HHsearch alignment for GI: 254780272 and conserved domain: cd07021

>cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease. Nodulation formation efficiency D (NfeD; stomatin operon partner protein, STOPP; DUF107) is a member of membrane-anchored ClpP-class proteases. Currently, more than 300 NfeD homologs have been identified - all of which are bacterial or archaeal in origin. Majority of these genomes have been shown to possess operons containing a homologous NfeD/stomatin gene pair, causing NfeD to be previously named STOPP (stomatin operon partner protein). NfeD homologs can be divided into two groups: long and short forms. Long-form homologs have a putative ClpP-class serine protease domain while the short form homologs do not. Downstream from the ClpP-class domain is the so-called NfeD or DUF107 domain. N-terminal region of the NfeD homolog PH1510 (1510-N or PH1510-N) from Pyrococcus horikoshii has been shown to possess serine protease activity and has a Ser-Lys catalytic dyad, preferentiall
Probab=99.89  E-value=4.9e-22  Score=159.60  Aligned_cols=162  Identities=22%  Similarity=0.301  Sum_probs=134.0

Q ss_pred             EEEECCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCC
Q ss_conf             79987831898999999999997411576976999936876146789999998644873489983155665200002467
Q gi|254780272|r   44 IVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGE  123 (216)
Q Consensus        44 iifl~g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~glaIyD~i~~i~~~V~Ti~~G~aaS~aslIl~aG~  123 (216)
T Consensus         3 vi~i~g~I~~~~~~~l~r~l~~A~-~~~a~~ivl~idTpGG~v~~~~~I~~~I~~~~~pvv~~V~~~AaSAG~~Ia~aad   81 (178)
T cd07021           3 VIPIEGEIDPGLAAFVERALKEAK-EEGADAVVLDIDTPGGRVDSALEIVDLILNSPIPTIAYVNDRAASAGALIALAAD   81 (178)
T ss_pred             EEEECCEECHHHHHHHHHHHHHHH-HCCCCEEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHCC
T ss_conf             999735686889999999999999-6899789999979998689999999999848999999999920779999998467


Q ss_pred             CCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCC-------------CC
Q ss_conf             77145544156644125666655541289999999999999999999871999899999724585-------------88
Q gi|254780272|r  124 KGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH-------------IM  190 (216)
Q Consensus       124 ~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~-------------~l  190 (216)
T Consensus        82 --~i~m~p~t~iG~a~Pv~~~g~~~~~~K~~s----~~~a~-~r~~Ae~~GRn~~~aeamV~~~~~v~~~~~~~g~~Ltl  154 (178)
T cd07021          82 --EIYMAPGATIGAAEPIPGDGNGAADEKVQS----YWRAK-MRAAAEKKGRDPDIAEAMVDKDIEVPGVGIKGGELLTL  154 (178)
T ss_pred             --EEEECCCCCEECCCCCCCCCCCHHHHHHHH----HHHHH-HHHHHHHCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCC
T ss_conf             --004889985301542558886314678999----99999-99999983998999999975144442112334554435


Q ss_pred             CHHHHHHCCCCCEEECCCCCCCC
Q ss_conf             88999975886446045422510
Q gi|254780272|r  191 SASEACDWGVVDKVLMSRIDIEE  213 (216)
Q Consensus       191 sa~EA~eyGliD~Ii~~~~e~~~  213 (216)
T Consensus       155 ta~EAl~~g~~d~ia~~~~~Ll~  177 (178)
T cd07021         155 TADEALKVGYAEGIAGSLDELLV  177 (178)
T ss_pred             CHHHHHHCCCCEEEECCHHHHHH
T ss_conf             89999973982788689999951