HHsearch alignment for GI: 254780272 and conserved domain: PRK07110

>PRK07110 polyketide biosynthesis enoyl-CoA hydratase; Validated.
Probab=97.72  E-value=0.00059  Score=45.44  Aligned_cols=142  Identities=13%  Similarity=0.096  Sum_probs=86.2

Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCCEEEEE-ECCCCCHHHH---------------------------HHHHHHHHHCC
Q ss_conf             8318989999999999974115769769999-3687614678---------------------------99999986448
Q gi|254780272|r   49 GQIEDHMATLICAQLLFLEAENPQKEISLYI-NSPGGVVTAG---------------------------MAIYDTMQFIK  100 (216)
Q Consensus        49 g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~I-NSpGG~v~~g---------------------------laIyD~i~~i~  100 (216)
T Consensus        26 Nal~~~m~~~l~~al~~~~~---d~~vrvvVltg~g~~FcaG~D~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  102 (257)
T PRK07110         26 NAFSDELVRQLHGAFDTIAQ---DPRCKVVILTGYPNYFATGGTQEGLLSLSEGKGTFTDYKTNIEHEYANLYSLALNCP  102 (257)
T ss_pred             CCCCHHHHHHHHHHHHHHHH---CCCCEEEEEECCCCCCCCCCCHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99899999999999999976---899169999889986525666788875441553114678889999999999998199


Q ss_pred             CCEEEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHH
Q ss_conf             73489983155665200002467771455441566441256666555412899999999999999999998719998999
Q gi|254780272|r  101 PPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV  180 (216)
Q Consensus       101 ~~V~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i  180 (216)
T Consensus       103 kPvIaavnG~a~GgG~~lal~cD--~ria~~~a~f~~pe~~lGl~p---~~g~----~~~l~~~--------vG~--~~a  163 (257)
T PRK07110        103 IPVIAAMQGHAIGGGFVMGLYAD--FVVLSEESVYTTNFMKYGFTP---GMGA----TAILPEK--------LGY--YLG  163 (257)
T ss_pred             CCEEEEECCHHHHHHHHHHHCCC--EEEECCCCEEECCCCCCCCCC---CCCH----HHHHHHH--------HHH--HHH
T ss_conf             98999978788577689973268--789869977977500567597---7439----9999998--------669--999


Q ss_pred             HHHHCCCCCCCHHHHHHCCCCCEEECCCCCCCC
Q ss_conf             997245858888999975886446045422510
Q gi|254780272|r  181 EKTLDRDHIMSASEACDWGVVDKVLMSRIDIEE  213 (216)
Q Consensus       181 ~~~~~rD~~lsa~EA~eyGliD~Ii~~~~e~~~  213 (216)
T Consensus       164 ~~llltg~~i~a~eA~~~Glv~~vvp~-~~l~~  195 (257)
T PRK07110        164 QEMLLTARSYRGAELQKRGVPFPVLPR-AEVLE  195 (257)
T ss_pred             HHHHHCCCCCCHHHHHHCCCCCEEECH-HHHHH
T ss_conf             999984997689999974987467786-38999