Query         gi|254780272|ref|YP_003064685.1| ATP-dependent Clp protease proteolytic subunit [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 216
No_of_seqs    163 out of 2313
Neff          6.0 
Searched_HMMs 23785
Date          Tue May 24 10:24:03 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780272.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 1tg6_A Putative ATP-dependent  100.0       0       0  489.2  14.8  203   11-213    51-253 (277)
  2 3p2l_A ATP-dependent CLP prote 100.0       0       0  444.9  14.3  197   17-213     5-201 (201)
  3 1y7o_A ATP-dependent CLP prote 100.0       0       0  442.7  15.2  195   16-210    19-215 (218)
  4 1yg6_A ATP-dependent CLP prote 100.0       0       0  442.8  14.0  193   17-209     1-193 (193)
  5 2cby_A ATP-dependent CLP prote 100.0       0       0  413.0  14.7  186   29-214    14-199 (208)
  6 2f6i_A ATP-dependent CLP prote 100.0       0       0  393.4  14.5  188   24-212    21-208 (215)
  7 3bpp_A 1510-N membrane proteas  99.9 6.3E-26 2.7E-30  182.8   9.4  170   38-211     3-178 (230)
  8 3bf0_A Protease 4; bacterial,   99.4   4E-13 1.7E-17  101.9   9.0  161   44-207   305-504 (593)
  9 2f9i_A Acetyl-coenzyme A carbo  98.2 5.4E-06 2.3E-10   56.9   8.6  111   68-207   156-276 (327)
 10 3lke_A Enoyl-COA hydratase; ny  98.2 2.4E-05   1E-09   52.9  11.3  143   50-214    27-196 (263)
 11 1vrg_A Propionyl-COA carboxyla  98.2 4.2E-05 1.8E-09   51.3  12.1  142   49-209   344-498 (527)
 12 1hzd_A AUH, AU-binding protein  98.1 6.8E-06 2.8E-10   56.3   7.4  140   50-210    35-196 (272)
 13 2f9y_A Acetyl-COA carboxylase,  98.1 2.8E-05 1.2E-09   52.4  10.2  127   49-206   153-289 (339)
 14 3isa_A Putative enoyl-COA hydr  98.1 5.7E-05 2.4E-09   50.5  11.2  162   16-212     4-187 (254)
 15 3h02_A Naphthoate synthase; ID  98.0 2.4E-05   1E-09   52.9   8.4  139   50-209    50-212 (288)
 16 1on3_A Methylmalonyl-COA carbo  98.0 0.00013 5.4E-09   48.2  12.1  143   48-209   339-494 (523)
 17 2ej5_A Enoyl-COA hydratase sub  98.0 6.1E-05 2.6E-09   50.3   9.7  140   50-212    26-186 (257)
 18 3gow_A PAAG, probable enoyl-CO  98.0 7.4E-05 3.1E-09   49.8  10.1  141   50-212    23-183 (254)
 19 2f6q_A Peroxisomal 3,2-trans-e  98.0 0.00012 5.2E-09   48.4  11.0  140   50-212    49-213 (280)
 20 3he2_A Enoyl-COA hydratase ECH  98.0 2.1E-05   9E-10   53.2   7.1  137   49-207    43-195 (264)
 21 2iex_A Dihydroxynapthoic acid   97.9 8.4E-05 3.5E-09   49.4  10.0  139   50-213    35-199 (272)
 22 2fbm_A Y chromosome chromodoma  97.9 7.3E-05 3.1E-09   49.8   9.6  141   50-213    47-212 (291)
 23 2pbp_A Enoyl-COA hydratase sub  97.9 3.5E-05 1.5E-09   51.8   7.9  141   49-211    27-186 (258)
 24 3iav_A Propionyl-COA carboxyla  97.9 3.1E-05 1.3E-09   52.2   7.6  144   48-209   345-501 (530)
 25 2a7k_A CARB; crotonase, antibi  97.9 0.00021 8.9E-09   46.9  11.8  144   44-211    12-184 (250)
 26 1nzy_A Dehalogenase, 4-chlorob  97.9   8E-05 3.4E-09   49.5   9.6  141   50-212    26-192 (269)
 27 3fdu_A Putative enoyl-COA hydr  97.9 8.9E-05 3.8E-09   49.2   9.7  139   49-208    27-188 (266)
 28 3h81_A Enoyl-COA hydratase ECH  97.9   4E-05 1.7E-09   51.4   7.8  149   41-210    32-206 (278)
 29 3bf0_A Protease 4; bacterial,   97.9 4.3E-05 1.8E-09   51.2   7.9  151   54-207    70-263 (593)
 30 3n6r_B Propionyl-COA carboxyla  97.9 0.00018 7.4E-09   47.4  10.8  136   48-209   351-502 (531)
 31 3gf3_A Glutaconyl-COA decarbox  97.9 0.00061 2.6E-08   44.0  13.2  150   45-209   383-549 (588)
 32 3pea_A Enoyl-COA hydratase/iso  97.9 0.00011 4.8E-09   48.6   9.4  137   50-208    28-187 (261)
 33 2j5g_A ALR4455 protein; enzyme  97.9  0.0003 1.3E-08   45.9  11.5  140   50-213    47-210 (263)
 34 1uiy_A Enoyl-COA hydratase; ly  97.9  0.0001 4.4E-09   48.8   9.2  138   50-209    22-183 (253)
 35 3ome_A Enoyl-COA hydratase; ss  97.8 7.9E-05 3.3E-09   49.6   8.4  148   40-213    29-211 (282)
 36 3myb_A Enoyl-COA hydratase; ss  97.8 0.00012 5.2E-09   48.4   9.3  136   50-208    49-207 (286)
 37 1sg4_A 3,2-trans-enoyl-COA iso  97.8 0.00045 1.9E-08   44.8  12.2  142   50-212    27-191 (260)
 38 2bzr_A Propionyl-COA carboxyla  97.8 0.00016 6.9E-09   47.6   9.9  144   48-209   360-519 (548)
 39 1pix_A Glutaconyl-COA decarbox  97.8 0.00025 1.1E-08   46.4  10.8  146   47-209   383-547 (587)
 40 3njd_A Enoyl-COA hydratase; ss  97.8 0.00011 4.5E-09   48.8   8.8  147   41-213    42-247 (333)
 41 2vx2_A Enoyl-COA hydratase dom  97.8 8.6E-05 3.6E-09   49.3   8.0  135   50-207    56-213 (287)
