HHsearch alignment for GI: 254780272 and conserved domain: cd07020

>cd07020 Clp_protease_NfeD_1 Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease. Nodulation formation efficiency D (NfeD; stomatin operon partner protein, STOPP; DUF107) is a member of membrane-anchored ClpP-class proteases. Currently, more than 300 NfeD homologs have been identified - all of which are bacterial or archaeal in origin. Majority of these genomes have been shown to possess operons containing a homologous NfeD/stomatin gene pair, causing NfeD to be previously named STOPP (stomatin operon partner protein). NfeD homologs can be divided into two groups: long and short forms. Long-form homologs have a putative ClpP-class serine protease domain while the short form homologs do not. Downstream from the ClpP-class domain is the so-called NfeD or DUF107 domain. N-terminal region of the NfeD homolog PH1510 (1510-N or PH1510-N) from Pyrococcus horikoshii has been shown to possess serine protease activity and has a Ser-Lys catalytic dyad, preferentially c
Probab=99.75  E-value=3.2e-17  Score=129.19  Aligned_cols=167  Identities=19%  Similarity=0.242  Sum_probs=130.9

Q ss_pred             EEEECCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEEE---CCCCCCCCCCCC
Q ss_conf             79987831898999999999997411576976999936876146789999998644873489983---155665200002
Q gi|254780272|r   44 IVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCM---GQAASMGSLLLS  120 (216)
Q Consensus        44 iifl~g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~glaIyD~i~~i~~~V~Ti~~---G~aaS~aslIl~  120 (216)
T Consensus         3 vi~i~g~I~~~~~~~l~r~l~~A~~~-~a~avvl~idTpGG~v~~~~~I~~~i~~s~vpvi~~V~p~G~~A~SAGa~I~~   81 (187)
T cd07020           3 VLEINGAITPATADYLERAIDQAEEG-GADALIIELDTPGGLLDSTREIVQAILASPVPVVVYVYPSGARAASAGTYILL   81 (187)
T ss_pred             EEEECCEECHHHHHHHHHHHHHHHHC-CCCEEEEEEECCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHH
T ss_conf             99961467688999999999999868-99899999858960789999999999818999899987897607718999998


Q ss_pred             CCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHHHHHCCC
Q ss_conf             46777145544156644125666655541289999999999999999999871999899999724585888899997588
Q gi|254780272|r  121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGV  200 (216)
Q Consensus       121 aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~~lsa~EA~eyGl  200 (216)
T Consensus        82 a~~--~~~MaPgt~iGaA~PV~~~~~~~~~~~~~~K~~n~~~-a~~rs~Ae~rGRn~~~Ae~~V~e~~~lta~eAl~~gv  158 (187)
T cd07020          82 AAH--IAAMAPGTNIGAAHPVAIGGGGGSDPVMEKKILNDAV-AYIRSLAELRGRNAEWAEKAVRESLSLTAEEALKLGV  158 (187)
T ss_pred             HCC--HHHCCCCCCEECCCCEECCCCCCCCHHHHHHHHHHHH-HHHHHHHHHCCCCHHHHHHHHHHCCCCCHHHHHHCCC
T ss_conf             360--7547898750014412068988760578999999999-9999999983999899999876147668999997698


Q ss_pred             CCEEECCCCCCCCC
Q ss_conf             64460454225101
Q gi|254780272|r  201 VDKVLMSRIDIEEK  214 (216)
Q Consensus       201 iD~Ii~~~~e~~~~  214 (216)
T Consensus       159 iD~ia~~~~eLL~~  172 (187)
T cd07020         159 IDLIAADLNELLKK  172 (187)
T ss_pred             CEEEECCHHHHHHH
T ss_conf             17884999999987