HHsearch results for GI: 254780272 and protein with PDBid: 3iav_A

>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 1xny_A* 1xnv_A* 1xo6_A
Probab=97.93  E-value=3.1e-05  Score=52.18  Aligned_cols=144  Identities=17%  Similarity=0.274  Sum_probs=92.8

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCC----------CCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCC
Q ss_conf             783189899999999999741157697699993687----------6146789999998644873489983155665200
Q gi|254780272|r   48 TGQIEDHMATLICAQLLFLEAENPQKEISLYINSPG----------GVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSL  117 (216)
Q Consensus        48 ~g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpG----------G~v~~glaIyD~i~~i~~~V~Ti~~G~aaS~asl  117 (216)
                      +|.++.+.+.... +++.|-.. -+-||-.++|+||          |.+.+|-.+++++...+.|+.||.+|.+++.|.+
T Consensus       345 ~G~~~~~~a~Kaa-rfi~lcd~-~~iPlv~lvDtpGf~~G~~~E~~G~~~~gA~l~~a~a~~~vP~isviigka~Ggg~~  422 (530)
T 3iav_A          345 AGCLDITASEKAA-RFVRTCDA-FNVPVLTFVDVPGFLPGVDQEHDGIIRRGAKLIFAYAEATVPLITVITRKAFGGAYV  422 (530)
T ss_dssp             GGCBCHHHHHHHH-HHHHHHHH-TTCCEEEEEEECCBCCCHHHHHTTHHHHHHHHHHHHHHCCSCEEEEEEEEEEHHHHH
T ss_pred             CCCCCCCHHHHHH-HHHHHHHC-CCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHH
T ss_conf             6887855699999-99999863-699658997446767888999976999999999999838998699998985408878


Q ss_pred             CCCCCC--CCCEEECCCHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHH
Q ss_conf             002467--77145544156644125666655-541289999999999999999999871999899999724585888899
Q gi|254780272|r  118 LLSAGE--KGMRFALPNARILLHQPSGGFSG-QASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE  194 (216)
Q Consensus       118 Il~aG~--~g~R~~~pns~iMiHqps~~~~G-~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~~lsa~E  194 (216)
                      .+++..  ....++.|++++-.=.|.+.+.= ...+++...++.+..+..+.+-|.                +...+|..
T Consensus       423 am~~~~~~~d~~~AwP~a~~~vm~~egaa~i~~r~~~~~a~~~~~~~~~~~~~~~~----------------~~~~~~~~  486 (530)
T 3iav_A          423 VMGSKHLGADLNLAWPTAQIAVMGAQGAVNILHRRTIADAGDDAEATRARLIQEYE----------------DALLNPYT  486 (530)
T ss_dssp             HTTCGGGTCSEEEECTTCEEESSCHHHHHHHHTSTTTSTTCTTCHHHHHHHHHHHH----------------HHHSSSHH
T ss_pred             HHCCCCCCCCEEEECCCCEEEECCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHH----------------HHHCCHHH
T ss_conf             74244568887999687759716999999999765564277778999999999999----------------88569899


Q ss_pred             HHHCCCCCEEECCCC
Q ss_conf             997588644604542
Q gi|254780272|r  195 ACDWGVVDKVLMSRI  209 (216)
Q Consensus       195 A~eyGliD~Ii~~~~  209 (216)
                      |.+.|.+|+||.++.
T Consensus       487 aa~~~~vD~vIdP~d  501 (530)
T 3iav_A          487 AAERGYVDAVIMPSD  501 (530)
T ss_dssp             HHHTTSSSEECCGGG
T ss_pred             HHHCCCCCCCCCHHH
T ss_conf             987478787478999