 42 1wz8_A Enoyl-COA hydratase; ly  97.8 0.00011 4.6E-09   48.7   8.3  140   50-212    33-196 (264)
 43 1q52_A MENB; lyase, structural  97.8 0.00024   1E-08   46.5  10.0  170   17-212    19-240 (314)
 44 1dci_A Dienoyl-COA isomerase;   97.8 5.2E-05 2.2E-09   50.7   6.4  141   50-210    27-199 (275)
 45 2gtr_A CDY-like, chromodomain   97.8 0.00017   7E-09   47.5   8.9  140   50-212    29-193 (261)
 46 3kqf_A Enoyl-COA hydratase/iso  97.7 0.00034 1.4E-08   45.6  10.4  140   50-212    32-194 (265)
 47 3moy_A Probable enoyl-COA hydr  97.7  0.0001 4.3E-09   48.9   7.4  135   50-209    33-190 (263)
 48 1szo_A 6-oxocamphor hydrolase;  97.7 0.00058 2.4E-08   44.1  11.2  139   50-212    39-200 (257)
 49 1wdk_A Fatty oxidation complex  97.7 0.00039 1.6E-08   45.2  10.2  136   50-207    31-191 (715)
 50 2j5i_A P-hydroxycinnamoyl COA   97.7 9.9E-05 4.2E-09   49.0   7.0  140   50-212    32-198 (276)
 51 3bpt_A 3-hydroxyisobutyryl-COA  97.7 0.00036 1.5E-08   45.4   9.8  137   49-207    28-189 (363)
 52 3hp0_A Putative polyketide bio  97.7 0.00018 7.6E-09   47.3   8.2  138   50-210    30-190 (267)
 53 3h0u_A Putative enoyl-COA hydr  97.7 0.00018 7.7E-09   47.3   8.2  140   50-212    30-196 (289)
 54 3i47_A Enoyl COA hydratase/iso  97.7 0.00022 9.2E-09   46.8   8.4  140   49-212    26-190 (268)
 55 2w3p_A Benzoyl-COA-dihydrodiol  97.7 0.00032 1.4E-08   45.7   9.3  146   50-212    54-226 (556)
 56 3ff6_A Acetyl-COA carboxylase   97.7 0.00091 3.8E-08   42.9  11.4  158   48-208   435-629 (760)
 57 3p85_A Enoyl-COA hydratase; ss  97.6 2.6E-05 1.1E-09   52.6   3.5  142   49-212    47-200 (270)
 58 3gkb_A Putative enoyl-COA hydr  97.6 0.00033 1.4E-08   45.7   9.1  137   50-212    31-199 (287)
 59 2q35_A CURF; crotonase, lyase;  97.6 0.00012   5E-09   48.4   6.5  140   50-212    26-182 (243)
 60 1x0u_A Hypothetical methylmalo  97.6 0.00011 4.7E-09   48.6   6.2  143   48-209   338-493 (522)
 61 3p5m_A Enoyl-COA hydratase/iso  97.6 0.00053 2.2E-08   44.3   9.4  137   50-208    29-181 (255)
 62 3ot6_A Enoyl-COA hydratase/iso  97.6 0.00063 2.7E-08   43.9   9.5  140   50-213    28-188 (232)
 63 3hin_A Putative 3-hydroxybutyr  97.5 0.00014 6.1E-09   47.9   5.9  139   50-212    39-198 (275)
 64 3g64_A Putative enoyl-COA hydr  97.5 0.00047   2E-08   44.7   8.6  150   41-212    24-206 (279)
 65 2ppy_A Enoyl-COA hydratase; be  97.5  0.0016 6.8E-08   41.3  11.3  140   50-211    31-194 (265)
 66 2x58_A Peroxisomal bifunctiona  97.5 0.00031 1.3E-08   45.9   7.6  137   49-207    27-179 (727)
 67 3lao_A Enoyl-COA hydratase/iso  97.5 0.00014 5.7E-09   48.1   5.7  135   50-208    35-194 (258)
 68 3oc7_A Enoyl-COA hydratase; se  97.4 0.00048   2E-08   44.6   7.6  136   50-207    34-195 (267)
 69 1ef8_A Methylmalonyl COA decar  97.4 0.00025 1.1E-08   46.4   6.1  137   50-208    27-185 (261)
 70 1mj3_A Enoyl-COA hydratase, mi  97.4 6.8E-05 2.9E-09   50.0   3.2  135   50-209    30-187 (260)
 71 1pjh_A Enoyl-COA isomerase; EC  97.4 0.00076 3.2E-08   43.4   7.8  137   50-208    32-202 (280)
 72 3l3s_A Enoyl-COA hydratase/iso  97.2 0.00082 3.5E-08   43.2   7.0  139   50-212    29-195 (263)
 73 3ju1_A Enoyl-COA hydratase/iso  97.2 0.00089 3.7E-08   42.9   6.6  141   44-207    54-229 (407)
 74 3m6n_A RPFF protein; enoyl-COA  97.1  0.0027 1.1E-07   39.9   8.5  138   51-207    60-228 (305)
 75 2np9_A DPGC; protein inhibitor  97.0 0.00076 3.2E-08   43.4   4.6  139   50-212   190-375 (440)
 76 2wtb_A MFP2, fatty acid multif  96.9 0.00037 1.6E-08   45.3   2.9  135   50-209    30-192 (725)
 77 3k8x_A Acetyl-COA carboxylase;  96.4   0.057 2.4E-06   31.5  10.9  160   49-209   447-642 (758)
 78 2f9i_B Acetyl-coenzyme A carbo  93.0    0.49   2E-05   25.6   8.3  128   46-212   132-270 (285)
 79 2f9y_B Acetyl-coenzyme A carbo  76.2       4 0.00017   19.9   5.2   89   47-139   130-229 (304)
 80 2duw_A Putative COA-binding pr  33.9      11 0.00044   17.2   0.9  102   34-140     5-132 (145)
 81 1fxw_F Alpha2, platelet-activa  28.8      27  0.0011   14.7   2.3   84   19-110    11-104 (229)
 82 1uxy_A MURB, uridine diphospho  28.2      18 0.00075   15.7   1.3   57  111-178   260-321 (340)
 83 3lwz_A 3-dehydroquinate dehydr  27.2      29  0.0012   14.4   2.4   37   78-114    77-113 (153)
 84 3i99_A UDP-N-acetylenolpyruvoy  25.6      21 0.00089   15.3   1.3   78   90-178   251-335 (357)
 85 3kip_A 3-dehydroquinase, type   21.5      37  0.0016   13.8   3.2   36   78-113    87-122 (167)

