HHsearch results for GI: 254780272 and protein with PDBid: 2j5g_A

>2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D
Probab=97.86  E-value=0.0003  Score=45.93  Aligned_cols=140  Identities=13%  Similarity=0.087  Sum_probs=82.3

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEE-EEECC------CCCHH----------------HHHHHHHHHHHCCCCEEEE
Q ss_conf             3189899999999999741157697699-99368------76146----------------7899999986448734899
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISL-YINSP------GGVVT----------------AGMAIYDTMQFIKPPISTF  106 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l-~INSp------GG~v~----------------~glaIyD~i~~i~~~V~Ti  106 (216)
                      .++.++-..+...+..++.. +  +|.+ .|.+.      |+++.                .+..++..+..++.||...
T Consensus        47 al~~~~~~eL~~al~~~~~d-~--~i~vvvl~g~g~~FsaG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~PvIa~  123 (263)
T 2j5g_A           47 VFTGKTHREFPDAFYDISRD-R--DNRVVILTGSGDAWMAEIDFPSLGDVTNPREWDKTYWEGKKVLQNLLDIEVPVISA  123 (263)
T ss_dssp             EECHHHHHHHHHHHHHHHHC-T--TCCEEEEECBTTEEECEECSGGGCCTTSHHHHHHHHHHHHHHHHHHHTCCSCEEEE
T ss_pred             CCCHHHHHHHHHHHHHHHHC-C--CCEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             88999999999999999759-9--98599997889975288723133444553101466789999999999669975876


Q ss_pred             EECCCCCCCCCCCCCCCCCCEEECCCHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHC
Q ss_conf             831556652000024677714554415664-4125666655541289999999999999999999871999899999724
Q gi|254780272|r  107 CMGQAASMGSLLLSAGEKGMRFALPNARIL-LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD  185 (216)
Q Consensus       107 ~~G~aaS~aslIl~aG~~g~R~~~pns~iM-iHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~  185 (216)
                      +-|.|.+-+ .++++++  .|++.+++++. +-....|..   .+.-... .+.   +.+-          .....+.+-
T Consensus       124 v~G~a~GGg-~lal~cD--~~ia~~~a~f~~~pe~~~G~~---p~~g~~~-~l~---~~iG----------~~~a~~lll  183 (263)
T 2j5g_A          124 VNGAALLHS-EYILTTD--IILASENTVFQDMPHLNAGIV---PGDGVHI-LWP---LALG----------LYRGRYFLF  183 (263)
T ss_dssp             ECSEECSCG-GGGGGCS--EEEEETTCEECCCHHHHHTCC---CCSSHHH-HHH---HHHH----------HHHHHHHHH
T ss_pred             ECCCEEEEE-EECCCCC--EEEECCCCEEEECHHHCCCCC---CCCCCHH-HHH---HHHH----------HHHHHHHHH
T ss_conf             188547887-7425563--478647866876411111667---6756077-889---8846----------999976561


Q ss_pred             CCCCCCHHHHHHCCCCCEEECCCCCCCC
Q ss_conf             5858888999975886446045422510
Q gi|254780272|r  186 RDHIMSASEACDWGVVDKVLMSRIDIEE  213 (216)
Q Consensus       186 rD~~lsa~EA~eyGliD~Ii~~~~e~~~  213 (216)
                      .-..++|+||+++||||+|++. .++.+
T Consensus       184 tg~~i~a~eA~~~Glv~~vv~~-~~l~~  210 (263)
T 2j5g_A          184 TQEKLTAQQAYELNVVHEVLPQ-SKLME  210 (263)
T ss_dssp             TTCCEEHHHHHHTTSCSEEECG-GGHHH
T ss_pred             CCCCCCHHHHHHCCCCEEEECH-HHHHH
T ss_conf             3980129999777993098787-89999