensus       164 ~~~a~ea~~~Glv~~v~~~-~~l~~  187 (257)
T PRK05862        164 MMDAAEAERAGLVSRVVPA-DKLLD  187 (257)
T ss_pred             CCCHHHHHHCCCCEEECCH-HHHHH
T ss_conf             9869999987991476384-58999