No 1  
>1tg6_A Putative ATP-dependent CLP protease proteolytic subunit; mitochondrial CLPP, CLP/HSP 100, X-RAY crystallography, ATP- dependent protease; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1
Probab=100.00  E-value=0  Score=489.21  Aligned_cols=203  Identities=57%  Similarity=0.928  Sum_probs=196.7

Q ss_pred             HHHHHCCCCCEEEEECCCCCCCCCHHHHHHCCCEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHH
Q ss_conf             36664245757976659984012200345146779987831898999999999997411576976999936876146789
Q gi|254780272|r   11 SEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAGM   90 (216)
Q Consensus        11 ~~~~~~~~~p~~~e~~~~~~~~~Di~s~L~~~Riifl~g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~gl   90 (216)
                      +....||++|+|+|+|++||+++||||+||++|||||+|+|||+++++|++||+||+++|+++||+||||||||+|++|+
T Consensus        51 ~~~~~~~~~p~v~e~~~~ge~~~Di~srLl~~RIIfl~g~Idd~~a~~iiaqLl~Le~ed~~k~I~lyINSpGGsv~~Gl  130 (277)
T 1tg6_A           51 TATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGL  130 (277)
T ss_dssp             ------CCCCBCC---------CBHHHHHHTTTEEEEESSBCHHHHHHHHHHHHHHHHHCSSSCEEEEEEECCBCHHHHH
T ss_pred             CCCCCCCCCCEEEEECCCCCCHHHHHHHHHCCCEEEECCEECHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCHHHHHH
T ss_conf             57677887676987679874102366787626889989877589999999999998665999878999979995687899


