HHsearch results for GI: 254780272 and protein with PDBid: 3hin_A

>3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure initiative; 2.00A {Rhodopseudomonas palustris}
Probab=97.53  E-value=0.00014  Score=47.93  Aligned_cols=139  Identities=17%  Similarity=0.161  Sum_probs=86.7

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCC------CCHH---------------HHHHHHHHHHHCCCCEEEEEE
Q ss_conf             3189899999999999741157697699993687------6146---------------789999998644873489983
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISLYINSPG------GVVT---------------AGMAIYDTMQFIKPPISTFCM  108 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpG------G~v~---------------~glaIyD~i~~i~~~V~Ti~~  108 (216)
                      .++.++...+...|   +..+++ -=-+.|.+.|      +++.               ....+++.|..++.||...+-
T Consensus        39 al~~~~~~~L~~al---~~~d~~-~rvvvl~g~g~~FsaG~Dl~~~~~~~~~~~~~~~~~~~~~~~~i~~~~kPvIaav~  114 (275)
T 3hin_A           39 ALNDGLMAALKDCL---TDIPDQ-IRAVVIHGIGDHFSAGLDLSELRERDATEGLVHSQTWHRVFDKIQYCRVPVIAALK  114 (275)
T ss_dssp             CBCHHHHHHHHHHT---SSCCTT-CCEEEEEESSSCSBCCBCGGGCCCCCHHHHHHHHHHHHHHHHHHHTCSSCEEEEEC
T ss_pred             CCCHHHHHHHHHHH---HHCCCC-CCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             98999999999999---841668-84899967899745888367753200123355667899999999718998899986


Q ss_pred             CCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCC
Q ss_conf             15566520000246777145544156644125666655541289999999999999999999871999899999724585
Q gi|254780272|r  109 GQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH  188 (216)
Q Consensus       109 G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~  188 (216)
                      |.|.+.|..|.++++  .|++.+++++-+.....|......-..    .+-           +..|.  ....+.+-.-.
T Consensus       115 G~a~GgG~~lal~cD--~ria~~~a~f~~pe~~~Gl~p~~~~~~----~l~-----------~~iG~--~~a~~l~ltg~  175 (275)
T 3hin_A          115 GAVIGGGLELACAAH--IRVAEASAYYALPEGSRGIFVGGGGSV----RLP-----------RLIGV--ARMADMMLTGR  175 (275)
T ss_dssp             SEEETHHHHHHHHSS--EEEEETTCEEECGGGGGTCCCCSSHHH----HHH-----------HHHCH--HHHHHHHHHCC
T ss_pred             CEEEHHHHHHHHHCC--CCHHHHHCHHHHHHCEEEECCCHHHHH----HHH-----------HHHCH--HHHHHHHHHCC
T ss_conf             877428899998226--133755233242211062256548888----899-----------87054--67766764089


Q ss_pred             CCCHHHHHHCCCCCEEECCCCCCC
Q ss_conf             888899997588644604542251
Q gi|254780272|r  189 IMSASEACDWGVVDKVLMSRIDIE  212 (216)
Q Consensus       189 ~lsa~EA~eyGliD~Ii~~~~e~~  212 (216)
                      .++|+||+++||||+|+.. .++.
T Consensus       176 ~~~A~eA~~~Glv~~vv~~-~~l~  198 (275)
T 3hin_A          176 VYSAAEGVVHGFSQYLIEN-GSAY  198 (275)
T ss_dssp             CEEHHHHHHHTSCSEEESS-SCHH
T ss_pred             CCCHHHHHHCCCCCEECCH-HHHH
T ss_conf             6869999983996876682-5899