HHsearch alignment for GI: 254780272 and conserved domain: PRK12552

>PRK12552 ATP-dependent Clp protease-like protein; Reviewed.
Probab=100.00  E-value=0  Score=471.82  Aligned_cols=183  Identities=45%  Similarity=0.727  Sum_probs=176.0

Q ss_pred             CCCHHHHHHCCCEEEECCCCCH----------HHHHHHHHHHHHHHHCCCCCCEEEEEECCC---------CCHHHHHHH
Q ss_conf             1220034514677998783189----------899999999999741157697699993687---------614678999
Q gi|254780272|r   32 SYDIYSRLLKERIVFVTGQIED----------HMATLICAQLLFLEAENPQKEISLYINSPG---------GVVTAGMAI   92 (216)
Q Consensus        32 ~~Di~s~L~~~Riifl~g~I~~----------~~a~~iia~Ll~L~~~~~~k~I~l~INSpG---------G~v~~glaI   92 (216)
T Consensus        20 p~Di~srLl~eRIiflg~pi~~~d~~~~~~~~~vanliiAqLL~L~~ed~~k~I~lYINSpGgs~~~G~~~G~vt~~lAI   99 (222)
T PRK12552         20 PPDLPSLLLKERIVYLGLPLFSDDDAKRQLGMDVTELIIAQLLYLEFDDPEKPIYFYINSTGTSWYTGDAIGFETEAFAI   99 (222)
T ss_pred             CCCHHHHHHHCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCCCCCCCCHHHHH
T ss_conf             96787887515489867865642001101207899999999998514389999799983899765567643432306789


Q ss_pred             HHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99986448734899831556652000024677714554415664412566665554128999999999999999999987
Q gi|254780272|r   93 YDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKN  172 (216)
Q Consensus        93 yD~i~~i~~~V~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~  172 (216)
T Consensus       100 yDtMq~Ik~~V~Tic~G~AaSmgalLLaaG~kGkR~alPnsriMiHQP~gg~~GqAsDI~i~a~Eil~~r~~l~~ila~~  179 (222)
T PRK12552        100 CDTMRYIKPPVHTICIGQAMGTAAMILSAGTKGQRASLPHASIVLHQPRSGARGQATDIQIRAKEVLHNKRTMLEILSRN  179 (222)
T ss_pred             HHHHHCCCCCEEEEEHHHHHHHHHHHHHCCCCCCCEECCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             89985159985788527877099999863888772126871132238776777779999999999999999999999998


Q ss_pred             CCCCHHHHHHHHCCCCCCCHHHHHHCCCCCEEECCCCCCCCC
Q ss_conf             199989999972458588889999758864460454225101
Q gi|254780272|r  173 CGKTYEEVEKTLDRDHIMSASEACDWGVVDKVLMSRIDIEEK  214 (216)
Q Consensus       173 Tg~~~e~i~~~~~rD~~lsa~EA~eyGliD~Ii~~~~e~~~~  214 (216)
T Consensus       180 TGq~~e~I~~d~~RD~~msA~EA~eYGLID~Il~~r~~~p~~  221 (222)
T PRK12552        180 TGQTVEKLSKDSDRMFYLTPQEAKEYGLIDRVLESRKDLPAP  221 (222)
T ss_pred             HCCCHHHHHHHCCCCCCCCHHHHHHHCCCCEEECCCCCCCCC
T ss_conf             796999999871877567899999809876872268879999