Q ss_pred             HHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999864487348998315566520000246777145544156644125666655541289999999999999999999
Q gi|254780272|r   91 AIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYV  170 (216)
Q Consensus        91 aIyD~i~~i~~~V~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a  170 (216)
                      +|||+|+++++||+|+|.|+|+|||++||++|++|+|+++|||++|||||+++++|+++|++++++|++++++++.++|+
T Consensus       131 aIyD~m~~i~~~V~Tv~~G~AaSmaslIlaaG~kgkR~a~pns~iMIHqp~~~~~G~a~di~~~a~el~~~~~~l~~iya  210 (277)
T 1tg6_A          131 AIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYA  210 (277)
T ss_dssp             HHHHHHHHSCSCEEEEEEEEEETHHHHHHHTSCTTCEEECTTCEEEECCCCCCCCSSHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHCCCCCEEEEEEEECCHHHHHHHCCCCCCCCCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999985488856998632230567898726777103389987887258657775899999999999999999999999


Q ss_pred             HHCCCCHHHHHHHHCCCCCCCHHHHHHCCCCCEEECCCCCCCC
Q ss_conf             8719998999997245858888999975886446045422510
Q gi|254780272|r  171 KNCGKTYEEVEKTLDRDHIMSASEACDWGVVDKVLMSRIDIEE  213 (216)
Q Consensus       171 ~~Tg~~~e~i~~~~~rD~~lsa~EA~eyGliD~Ii~~~~e~~~  213 (216)
                      ++||++.++|+++|+||+||+|+||++|||||+|++++.+..+
T Consensus       211 ~~TG~~~e~I~~~m~rD~~msa~EA~eyGliD~Ii~~~~~~~~  253 (277)
T 1tg6_A          211 KHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGE  253 (277)
T ss_dssp             HHHCCCHHHHHHHHSSCEEECHHHHHHHTSCSEECSSCC----
T ss_pred             HHHCCCHHHHHHHHCCCCCCCHHHHHHCCCCCEEECCCCCCCC
T ss_conf             9879399999987506840659999983998789337876676


No 2  
>3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp}
Probab=100.00  E-value=0  Score=444.91  Aligned_cols=197  Identities=59%  Similarity=0.989  Sum_probs=193.7

