HHsearch results for GI: 254780272 and protein with PDBid: 3ju1_A

>3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.30A {Shewanella oneidensis mr-1}
Probab=97.18  E-value=0.00089  Score=42.93  Aligned_cols=141  Identities=17%  Similarity=0.174  Sum_probs=89.1

Q ss_pred             EEEECCC-----CCHHHHHHHHHHHHHHHHCCCCCCEEEEE-ECC-------CCCHHHH---------------------
Q ss_conf             7998783-----18989999999999974115769769999-368-------7614678---------------------
Q gi|254780272|r   44 IVFVTGQ-----IEDHMATLICAQLLFLEAENPQKEISLYI-NSP-------GGVVTAG---------------------   89 (216)
Q Consensus        44 iifl~g~-----I~~~~a~~iia~Ll~L~~~~~~k~I~l~I-NSp-------GG~v~~g---------------------   89 (216)
                      +|-|+-|     ++.++...+...|..++.   +..|...| .+-       |||+.+-                     
T Consensus        54 ~ItLNRP~~lNAl~~~m~~~l~~~l~~~~~---d~~v~~vVl~g~G~kaFcAG~Dl~~l~~~~~~~~~~~~~~~~~~~~~  130 (407)
T 3ju1_A           54 VVTLNVEKALNALDLDMVRAMTVQLNLWKK---DPLIACVVLDGSGEKAFCAGGDVRALYHASVAAKGQVTEVAKVFFEE  130 (407)
T ss_dssp             EEEECCGGGTSCBCHHHHHHHHHHHHHHHH---CTTEEEEEEEESSSSEEECCBCCHHHHHHHHHHTSSCCHHHHHHHHH
T ss_pred             EEEECCCCCCCCCCHHHHHHHHHHHHHHHH---CCCCEEEEEEECCCCCEECCCCHHHHHHCCCCCCCCCHHHHHHHHHH
T ss_conf             999817886789899999999999999974---98957999980799971078188988513333334301589999998


Q ss_pred             -HHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             -9999998644873489983155665200002467771455441566441256666555412899999999999999999
Q gi|254780272|r   90 -MAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEI  168 (216)
Q Consensus        90 -laIyD~i~~i~~~V~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i  168 (216)
                       ..+...|...+.||...+-|.|.+-|.-|.++++  .|++.++++|-+-...-|+.   .+.-. ...+.         
T Consensus       131 ~~~~~~~i~~~~kPvIa~v~G~a~GgG~~lal~~D--~riate~a~f~~pe~~iGl~---P~~G~-s~~~~---------  195 (407)
T 3ju1_A          131 EYRLDYLLHTYGKPVLVWGDGIVMGGGLGLMAGAS--HKVVTETSRIAMPEVTIGLY---PDVGG-SYFLN---------  195 (407)
T ss_dssp             HHHHHHHHHTCSSCEEEECCSEEETHHHHHHHHCS--EEEECTTCEEECGGGGGTCC---SCTTH-HHHTT---------
T ss_pred             HHHHHHHHHHCCCCEEEEECCEEECCCCCCCCCCC--CCCCCCCCEEECHHHCEEEC---CCCHH-HHHHH---------
T ss_conf             88999999855993899976702045520002456--46558987983234145427---98115-46746---------


Q ss_pred             HHHHCCCCHHHHHHHHCCCCCCCHHHHHHCCCCCEEECC
Q ss_conf             998719998999997245858888999975886446045
Q gi|254780272|r  169 YVKNCGKTYEEVEKTLDRDHIMSASEACDWGVVDKVLMS  207 (216)
Q Consensus       169 ~a~~Tg~~~e~i~~~~~rD~~lsa~EA~eyGliD~Ii~~  207 (216)
                         +.+...-.  ..+-.-..++|+||+++||||+++.+
T Consensus       196 ---~~~~~~~~--~l~ltG~~i~a~eA~~~Glv~~vv~~  229 (407)
T 3ju1_A          196 ---RMPGKMGL--FLGLTAYHMNAADACYVGLADHYLNR  229 (407)
T ss_dssp             ---TSSTTHHH--HHHHHCCCBCHHHHHHHTSCSEECCG
T ss_pred             ---HCCHHHHH--HHHHHCCCCCHHHHHHCCCCEEECCH
T ss_conf             ---23528888--98865897765789874974175386