HHsearch alignment for GI: 254780272 and conserved domain: PRK05864

>PRK05864 enoyl-CoA hydratase; Provisional.
Probab=97.37  E-value=0.0018  Score=42.43  Aligned_cols=137  Identities=14%  Similarity=0.141  Sum_probs=83.0

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEEEEEC-C------CCCHHH----------------------HHHHHHHHHHCC
Q ss_conf             31898999999999997411576976999936-8------761467----------------------899999986448
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISLYINS-P------GGVVTA----------------------GMAIYDTMQFIK  100 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INS-p------GG~v~~----------------------glaIyD~i~~i~  100 (216)
T Consensus        26 Al~~~m~~el~~a~~~~~~---d~~vrvvVltG~G~~FcaG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~  102 (269)
T PRK05864         26 SMAFDVMVPLKEALAEVSY---DNSVRVVVLTGAGRGFSSGADHKSAGSVPHVEGLTRPTYALRSMELLDDVILALRRLH  102 (269)
T ss_pred             CCCHHHHHHHHHHHHHHHH---CCCEEEEEEECCCCCCCCCCCHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             9899999999999998864---8992799997899981468565650454333444235678889999999999998589


Q ss_pred             CCEEEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHH
Q ss_conf             73489983155665200002467771455441566441256666555412899999999999999999998719998999
Q gi|254780272|r  101 PPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV  180 (216)
Q Consensus       101 ~~V~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i  180 (216)
T Consensus       103 kPvIaaV~G~a~GgG~~lal~cD--~ria~~~A~f~~~~~~~Gl~~--~~~G~-~~~L-----------~r~vG~--~~A  164 (269)
T PRK05864        103 QPVIAAVNGPAIGGGLCLALAAD--IRVASSSAYFRAAGINNGLTA--SELGL-SYLL-----------PRAIGS--SRA  164 (269)
T ss_pred             CCEEEEECCEEEECCHHHHHCCC--EEEECCCCEEECCCCCEEECC--CCHHH-HHHH-----------HHHHHH--HHH
T ss_conf             98899973857646357764177--024358868955644741257--84127-7888-----------998689--999


Q ss_pred             HHHHCCCCCCCHHHHHHCCCCCEEECC
Q ss_conf             997245858888999975886446045
Q gi|254780272|r  181 EKTLDRDHIMSASEACDWGVVDKVLMS  207 (216)
Q Consensus       181 ~~~~~rD~~lsa~EA~eyGliD~Ii~~  207 (216)
T Consensus       165 ~el~ltg~~i~A~eA~~~Glv~~vv~~  191 (269)
T PRK05864        165 FEIMLTGRDVDAEEAERIGLVSRQVPD  191 (269)
T ss_pred             HHHHHHCCCCCHHHHHHCCCCCEEECC
T ss_conf             999981991279999977973368871