Q ss_pred             CCCCEEEEECCCCCCCCCHHHHHHCCCEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHHHHHH
Q ss_conf             45757976659984012200345146779987831898999999999997411576976999936876146789999998
Q gi|254780272|r   17 GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTM   96 (216)
Q Consensus        17 ~~~p~~~e~~~~~~~~~Di~s~L~~~Riifl~g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~glaIyD~i   96 (216)
                      .++|+|+|++++|++++|+||+||++|||||+|+||+++++.++++|++|+++++++||+||||||||+|++|++|||+|
T Consensus         5 ~~~p~~~~~~~~~~~~~D~~~~l~~~RiI~l~g~I~~~~~~~~i~~l~~l~~~~~~~~I~l~INSpGG~v~~g~ai~d~i   84 (201)
T 3p2l_A            5 NLVPTVIEKTAGGERAFDIYSRLLKERIVFLNGEVNDHSANLVIAQLLFLESEDPDKDIYFYINSPGGMVTAGMGVYDTM   84 (201)
T ss_dssp             CCSSEECCC-----CCEEHHHHHHHTTEEEEESCBCHHHHHHHHHHHHHHHHHCSSSCEEEEEEECCBCHHHHHHHHHHH
T ss_pred             CCCCEEEEECCCCCEEHHHHHHHHCCCEEEECCEECHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHHHHHH
T ss_conf             65636999879986310265686656889989868689999999999998733688986999818998788999999999


Q ss_pred             HHCCCCEEEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             64487348998315566520000246777145544156644125666655541289999999999999999999871999
Q gi|254780272|r   97 QFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKT  176 (216)
Q Consensus        97 ~~i~~~V~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~  176 (216)
                      +++++||+|+|.|.|+|||++||++|+||+|+++|||++|+|||+++++|+++|++.++++++++++++.++|+++||++
T Consensus        85 ~~~~~~V~Tv~~G~aaS~a~lil~aG~k~~R~~~pns~iMiHq~~~~~~G~~~di~~~~~el~~~~~~i~~i~a~~tg~~  164 (201)
T 3p2l_A           85 QFIKPDVSTICIGLAASMGSLLLAGGAKGKRYSLPSSQIMIHQPLGGFRGQASDIEIHAKNILRIKDRLNKVLAHHTGQD  164 (201)
T ss_dssp             HHSSSCEEEEEEEEEETHHHHHHHTSSTTCEEECTTCEEEECCCEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_pred             HHCCCCEEEEEECCHHHHHHHHHHCCCCCEEECCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             84799989999452876799999679988687574704677156778885799999999999999999999999997959


Q ss_pred             HHHHHHHHCCCCCCCHHHHHHCCCCCEEECCCCCCCC
Q ss_conf             8999997245858888999975886446045422510
Q gi|254780272|r  177 YEEVEKTLDRDHIMSASEACDWGVVDKVLMSRIDIEE  213 (216)
Q Consensus       177 ~e~i~~~~~rD~~lsa~EA~eyGliD~Ii~~~~e~~~  213 (216)
                      .++|.++++||+||+|+||++|||||+|+++|+++.+
T Consensus       165 ~~~i~~~~~rd~~lta~EAleyGliD~Ii~~~~~~~k  201 (201)
T 3p2l_A          165 LETIVKDTDRDNFMMADEAKAYGLIDHVIESREAIIK  201 (201)
T ss_dssp             HHHHHHHTSSCEEEEHHHHHHHTSCSEECCCSCC---
T ss_pred             HHHHHHHHCCCCCCCHHHHHHCCCCCEEECCCHHHCC
T ss_conf             9999986147843579999984998497055510059


No 3  
>1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1
Probab=100.00  E-value=0  Score=442.75  Aligned_cols=195  Identities=48%  Similarity=0.832  Sum_probs=188.5

Q ss_pred             CCCCCEEEEECCCCCCCCCHHHHHHCCCEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHHHHH
Q ss_conf             24575797665998401220034514677998783189899999999999741157697699993687614678999999
Q gi|254780272|r   16 LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDT   95 (216)
Q Consensus        16 ~~~~p~~~e~~~~~~~~~Di~s~L~~~Riifl~g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~glaIyD~   95 (216)
                      -+++|+|+|++++||+++||||+||++|||||+|+||+++++.+++||+||+++++++||+||||||||+|++|++|||+
T Consensus        19 ~~~~p~v~~~~~~~~~~~Di~~~L~~~RiIfL~g~Id~~~a~~iia~Ll~l~~~d~~k~I~l~INS~GG~v~~glaI~D~   98 (218)
T 1y7o_A           19 SHMIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSVIAQLLFLDAQDSTKDIYLYVNTPGGSVSAGLAIVDT   98 (218)
T ss_dssp             ---CCEECC-------CEEHHHHHHHTTEEEEESCBCHHHHHHHHHHHHHHHHHCTTSCEEEEEEECCBCHHHHHHHHHH
T ss_pred             CCCCCEEEEECCCCCEEHHHHHHHHCCCEEEECCEECHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHH
T ss_conf             88588799876997420047678753688998989868999999999998885199987899982897868789999999


