HHsearch results for GI: 254780272 and protein with PDBid: 2iex_A

>2iex_A Dihydroxynapthoic acid synthetase; crotonase-like family, beta-BETA-alpha, coenzyme biosyntheses, naphthoate synthase; 2.20A {Geobacillus kaustophilus HTA426} PDB: 2uzf_A*
Probab=97.95  E-value=8.4e-05  Score=49.40  Aligned_cols=139  Identities=18%  Similarity=0.194  Sum_probs=89.8

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHH-----------------------HHHHHHHHHHCCCCEEEE
Q ss_conf             318989999999999974115769769999368761467-----------------------899999986448734899
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTA-----------------------GMAIYDTMQFIKPPISTF  106 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~-----------------------glaIyD~i~~i~~~V~Ti  106 (216)
                      .++.++-..+...|..++..+ + ---+.|.+.|+...+                       ...++..|..++.||...
T Consensus        35 als~~m~~~l~~al~~~~~d~-~-v~~vvl~g~g~~f~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~kPvIAa  112 (272)
T 2iex_A           35 AFRPKTVNEMIDAFTKARDDS-N-IGVIILTGAGGKAFCSGGDQKVRGHGGYVGEDEIPRLNVLDLQRLIRVIPKPVIAM  112 (272)
T ss_dssp             CBCHHHHHHHHHHHHHHHHCT-T-CCEEEEEESSSSEEECCBC---------------CCCTHHHHHHHHHHSSSCEEEE
T ss_pred             CCCHHHHHHHHHHHHHHHHCC-C-CEEEEEECCCCCCCCCCCCHHHHHCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             989999999999999986199-9-55999843786540037718776035642024567777778999998399989999


Q ss_pred             EECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHH
Q ss_conf             831556652000024677714554415664412566665---55412899999999999999999998719998999997
Q gi|254780272|r  107 CMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFS---GQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKT  183 (216)
Q Consensus       107 ~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~---G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~  183 (216)
                      +-|.|.+.|..|.++++  .|++.++++|-+-...-|..   |-..       .+.   +.+        |  .....+.
T Consensus       113 v~G~a~GgG~~lal~~D--~ria~~~a~f~~pe~~lGl~p~~~~~~-------~l~---r~v--------g--~~~a~~l  170 (272)
T 2iex_A          113 VAGYAIGGGHVLHVVCD--LTIAADNAIFGQTGPKVGSFDGGYGAG-------YLA---RIV--------G--HKKAREI  170 (272)
T ss_dssp             ECSEEETHHHHHHHHSS--EEEEETTCEEECCHHHHTCCCCSTTTH-------HHH---HHH--------C--HHHHHHH
T ss_pred             ECCEEEHHHHHHHHCCC--CCEECCCCEEECCCCCCCCCCCHHHHH-------HHH---HHH--------H--HHHHHHH
T ss_conf             88984378999986036--445668878987500134076601578-------999---997--------2--9999999


Q ss_pred             HCCCCCCCHHHHHHCCCCCEEECCCCCCCC
Q ss_conf             245858888999975886446045422510
Q gi|254780272|r  184 LDRDHIMSASEACDWGVVDKVLMSRIDIEE  213 (216)
Q Consensus       184 ~~rD~~lsa~EA~eyGliD~Ii~~~~e~~~  213 (216)
                      +-.-.-++|+||+++|+||+|+.. .++.+
T Consensus       171 ll~g~~i~a~eA~~~Glv~~v~~~-~~l~~  199 (272)
T 2iex_A          171 WYLCRQYTAQEALEMGLVNKVVPL-EQLEE  199 (272)
T ss_dssp             HHHCCCEEHHHHHHTTSSSEEECG-GGHHH
T ss_pred             HHCCCCCCHHHHHHCCCEEEEECH-HHHHH
T ss_conf             970886569999767997698077-89999