HHsearch results for GI: 254780272 and protein with PDBid: 1x0u_A

>1x0u_A Hypothetical methylmalonyl-COA decarboxylase alpha subunit; lyase; 2.20A {Sulfolobus tokodaii str}
Probab=97.61  E-value=0.00011  Score=48.64  Aligned_cols=143  Identities=17%  Similarity=0.240  Sum_probs=90.9

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCC----------CCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCC
Q ss_conf             783189899999999999741157697699993687----------6146789999998644873489983155665200
Q gi|254780272|r   48 TGQIEDHMATLICAQLLFLEAENPQKEISLYINSPG----------GVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSL  117 (216)
Q Consensus        48 ~g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpG----------G~v~~glaIyD~i~~i~~~V~Ti~~G~aaS~asl  117 (216)
                      +|.++.+.+.....-+..-+.  -.-||-.++|+||          |-+.+|-.+.+++...+.|+.|+.+|.+++.|.+
T Consensus       338 ~G~~~~~~a~Kaarfi~lcd~--~~iPlv~lvDtpGf~~G~~~E~~Gi~~~ga~~~~a~a~~~vP~isvi~~~~~Ggg~~  415 (522)
T 1x0u_A          338 GGSIDIDAADKAARFIRFCDA--FNIPLISLVDTPGYVPGTDQEYKGIIRHGAKMLYAFAEATVPKITVIVRKSYGGAHI  415 (522)
T ss_dssp             GGCBCHHHHHHHHHHHHHHHH--TTCCEEEEEEECCBCCSHHHHHTTHHHHHHHHHHHHHHCCSCEEEEEEEEEEHHHHH
T ss_pred             CCCCCHHHHHHHHHHHHHHCC--CCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHH
T ss_conf             787773779999999973300--275479984278777767999972999999999999838998799986765466777


Q ss_pred             CCCCCC--CCCEEECCCHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHH
Q ss_conf             002467--7714554415664412566665554-1289999999999999999999871999899999724585888899
Q gi|254780272|r  118 LLSAGE--KGMRFALPNARILLHQPSGGFSGQA-SDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE  194 (216)
Q Consensus       118 Il~aG~--~g~R~~~pns~iMiHqps~~~~G~~-~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~~lsa~E  194 (216)
                      -+++..  ....++.|++++-.-.|.+.+.=-. .+++. +++-              ...-.+++.+..  +...++..
T Consensus       416 am~~~~~~~d~~~awP~a~~~vm~pEgaa~i~~r~~l~~-a~~~--------------~~~~~~~~~~~~--~~~~~~~~  478 (522)
T 1x0u_A          416 AMSIKSLGADLVYAWPTAEIAVTGPEGAVRILYRKEIQQ-ASNP--------------DDVLKQRIAEYR--KLFANPYW  478 (522)
T ss_dssp             HTCCGGGTCSEEEECTTCEEESSCHHHHHHHHTSSSSSS-SSSS--------------SSSSHHHHHHHH--HHHSSSHH
T ss_pred             HHCCCCCCCCEEEECCCCEEEECCHHHHHHHHHHHHHHH-CCCH--------------HHHHHHHHHHHH--HHHCCHHH
T ss_conf             542667788879996757798459999999986765643-7898--------------999999999999--87579999


Q ss_pred             HHHCCCCCEEECCCC
Q ss_conf             997588644604542
Q gi|254780272|r  195 ACDWGVVDKVLMSRI  209 (216)
Q Consensus       195 A~eyGliD~Ii~~~~  209 (216)
                      |.+.|+||+||+++.
T Consensus       479 aa~~g~iD~VIdP~~  493 (522)
T 1x0u_A          479 AAEKGLVDDVIEPKD  493 (522)
T ss_dssp             HHHTTSSSEECCGGG
T ss_pred             HHHCCCCCEEECHHH
T ss_conf             986688573288799