HHsearch results for GI: 254780272 and protein with PDBid: 3oc7_A

>3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium 104}
Probab=97.43  E-value=0.00048  Score=44.61  Aligned_cols=136  Identities=12%  Similarity=0.126  Sum_probs=84.7

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECC------CCCHHH--------------------HHHHHHHHHHCCCCE
Q ss_conf             318989999999999974115769769999368------761467--------------------899999986448734
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISLYINSP------GGVVTA--------------------GMAIYDTMQFIKPPI  103 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSp------GG~v~~--------------------glaIyD~i~~i~~~V  103 (216)
                      .++.++...+...+-.++.. ++-. .+.|.+.      |+++..                    ...++..|...+.||
T Consensus        34 al~~~~~~~l~~~l~~~~~d-~~v~-vvvl~g~g~~F~aG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~kPv  111 (267)
T 3oc7_A           34 ALSTALVSQLHQGLRDASSD-PAVR-VVVLAHTGGTFCAGADLSEAGSGGSPSSAYDMAVERAREMAALMRAIVESRLPV  111 (267)
T ss_dssp             CBCHHHHHHHHHHHHHHHHC-TTCC-EEEEEECSSEEECCBC-----------CHHHHHHHHHHHHHHHHHHHHHCSSCE
T ss_pred             CCCHHHHHHHHHHHHHHHHC-CCCE-EEEEECCCCCCCCCCCHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCE
T ss_conf             98999999999999999659-9955-999978899774898779875324430246778999999999999999779988


Q ss_pred             EEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHH
Q ss_conf             89983155665200002467771455441566441256666555412899999999999999999998719998999997
Q gi|254780272|r  104 STFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKT  183 (216)
Q Consensus       104 ~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~  183 (216)
                      ...+-|.|.+.|+-|.++++  .|++.+++++-+.....|......-.....+-..                  ....+.
T Consensus       112 Ia~v~G~a~GgG~~la~~~D--~ria~~~a~f~~~~~~~Gl~p~~g~~~~~~~~~~------------------~~~~~l  171 (267)
T 3oc7_A          112 IAAIDGHVRAGGFGLVGACD--IAVAGPRSSFALTEARIGVAPAIISLTLLPKLSA------------------RAAARY  171 (267)
T ss_dssp             EEEECSEEETTHHHHHHHSS--EEEECTTCEEECCGGGGTCCCTTTHHHHTTTSCH------------------HHHHHH
T ss_pred             EEEEECEECCCCHHHHHHCC--CCEECCCCCEEHHHHCCCCCCCCHHHHHHHHHHH------------------HHHHHH
T ss_conf             99982766115337765123--0111775431125302077873018899999889------------------999999


Q ss_pred             HCCCCCCCHHHHHHCCCCCEEECC
Q ss_conf             245858888999975886446045
Q gi|254780272|r  184 LDRDHIMSASEACDWGVVDKVLMS  207 (216)
Q Consensus       184 ~~rD~~lsa~EA~eyGliD~Ii~~  207 (216)
                      +-...-++++||+++||||++++.
T Consensus       172 lltg~~~~a~eA~~~Glv~~v~e~  195 (267)
T 3oc7_A          172 YLTGEKFDARRAEEIGLITMAAED  195 (267)
T ss_dssp             HHHCCCBCHHHHHHHTSSSEECSS
T ss_pred             HHCCCCCCHHHHHHCCCEEEECHH
T ss_conf             985897787999988985887604