HHsearch alignment for GI: 254780272 and conserved domain: PRK07827

>PRK07827 enoyl-CoA hydratase; Provisional.
Probab=97.44  E-value=0.0042  Score=40.07  Aligned_cols=134  Identities=16%  Similarity=0.162  Sum_probs=81.6

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEEEE-ECC------CCCHHH----------------HHHHHHHHHHCCCCEEEE
Q ss_conf             318989999999999974115769769999-368------761467----------------899999986448734899
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISLYI-NSP------GGVVTA----------------GMAIYDTMQFIKPPISTF  106 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l~I-NSp------GG~v~~----------------glaIyD~i~~i~~~V~Ti  106 (216)
T Consensus        26 al~~~m~~eL~~~~~~~~~---d~~vrvivltg~G~~FcaG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~kPvIaa  102 (255)
T PRK07827         26 ALSTALVSQLHDGLTDAAA---DPGVRAVVLTHTGGTFCAGADLSEAGGGDPYDMAVDRAREMTALLRAIVELPKPVIAA  102 (255)
T ss_pred             CCCHHHHHHHHHHHHHHHH---CCCCEEEEEECCCCCCCCCCCCHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             9899999999999999975---8995599997799874478860543237814457888999999999999689988999


Q ss_pred             EECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCC
Q ss_conf             83155665200002467771455441566441256666555412899999999999999999998719998999997245
Q gi|254780272|r  107 CMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR  186 (216)
Q Consensus       107 ~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~r  186 (216)
T Consensus       103 v~G~a~GgG~~la~~cD--~~ia~~~a~f~~pe~~lGl~p---~~g~-~~~l~r----lg~----------~~a~~l~lt  162 (255)
T PRK07827        103 IDGHVRAGGLGLVGACD--IAVAGPGSTFALTEARIGVAP---AIIS-LTLLPK----LSP----------RAAARYYLT  162 (255)
T ss_pred             ECCEEEECCHHHHHCCC--EEECCCCCEEECCCCCCCCCC---CCCH-HHHHHH----HHH----------HHHHHHHHC
T ss_conf             77867634046655165--541489985505001562588---7539-999999----999----------999988610


Q ss_pred             CCCCCHHHHHHCCCCCEEEC
Q ss_conf             85888899997588644604
Q gi|254780272|r  187 DHIMSASEACDWGVVDKVLM  206 (216)
Q Consensus       187 D~~lsa~EA~eyGliD~Ii~  206 (216)
T Consensus       163 g~~~~a~eA~~~Glv~~~~e  182 (255)
T PRK07827        163 GEKFGAAEAARIGLVTVAAD  182 (255)
T ss_pred             CCCCCHHHHHHCCCEEEECC
T ss_conf             88278999998799245665