HHsearch alignment for GI: 254780272 and conserved domain: PRK10949

>PRK10949 protease 4; Provisional.
Probab=99.10  E-value=2.5e-09  Score=79.39  Aligned_cols=160  Identities=24%  Similarity=0.299  Sum_probs=106.2

Q ss_pred             EEEECCCCCHH-------HHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCC---CCEEEEEECCCCC
Q ss_conf             79987831898-------9999999999974115769769999368761467899999986448---7348998315566
Q gi|254780272|r   44 IVFVTGQIEDH-------MATLICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIK---PPISTFCMGQAAS  113 (216)
Q Consensus        44 iifl~g~I~~~-------~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~glaIyD~i~~i~---~~V~Ti~~G~aaS  113 (216)
T Consensus       330 VI~a~G~Iv~G~~~~g~ig~dt~~~~lr~a~~D~~VKAvVLRVnSPGGSa~ASE~I~~el~~lk~~gKPVVvSMG~vAAS  409 (618)
T PRK10949        330 VIFANGAIMDGEETPGNVGGDTTAAQIRDARLDPKVKAIVLRVNSPGGSVTASEVIRAELAAARAAGKPVVVSMGGMAAS  409 (618)
T ss_pred             EEEEEEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             99968768548887886655899999999730867228999985899866789999999999984499799997010156


Q ss_pred             CCCCCCCCCCCCCEEECCCHHH-------HHH---HHH--HH------HHHHHHHH-----------HHHHHHHHHHHHH
Q ss_conf             5200002467771455441566-------441---256--66------65554128-----------9999999999999
Q gi|254780272|r  114 MGSLLLSAGEKGMRFALPNARI-------LLH---QPS--GG------FSGQASDI-----------ERHAQDIVKIKRR  164 (216)
Q Consensus       114 ~aslIl~aG~~g~R~~~pns~i-------MiH---qps--~~------~~G~~~di-----------~~~a~el~~~~~~  164 (216)
T Consensus       410 GGYwIa~~Ad--~I~A~p~TITGSIGVfg~~p~~~~~l~~lGI~~D~V~t~~~a~~s~~~~l~~~~~~~~q~~i~~~Y~~  487 (618)
T PRK10949        410 GGYWISTPAN--YIVANPSTLTGSIGIFGVINTVENSLDSIGVHTDGVSTSPLADVSITKALPPEFQQMMQLSIENGYKR  487 (618)
T ss_pred             CCEEEECCCC--EEEECCCCEEEECEEEEEHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             6258851687--69988986788640477610499999964952468854567778877799999999999999999999


Q ss_pred             HHHHHHHHCCCCHHHHHHHHCCCCCCCHHHHHHCCCCCEEEC
Q ss_conf             999999871999899999724585888899997588644604
Q gi|254780272|r  165 LNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGVVDKVLM  206 (216)
Q Consensus       165 l~~i~a~~Tg~~~e~i~~~~~rD~~lsa~EA~eyGliD~Ii~  206 (216)
T Consensus       488 Fl~~Va~gR~mt~e~Vd~-iAqGRVWsG~~A~~~GLVD~LGg  528 (618)
T PRK10949        488 FITLVADARHKTPEQIDK-IAQGHVWTGQDAKANGLVDSLGD  528 (618)
T ss_pred             HHHHHHHHCCCCHHHHHH-HCCCCEEEHHHHHHCCCCCCCCC
T ss_conf             999998657999899998-64883776999998689365499