HHsearch results for GI: 254780272 and protein with PDBid: 2pbp_A

>2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA; 1.80A {Geobacillus kaustophilus HTA426} PDB: 2qq3_A
Probab=97.93  E-value=3.5e-05  Score=51.80  Aligned_cols=141  Identities=20%  Similarity=0.196  Sum_probs=89.0

Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHH-------------------HHHHHHHHHHCCCCEEEEEEC
Q ss_conf             8318989999999999974115769769999368761467-------------------899999986448734899831
Q gi|254780272|r   49 GQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTA-------------------GMAIYDTMQFIKPPISTFCMG  109 (216)
Q Consensus        49 g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~-------------------glaIyD~i~~i~~~V~Ti~~G  109 (216)
                      -.++.++-..+...+-.++.. ++ ---+.|.+.|+...+                   .+.++..+...+.||...+-|
T Consensus        27 Nal~~~~~~~l~~~l~~~~~d-~~-~~~vvl~~~~~~f~~g~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~Iaai~G  104 (258)
T 2pbp_A           27 NALSRQMVAEIVAAVEAFDRN-EK-VRVIVLTGRGRAFAAGADIQEMAKDDPIRLEWLNQFADWDRLSIVKTPMIAAVNG  104 (258)
T ss_dssp             TCCCHHHHHHHHHHHHHHHHC-TT-CCEEEEEESTTEEECCCCHHHHHTCCHHHHHHHCTTHHHHHHHTCCSCEEEEECS
T ss_pred             CCCCHHHHHHHHHHHHHHHCC-CC-EEEEEEECCCCCEECCCCHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             999999999999999998609-98-5899990798640127538877313211467777767889985189988999806


Q ss_pred             CCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCC
Q ss_conf             55665200002467771455441566441256666555412899999999999999999998719998999997245858
Q gi|254780272|r  110 QAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI  189 (216)
Q Consensus       110 ~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~~  189 (216)
                      .|.+.|..|.++++  .|++.++++|-+-...-|......-..               .+.+..|.  ..-.+.+-.-..
T Consensus       105 ~a~GgG~~lal~~D--~ria~~~a~f~~pe~~~Gl~p~~g~~~---------------~l~~~iG~--~~a~~l~l~g~~  165 (258)
T 2pbp_A          105 LALGGGFELALSCD--LIVASSAAEFGFPEVNLGVMPGAGGTQ---------------RLTKLIGP--KRALEWLWTGAR  165 (258)
T ss_dssp             EEETHHHHHHHTSS--EEEEETTCEEECGGGGGTCCCCSSHHH---------------HHHHHHCH--HHHHHHHHHCCC
T ss_pred             EEEEHHHHHHHHCC--EEEECCCCEEECCCCCCCCCCCCCHHH---------------HHHHHHCH--HHHHHHHHCCCC
T ss_conf             57616689986278--799879978987311568798722999---------------99998689--999999982997


Q ss_pred             CCHHHHHHCCCCCEEECCCCCC
Q ss_conf             8889999758864460454225
Q gi|254780272|r  190 MSASEACDWGVVDKVLMSRIDI  211 (216)
Q Consensus       190 lsa~EA~eyGliD~Ii~~~~e~  211 (216)
                      ++|+||.++||||+|+.. .++
T Consensus       166 ~~a~eA~~~Glv~~vv~~-~~l  186 (258)
T 2pbp_A          166 MSAKEAEQLGIVNRVVSP-ELL  186 (258)
T ss_dssp             EEHHHHHHTTSCSEEECG-GGH
T ss_pred             CCHHHHHHCCCEEEEECH-HHH
T ss_conf             879999988990187257-888