HHsearch alignment for GI: 254780272 and conserved domain: PRK08138

>PRK08138 enoyl-CoA hydratase; Provisional.
Probab=97.82  E-value=0.00034  Score=46.98  Aligned_cols=138  Identities=15%  Similarity=0.174  Sum_probs=86.1

Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCCEEEEE-ECC------CCCHHH-------------HHHHHHHHHHCCCCEEEEEE
Q ss_conf             8318989999999999974115769769999-368------761467-------------89999998644873489983
Q gi|254780272|r   49 GQIEDHMATLICAQLLFLEAENPQKEISLYI-NSP------GGVVTA-------------GMAIYDTMQFIKPPISTFCM  108 (216)
Q Consensus        49 g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~I-NSp------GG~v~~-------------glaIyD~i~~i~~~V~Ti~~  108 (216)
T Consensus        29 Nal~~~m~~el~~al~~~~~---d~~vr~vVltg~g~~FcaG~Dl~~~~~~~~~~~~~~~~~~~~~~i~~~~kPvIaaV~  105 (260)
T PRK08138         29 NALNMEVRQQLAEHFTSLSE---DPDIRVIVLTGGGTVFAAGADLKEFATAGAIELYLRHTERYWEAIAQCPKPVIAAVN  105 (260)
T ss_pred             CCCCHHHHHHHHHHHHHHHH---CCCCEEEEEECCCCCEECCCCHHHHHCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             99899999999999999976---899669999789987646878888844584678999999999999838998999978


Q ss_pred             CCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCC
Q ss_conf             15566520000246777145544156644125666655541289999999999999999999871999899999724585
Q gi|254780272|r  109 GQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH  188 (216)
Q Consensus       109 G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~  188 (216)
T Consensus       106 G~a~GgG~~lalacD--~~ia~~~a~f~~pe~~~Gl~p---~~g~~~-~l~---r--------~iG~--~~A~ellltg~  166 (260)
T PRK08138        106 GYALGGGCELAMHAD--IIVAGESASFGQPEIKVGLMP---GAGGTQ-RLV---R--------AVGK--FKAMRMALTGC  166 (260)
T ss_pred             CEEECCCHHHHHHCC--CCCCCCCCCEECCCCEECCCC---CCCHHH-HHH---H--------HHHH--HHHHHHHHCCC
T ss_conf             940333079987410--113354442446410168788---855899-999---9--------9759--99999986088


Q ss_pred             CCCHHHHHHCCCCCEEECCC
Q ss_conf             88889999758864460454
Q gi|254780272|r  189 IMSASEACDWGVVDKVLMSR  208 (216)
Q Consensus       189 ~lsa~EA~eyGliD~Ii~~~  208 (216)
T Consensus       167 ~~~a~eA~~~Glv~~vv~~~  186 (260)
T PRK08138        167 MVPAPEALAIGLVSEVVEDE  186 (260)
T ss_pred             CCCHHHHHHCCCCCEEECHH
T ss_conf             25799999869953874816