HHsearch alignment for GI: 254780272 and conserved domain: PRK07510

>PRK07510 consensus.
Probab=97.95  E-value=6.6e-05  Score=51.44  Aligned_cols=143  Identities=20%  Similarity=0.279  Sum_probs=87.5

Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCCEEEE-EECCCCCHHHHH---------------------------HHHHHHHHCC
Q ss_conf             831898999999999997411576976999-936876146789---------------------------9999986448
Q gi|254780272|r   49 GQIEDHMATLICAQLLFLEAENPQKEISLY-INSPGGVVTAGM---------------------------AIYDTMQFIK  100 (216)
Q Consensus        49 g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~-INSpGG~v~~gl---------------------------aIyD~i~~i~  100 (216)
T Consensus        27 NAl~~~m~~el~~~~~~~~---~d~~vr~vvltg~g~~FcaG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~  103 (266)
T PRK07510         27 NALNDDLTRALVEAARRAA---DDPEVRAVLLTGAGGAFCAGGDVKSMAAARAAPPFEGAQRVANLRRRMEVSRLLHQMP  103 (266)
T ss_pred             CCCCHHHHHHHHHHHHHHH---HCCCCEEEEEECCCCCCCCCCCHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             9989999999999999986---4899459999789986055657898861447776327789999999999999998399


Q ss_pred             CCEEEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHH
Q ss_conf             73489983155665200002467771455441566441256666555412899999999999999999998719998999
Q gi|254780272|r  101 PPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV  180 (216)
Q Consensus       101 ~~V~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i  180 (216)
T Consensus       104 kPvIaav~G~a~GgG~~la~~cD--~rias~~a~f~~~~~~~Gl~p~~g~~~----~l~---r~--------iG~--~~a  164 (266)
T PRK07510        104 KPTVAQIDGAAAGAGLSLALACD--LRVAGASAKLTTAFAKVGLSGDFGGTY----FLT---RL--------VGP--AKA  164 (266)
T ss_pred             CCEEEEECCEEEEHHHHHHHCCC--CHHCCCCCEEECCCCCEECCCCCCHHH----HHH---HH--------HHH--HHH
T ss_conf             98899987977642256765046--010154437845765430288634899----999---99--------629--999


Q ss_pred             HHHHCCCCCCCHHHHHHCCCCCEEECCCCCCCCC
Q ss_conf             9972458588889999758864460454225101
Q gi|254780272|r  181 EKTLDRDHIMSASEACDWGVVDKVLMSRIDIEEK  214 (216)
Q Consensus       181 ~~~~~rD~~lsa~EA~eyGliD~Ii~~~~e~~~~  214 (216)
T Consensus       165 ~~llltg~~~~a~eA~~~Glv~~vv~~-~~l~~~  197 (266)
T PRK07510        165 RELYLTSPVLSAAEALALGLVNRVVPD-AEVEAE  197 (266)
T ss_pred             HHHHHHCCCCCHHHHHHCCCCCEEECH-HHHHHH
T ss_conf             999982999479999977975434585-799999