Q ss_pred             HHHCCCCEEEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             864487348998315566520000246777145544156644125666655541--289999999999999999999871
Q gi|254780272|r   96 MQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQAS--DIERHAQDIVKIKRRLNEIYVKNC  173 (216)
Q Consensus        96 i~~i~~~V~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~--di~~~a~el~~~~~~l~~i~a~~T  173 (216)
                      |+++++||+|+|.|.|||||++||+||+||+|+++|||++|||||+++++|+..  |++++++++.++++.+.++|+++|
T Consensus        99 m~~~~~~V~Ti~~G~AaS~aslIl~aG~kg~R~~~pns~iMiHqp~~~~~G~~~~~~~~~~~~el~~~~~~i~~i~a~~T  178 (218)
T 1y7o_A           99 MNFIKADVQTIVMGMAASMGTVIASSGAKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAPEHLLKTRNTLEKILAENS  178 (218)
T ss_dssp             HHHSSSCEEEEEEEEEETHHHHHHTTSCTTCEEECTTCEEECCCCC--------------CHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHCCCCEEEEEEEEECCHHHHHHHCCCCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             98569987999962554435689871688846874558888378855655553177999999999999999999999887


Q ss_pred             CCCHHHHHHHHCCCCCCCHHHHHHCCCCCEEECCCCC
Q ss_conf             9998999997245858888999975886446045422
Q gi|254780272|r  174 GKTYEEVEKTLDRDHIMSASEACDWGVVDKVLMSRID  210 (216)
Q Consensus       174 g~~~e~i~~~~~rD~~lsa~EA~eyGliD~Ii~~~~e  210 (216)
                      |++.++|+++++||+||+|+||++|||||+|+++++.
T Consensus       179 g~~~~~I~~~~~rd~~lsa~EAleyGliD~Ii~~~~~  215 (218)
T 1y7o_A          179 GQSMEKVHADAERDNWMSAQETLEYGFIDEIMANNSL  215 (218)
T ss_dssp             TCCHHHHHHHHHSCCCBCHHHHHHHTSCSEECCCC--
T ss_pred             CCCHHHHHHHHCCCEEECHHHHHHCCCCCEECCCCCC
T ss_conf             9799999986217906539999985998698246888


No 4  
>1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 1yg8_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A 3ktg_A 3kth_A 3kti_A* 3ktj_A* 3ktk_A*
Probab=100.00  E-value=0  Score=442.80  Aligned_cols=193  Identities=65%  Similarity=1.099  Sum_probs=189.9

Q ss_pred             CCCCEEEEECCCCCCCCCHHHHHHCCCEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHHHHHH
Q ss_conf             45757976659984012200345146779987831898999999999997411576976999936876146789999998
Q gi|254780272|r   17 GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTM   96 (216)
Q Consensus        17 ~~~p~~~e~~~~~~~~~Di~s~L~~~Riifl~g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~glaIyD~i   96 (216)
                      .++|+|+|+|++|++++|+||+||++|+|||+|+|++++++.++++|+||+++++++||+||||||||+|++|++|||+|
T Consensus         1 ~~~p~~~~~~~~~~~~~Di~~~l~~~riifl~~~I~~~~~~~~i~~l~~l~~~~~~~~I~l~InSpGG~v~~gl~i~D~i   80 (193)
T 1yg6_A            1 ALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTM   80 (193)
T ss_dssp             CCSCBCCSSSCSSCCCCBHHHHHHTTTEEEEESSBCHHHHHHHHHHHHHHHHHCSSSCEEEEEEECCBCHHHHHHHHHHH
T ss_pred             CCCCEEEEECCCCCCCCCHHHHHHCCCEEEECCEECHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHHHHHH
T ss_conf             99786998869986101376797566889889886468899999999999804999997999978996275799999998


