HHsearch results for GI: 254780272 and protein with PDBid: 1uiy_A

>1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3
Probab=97.85  E-value=0.0001  Score=48.81  Aligned_cols=138  Identities=20%  Similarity=0.230  Sum_probs=91.9

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHH------------------------HHHHHHHHHHCCCCEEE
Q ss_conf             318989999999999974115769769999368761467------------------------89999998644873489
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTA------------------------GMAIYDTMQFIKPPIST  105 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~------------------------glaIyD~i~~i~~~V~T  105 (216)
                      .++.++-..+...+-.++.. ++ ---+.|.|.|+...+                        ...++..+..++.||..
T Consensus        22 al~~~~~~el~~~l~~~~~d-~~-v~~vvi~g~g~~f~~g~dl~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~kpvIa   99 (253)
T 1uiy_A           22 PLSPEMALSLLQALDDLEAD-PG-VRAVVLTGRGKAFSAGADLAFLERVTELGAEENYRHSLSLMRLFHRVYTYPKPTVA   99 (253)
T ss_dssp             CCCHHHHHHHHHHHHHHHHC-TT-CCEEEEEESSSCSBCCCCHHHHHHHTTSCHHHHHHHHHHHHHHHHHHHHCSSCEEE
T ss_pred             CCCHHHHHHHHHHHHHHHHC-CC-CEEEEEECCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             98999999999999999739-99-65999978886644564067664123455301223212366899999968998899


Q ss_pred             EEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHC
Q ss_conf             98315566520000246777145544156644125666655541289999999999999999999871999899999724
Q gi|254780272|r  106 FCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD  185 (216)
Q Consensus       106 i~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~  185 (216)
                      .+-|.|.+.|..|.++++  .|++.+++++-+.....|...-   .-  ...+.           +..|  ..+..+.+-
T Consensus       100 ai~G~a~GgG~~lal~cD--~ria~~~a~~~~pe~~~g~~~~---~g--~~~l~-----------~~iG--~~~a~~l~l  159 (253)
T 1uiy_A          100 AVNGPAVAGGAGLALACD--LVVMDEEARLGYTEVKIGFVAA---LV--SVILV-----------RAVG--EKAAKDLLL  159 (253)
T ss_dssp             EECSCEETHHHHHHHTSS--EEEEETTCEEECCHHHHTCCCH---HH--HHHHH-----------HHSC--HHHHHHHHH
T ss_pred             EECCEEEHHHHHHHHHCC--EEEECCCCCCCCCCCEEEECCC---HH--HHHHH-----------HHHC--HHHHHHHHH
T ss_conf             993857628899997347--8895455511574000622674---59--99999-----------9878--999999873


Q ss_pred             CCCCCCHHHHHHCCCCCEEECCCC
Q ss_conf             585888899997588644604542
Q gi|254780272|r  186 RDHIMSASEACDWGVVDKVLMSRI  209 (216)
Q Consensus       186 rD~~lsa~EA~eyGliD~Ii~~~~  209 (216)
                      .-..++|+||.++|+||+|+.+..
T Consensus       160 ~g~~~~a~eA~~~Glv~~v~~~~~  183 (253)
T 1uiy_A          160 TGRLVEAREAKALGLVNRIAPPGK  183 (253)
T ss_dssp             HCCEEEHHHHHHHTSCSEEECTTC
T ss_pred             CCCCCCHHHHHHCCCCCEECCHHH
T ss_conf             298577999986799638657688