HHsearch alignment for GI: 254780272 and conserved domain: pfam01972

>pfam01972 SDH_sah Serine dehydrogenase proteinase. This family of archaebacterial proteins, formerly known as DUF114, has been found to be a serine dehydrogenase proteinase distantly related to ClpP proteinases that belong to the serine proteinase superfamily. The family has a catalytic triad of Ser, Asp, His residues, which shows an altered residue ordering compared with the ClpP proteinases but similar to that of the carboxypeptidase clan.
Probab=98.93  E-value=4.7e-08  Score=71.34  Aligned_cols=149  Identities=19%  Similarity=0.200  Sum_probs=110.4

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCE
Q ss_conf             78318989999999999974115769769999368761467899999986448734899831556652000024677714
Q gi|254780272|r   48 TGQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR  127 (216)
Q Consensus        48 ~g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~glaIyD~i~~i~~~V~Ti~~G~aaS~aslIl~aG~~g~R  127 (216)
T Consensus        70 ~ryI~ieDSE~VLRAI---r~Tp~d~PIDlIlHTPGGlvLAa~QIA~AL~~H~akvtV~VPHYAMSGGTlIALAAD--EI  144 (286)
T pfam01972        70 YKFITIEDSEEILRAI---RLTPKDMPIDLIIHTPGGLALAATQIAKALKEHKAKTTVIVPHYAMSGGTLIALAAD--EI  144 (286)
T ss_pred             HHCCCHHHHHHHHHHH---HCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCEEEEEECC--CE
T ss_conf             4322623289999999---759999985799857961689999999999958997399950310567420321066--05


Q ss_pred             EECCCHHHHHHHHHHHHHH--------------HHHH-----HHHHHHHHHHHHHHHHHHHHHHCCCC-HHHHHHHH---
Q ss_conf             5544156644125666655--------------5412-----89999999999999999999871999-89999972---
Q gi|254780272|r  128 FALPNARILLHQPSGGFSG--------------QASD-----IERHAQDIVKIKRRLNEIYVKNCGKT-YEEVEKTL---  184 (216)
Q Consensus       128 ~~~pns~iMiHqps~~~~G--------------~~~d-----i~~~a~el~~~~~~l~~i~a~~Tg~~-~e~i~~~~---  184 (216)
T Consensus       145 vMd~nAVLGPvDPQlG~~PAaSIl~v~e~K~~~~idD~TLIlaDva~KAi~Qv~~~v~~LL~~k~~eeka~~ia~~L~~G  224 (286)
T pfam01972       145 IMDENAVLGPVDPQIGQYPAASILKAVEKKGPKKIDDQTLILADISKKAIKQMEEFVYNLLKDKYGEEKAKEIAKILTEG  224 (286)
T ss_pred             EECCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCC
T ss_conf             56776555887820268767999999974791314640012788899999999999999987438889999999998068


Q ss_pred             --CCCCCCCHHHHHHCCCC
Q ss_conf             --45858888999975886
Q gi|254780272|r  185 --DRDHIMSASEACDWGVV  201 (216)
Q Consensus       185 --~rD~~lsa~EA~eyGli  201 (216)
T Consensus       225 ~wTHDyPit~e~ak~lGl~  243 (286)
T pfam01972       225 RWTHDYPLTVEELKELGLE  243 (286)
T ss_pred             CEECCCCCCHHHHHHCCCC
T ss_conf             4417888899999985996