HHsearch alignment for GI: 254780272 and conserved domain: PRK06144

>PRK06144 enoyl-CoA hydratase; Provisional.
Probab=97.69  E-value=0.00054  Score=45.69  Aligned_cols=142  Identities=17%  Similarity=0.233  Sum_probs=86.3

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEE-EEECCCC-------CHHH----------------HHHHHHHHHHCCCCEEE
Q ss_conf             3189899999999999741157697699-9936876-------1467----------------89999998644873489
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISL-YINSPGG-------VVTA----------------GMAIYDTMQFIKPPIST  105 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l-~INSpGG-------~v~~----------------glaIyD~i~~i~~~V~T  105 (216)
T Consensus        31 al~~~m~~el~~~l~~~~~---d~~vr~vVl~gag~~~F~aG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~kPvIa  107 (262)
T PRK06144         31 AMTWAMYEGLAAICEEIAA---DPSIRAVVLRGAGDKAFVAGTDIAQFRAFSTAEDAVAYERRIDRVLGALEQLRVPTIA  107 (262)
T ss_pred             CCCHHHHHHHHHHHHHHHH---CCCCEEEEEECCCCCCEECCCCHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             9999999999999999863---8991499995799862534765787614577045789999999999999958998899


Q ss_pred             EEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHC
Q ss_conf             98315566520000246777145544156644125666655541289999999999999999999871999899999724
Q gi|254780272|r  106 FCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD  185 (216)
Q Consensus       106 i~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~  185 (216)
T Consensus       108 av~G~a~GgG~~lal~cD--~~ias~~a~f~~p~~~--~lG~~~~~~~----~~~--------l~~~iG~~--~A~~l~l  169 (262)
T PRK06144        108 AIAGACVGGGAAIAAACD--LRIATPSARFGFPIAR--TLGNCLSMSN----LAR--------LVALLGAA--RVKDMLF  169 (262)
T ss_pred             EECCEEEECCCEEHHCCC--EEEECCCCEEECCEEE--ECCCCCCHHH----HHH--------HHHHHCHH--HHHHHHH
T ss_conf             975878607222011077--7677899789754345--1477777148----999--------99986899--9999975


Q ss_pred             CCCCCCHHHHHHCCCCCEEECCCCCCCC
Q ss_conf             5858888999975886446045422510
Q gi|254780272|r  186 RDHIMSASEACDWGVVDKVLMSRIDIEE  213 (216)
Q Consensus       186 rD~~lsa~EA~eyGliD~Ii~~~~e~~~  213 (216)
T Consensus       170 tg~~~~a~eA~~~Glv~~vv~~-~~l~~  196 (262)
T PRK06144        170 TARLLEAEEALAAGLLNEVVPD-AALDA  196 (262)
T ss_pred             CCCEECHHHHHHCCCHHHCCCH-HHHHH
T ss_conf             0887079999977984612490-68999