Q ss_pred             HHCCCCEEEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             64487348998315566520000246777145544156644125666655541289999999999999999999871999
Q gi|254780272|r   97 QFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKT  176 (216)
Q Consensus        97 ~~i~~~V~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~  176 (216)
                      +++++||+|+|.|.|||||++||++|+||+|+++|||++|+|||+++++|++.|++.++++++++++++.++|+++||+|
T Consensus        81 ~~~~~~V~Tv~~G~aaS~a~lIl~~G~~g~R~~~pns~iMiHq~s~~~~G~~~di~~~~~el~~~~~~i~~i~a~~tg~~  160 (193)
T 1yg6_A           81 QFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQS  160 (193)
T ss_dssp             HHSSSCEEEEEEEEEETHHHHHHHTSCTTCEEECTTCEEEECCCEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_pred             HHCCCCEEEEEEHHHHHHHHHHHHCCCCCCEEECCCHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             42799999998249998999999759999745766537762256646575499999999999999999999999997939


Q ss_pred             HHHHHHHHCCCCCCCHHHHHHCCCCCEEECCCC
Q ss_conf             899999724585888899997588644604542
Q gi|254780272|r  177 YEEVEKTLDRDHIMSASEACDWGVVDKVLMSRI  209 (216)
Q Consensus       177 ~e~i~~~~~rD~~lsa~EA~eyGliD~Ii~~~~  209 (216)
                      .++++++++|||||+|+||++|||||+|+++|.
T Consensus       161 ~~~i~~~~~rd~~l~a~EAl~~GiiD~Ii~~~~  193 (193)
T 1yg6_A          161 LEQIERDTERDRFLSAPEAVEYGLVDSILTHRN  193 (193)
T ss_dssp             HHHHHHHTSSCEEEEHHHHHHHTSSSEECCCC-
T ss_pred             HHHHHHHHCCCCCCCHHHHHHCCCCCEEECCCC
T ss_conf             999998724783377999998099858935699


No 5  
>2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopeptidase, ATP-dependent protease, hydrolase; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A
Probab=100.00  E-value=0  Score=412.97  Aligned_cols=186  Identities=46%  Similarity=0.756  Sum_probs=178.9

Q ss_pred             CCCCCCHHHHHHCCCEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEEE
Q ss_conf             84012200345146779987831898999999999997411576976999936876146789999998644873489983
Q gi|254780272|r   29 GERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCM  108 (216)
Q Consensus        29 ~~~~~Di~s~L~~~Riifl~g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~glaIyD~i~~i~~~V~Ti~~  108 (216)
                      ++..-||||+||++|||||+|+||+++++.+++||+||+++++++||+||||||||+|++|++|||+|+++++||+|+|.
T Consensus        14 ~~~~~~iys~L~~~Riifl~~~Id~~~a~~ii~~L~~L~~~~~~k~I~l~InS~GG~v~~glaI~d~i~~~~~~V~ti~~   93 (208)
T 2cby_A           14 LSLTDSVYERLLSERIIFLGSEVNDEIANRLCAQILLLAAEDASKDISLYINSPGGSISAGMAIYDTMVLAPCDIATYAM   93 (208)
T ss_dssp             -CHHHHHHHHHHTTTEEEECSCBCHHHHHHHHHHHHHHHHHCSSSCEEEEEEECCBCHHHHHHHHHHHHHCSSCEEEEEE
T ss_pred             CCCCCHHHHHHHHCCEEEECCEECHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             66654899987626889989836789999999999997451889980788679988787899999999865998799963


Q ss_pred             CCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCC
Q ss_conf             15566520000246777145544156644125666655541289999999999999999999871999899999724585
Q gi|254780272|r  109 GQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH  188 (216)
Q Consensus       109 G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~  188 (216)
                      |.|+|||++||++|+||+|+++|||++|||||+++++|++.|++.+++++.++++.+.++|+++||++.++|+++++||+
T Consensus        94 G~aaS~aslIl~aG~kg~R~~~pns~iMiHq~~~~~~G~~~di~~~a~el~~~~~~i~~iya~~Tg~~~e~I~~~~~rd~  173 (208)
T 2cby_A           94 GMAASMGEFLLAAGTKGKRYALPHARILMHQPLGGVTGSAADIAIQAEQFAVIKKEMFRLNAEFTGQPIERIEADSDRDR  173 (208)
T ss_dssp             EEEETHHHHHHHTSCTTCEEECTTCEEECCCC----------CHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHTTC
T ss_pred             CCCCCHHHHHHHCCCCCCEEECCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHCCCC
T ss_conf             63543899998678989568879862788888736677776899999999999999999999997959999998606884


