HHsearch alignment for GI: 254780272 and conserved domain: PRK11730

>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed.
Probab=96.91  E-value=0.0058  Score=39.15  Aligned_cols=132  Identities=23%  Similarity=0.306  Sum_probs=83.1

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEE-EEEECCC------CCHHH------------------HHHHHHHHHHCCCCEE
Q ss_conf             318989999999999974115769769-9993687------61467------------------8999999864487348
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEIS-LYINSPG------GVVTA------------------GMAIYDTMQFIKPPIS  104 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~-l~INSpG------G~v~~------------------glaIyD~i~~i~~~V~  104 (216)
T Consensus        30 al~~~~~~~L~~al~~~~~---d~~vr~vVltg~g~~F~AGaDl~e~~~~~~~~~~~~~~~~~~~~~~~~~ie~~~kPvI  106 (715)
T PRK11730         30 KLDRATLASLGEALDALEA---QSDLKGLLLTSAKDAFIVGADITEFLSLFAVPEEELSQWLHFANSIFNRLEDLPVPTV  106 (715)
T ss_pred             CCCHHHHHHHHHHHHHHHH---CCCCEEEEEECCCCEEEECCCHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHCCCCCEE
T ss_conf             9899999999999999850---9997599997899815727087878525468878898888888999999971999889


Q ss_pred             EEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHH
Q ss_conf             9983155665200002467771455441566441256666----555412899999999999999999998719998999
Q gi|254780272|r  105 TFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGF----SGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV  180 (216)
Q Consensus       105 Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~----~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i  180 (216)
T Consensus       107 AAI~G~AlGgGlelALacd--~Rias~~a~~g~pev~lGl~pg~Ggt~-r-------Lprl-----------iG~--~~A  163 (715)
T PRK11730        107 AAINGYALGGGCECVLATD--YRVASPTARIGLPETKLGIMPGFGGTV-R-------LPRL-----------IGA--DNA  163 (715)
T ss_pred             EEECCEEEHHHHHHHHHCC--EEEECCCCEEECCCCCCCCCCCCCHHH-H-------HHHH-----------CCH--HHH
T ss_conf             9988884279899999689--999639988978654757287984253-7-------5413-----------269--999


Q ss_pred             HHHHCCCCCCCHHHHHHCCCCCEEECC
Q ss_conf             997245858888999975886446045
Q gi|254780272|r  181 EKTLDRDHIMSASEACDWGVVDKVLMS  207 (216)
Q Consensus       181 ~~~~~rD~~lsa~EA~eyGliD~Ii~~  207 (216)
T Consensus       164 ~~l~l~G~~~~a~~A~~~GLvd~vv~~  190 (715)
T PRK11730        164 LEWIAAGKDVRAEDALKVGAVDAVVAP  190 (715)
T ss_pred             HHHHHHCCCCCHHHHHHCCCCCEECCH
T ss_conf             735411797889999868986462580