HHsearch results for GI: 254780272 and protein with PDBid: 2x58_A

>2x58_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, lyase, isomerase, peroxisome; HET: ADP COA; 2.80A {Rattus norvegicus}
Probab=97.53  E-value=0.00031  Score=45.86  Aligned_cols=137  Identities=20%  Similarity=0.199  Sum_probs=88.6

Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCCE-EEEEECCCCCHHH---------------HHHHHHHHHHCCCCEEEEEECCCC
Q ss_conf             831898999999999997411576976-9999368761467---------------899999986448734899831556
Q gi|254780272|r   49 GQIEDHMATLICAQLLFLEAENPQKEI-SLYINSPGGVVTA---------------GMAIYDTMQFIKPPISTFCMGQAA  112 (216)
Q Consensus        49 g~I~~~~a~~iia~Ll~L~~~~~~k~I-~l~INSpGG~v~~---------------glaIyD~i~~i~~~V~Ti~~G~aa  112 (216)
                      -.++.++...+...+-.++..   .++ -+.|.|.|+...+               .-.+++.|..++.||...+-|.|.
T Consensus        27 Nal~~~~~~~l~~~l~~~~~d---~~v~~vvltg~g~~F~aG~Dl~~~~~~~~~~~~~~~~~~i~~~~kPvIaav~G~a~  103 (727)
T 2x58_A           27 NAVSPTVIREVRNGLQKAGSD---HTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVAL  103 (727)
T ss_dssp             TCBCHHHHHHHHHHHHHHHSC---TTCCEEEEEESTTCSBCCBCGGGCSSSCSCSHHHHHHHHHHTCSSCEEEEECSEEE
T ss_pred             CCCCHHHHHHHHHHHHHHHHC---CCCEEEEEECCCCCCCCCCCHHHHHCCCCHHHHHHHHHHHHHCCCCEEEEECCHHH
T ss_conf             789999999999999998648---99769999898997556808575653590579999999999499989999884532


Q ss_pred             CCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCH
Q ss_conf             65200002467771455441566441256666555412899999999999999999998719998999997245858888
Q gi|254780272|r  113 SMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSA  192 (216)
Q Consensus       113 S~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~~lsa  192 (216)
                      +.|.-|.++++  .|++.++++|-+-...-|..-...-.    .   ++        .+..|.  ..-.+.+-.-..++|
T Consensus       104 GgG~elalacD--~ria~~~a~~g~pev~lGl~p~~ggt----~---~l--------~r~iG~--~~a~~l~l~g~~~~a  164 (727)
T 2x58_A          104 GGGLELALGCH--YRIANAKARVGLPEVTLGILPGARGT----Q---LL--------PRVVGV--PVALDLITSGKYLSA  164 (727)
T ss_dssp             THHHHHHHHSS--EEEEETTCEEECCGGGGTCCCTTTHH----H---HH--------HHHHCH--HHHHHHHHHCCEEEH
T ss_pred             HHHHHHHHHCC--EEEECCCCEEECCCCCCCCCCCCCHH----H---HH--------HHHCCH--HHHHHHHHCCCCCCH
T ss_conf             99999999659--89975997998830051618861699----9---99--------885257--789998753787878


Q ss_pred             HHHHHCCCCCEEECC
Q ss_conf             999975886446045
Q gi|254780272|r  193 SEACDWGVVDKVLMS  207 (216)
Q Consensus       193 ~EA~eyGliD~Ii~~  207 (216)
                      +||+++||||+|+..
T Consensus       165 ~~A~~~Glvd~v~~~  179 (727)
T 2x58_A          165 DEALRLGILDAVVKS  179 (727)
T ss_dssp             HHHHTTTSCSEEESS
T ss_pred             HHHHHCCCCCEECCC
T ss_conf             999865997176475