HHsearch alignment for GI: 254780272 and conserved domain: PRK07468

>PRK07468 enoyl-CoA hydratase; Provisional.
Probab=97.70  E-value=0.00042  Score=46.38  Aligned_cols=139  Identities=17%  Similarity=0.256  Sum_probs=88.1

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEEEE-ECC------CCCHHH------------------HHHHHHHHHHCCCCEE
Q ss_conf             318989999999999974115769769999-368------761467------------------8999999864487348
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISLYI-NSP------GGVVTA------------------GMAIYDTMQFIKPPIS  104 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l~I-NSp------GG~v~~------------------glaIyD~i~~i~~~V~  104 (216)
T Consensus        28 Al~~~m~~el~~a~~~~~~d---~~vr~vvltg~G~~FcaG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~kPvI  104 (262)
T PRK07468         28 ALSARMIAELTTAALRLAAD---AAVRVVVLTGAGKSFCAGGDLGWMREQMNADRATRIEEARKLALMLKALNDLPKPLI  104 (262)
T ss_pred             CCCHHHHHHHHHHHHHHHHC---CCCEEEEEECCCCCEECCCCHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCCCCEE
T ss_conf             98999999999999998658---991699997899860478877877641136766777888799999999984899899


Q ss_pred             EEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             99831556652000024677714554415664412566665554128999999999999999999987199989999972
Q gi|254780272|r  105 TFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTL  184 (216)
Q Consensus       105 Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~  184 (216)
T Consensus       105 aav~G~a~GgG~~lal~~D--~~ia~~~a~f~~pe~~~Gl~p~~--~~--~~~l~r------------iG--~~~A~ell  164 (262)
T PRK07468        105 GRIQGQAFGGGVGLISVCD--VAIGVSGARFGLTETRLGLIPAT--IG--PYVVAR------------MG--EANARRVF  164 (262)
T ss_pred             EEECCEEEECCCEEECCCC--EEEECCCCCCCCHHHHCCCCCCC--CH--HHHHHH------------HH--HHHHHHHH
T ss_conf             9974767555540204576--78973787544475305567784--38--899988------------62--99999998


Q ss_pred             CCCCCCCHHHHHHCCCCCEEECCCCCCC
Q ss_conf             4585888899997588644604542251
Q gi|254780272|r  185 DRDHIMSASEACDWGVVDKVLMSRIDIE  212 (216)
Q Consensus       185 ~rD~~lsa~EA~eyGliD~Ii~~~~e~~  212 (216)
T Consensus       165 ltg~~i~a~eA~~~GlV~~vv~~-~~l~  191 (262)
T PRK07468        165 MSARLFDAEEAVRLGLLARVVPA-ERLD  191 (262)
T ss_pred             HCCCCCCHHHHHHCCCCCEEECH-HHHH
T ss_conf             50882579999976987165288-7999