Q ss_pred             CCCHHHHHHCCCCCEEECCCCCCCCC
Q ss_conf             88889999758864460454225101
Q gi|254780272|r  189 IMSASEACDWGVVDKVLMSRIDIEEK  214 (216)
Q Consensus       189 ~lsa~EA~eyGliD~Ii~~~~e~~~~  214 (216)
                      ||+|+||++|||||+|++++....+.
T Consensus       174 ~lsa~EAl~yGliD~Ii~~~~~~~e~  199 (208)
T 2cby_A          174 WFTAAEALEYGFVDHIITRAHVNGEA  199 (208)
T ss_dssp             EEEHHHHHHHTSCSEECSCC------
T ss_pred             CCCHHHHHHCCCCCEEECCCCCCCCC
T ss_conf             34599999849987983579899631


No 6  
>2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics consortium, SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1
Probab=100.00  E-value=0  Score=393.39  Aligned_cols=188  Identities=36%  Similarity=0.613  Sum_probs=179.7

Q ss_pred             EECCCCCCCCCHHHHHHCCCEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             66599840122003451467799878318989999999999974115769769999368761467899999986448734
Q gi|254780272|r   24 EQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPI  103 (216)
Q Consensus        24 e~~~~~~~~~Di~s~L~~~Riifl~g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~glaIyD~i~~i~~~V  103 (216)
                      +.+.....+.|++++||++|||||+|+||+++++++++||+||+++++ +||+||||||||+|++|++|||+|+++++||
T Consensus        21 ~~~~~~~~~~d~~~~l~~~Riifl~g~Id~~~a~~ii~~Ll~L~~~~~-~~I~l~INS~GG~v~~g~aIyd~i~~~~~~V   99 (215)
T 2f6i_A           21 GHMDIKDMKKDVKLFFFKKRIIYLTDEINKKTADELISQLLYLDNINH-NDIKIYINSPGGSINEGLAILDIFNYIKSDI   99 (215)
T ss_dssp             -CCCCSCSSHHHHHHHHTTTEEEECSCBCHHHHHHHHHHHHHHHHHCC-SCEEEEEEECCBCHHHHHHHHHHHHHSSSCE
T ss_pred             CCCCCCCCCCCHHHHHHCCCEEEECCEECHHHHHHHHHHHHHHHCCCC-CCEEEEEECCCCCHHHHHHHHHHHHHCCCCE
T ss_conf             455412240108899873978998981278999999999999755899-7859999899976889999999998669985


Q ss_pred             EEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHH
Q ss_conf             89983155665200002467771455441566441256666555412899999999999999999998719998999997
Q gi|254780272|r  104 STFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKT  183 (216)
Q Consensus       104 ~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~  183 (216)
                      +|+|.|.|+|||++|+++|+||+|+++|||++|+|||+++++|++.|++.++++++++++.+.++|+++||++.++|+++
T Consensus       100 ~Tv~~G~aaS~as~Il~aG~kg~R~~~pns~iMiHq~s~~~~G~~~di~~~~~el~~~~~~i~~~~a~~tg~~~e~I~~~  179 (215)
T 2f6i_A          100 QTISFGLVASMASVILASGKKGKRKSLPNCRIMIHQPLGNAFGHPQDIEIQTKEILYLKKLLYHYLSSFTNQTVETIEKD  179 (215)
T ss_dssp             EEEEEEEECHHHHHHHHTSCTTCEEECTTCEEESSCTTCSCC--------CHHHHHHHHHHHHHHHHHHHCCCHHHHHHH
T ss_pred             EEEEECCCHHHHHHHHHCCCCCCEEECCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHH
T ss_conf             99997885045688886078884683477569973687677887579999999999999999999998829999999987


Q ss_pred             HCCCCCCCHHHHHHCCCCCEEECCCCCCC
Q ss_conf             24585888899997588644604542251
Q gi|254780272|r  184 LDRDHIMSASEACDWGVVDKVLMSRIDIE  212 (216)
Q Consensus       184 ~~rD~~lsa~EA~eyGliD~Ii~~~~e~~  212 (216)
                      ++||+||+|+||++|||||+|+++|...+
T Consensus       180 ~~~d~~lsa~EA~e~GliD~Ii~~k~~~p  208 (215)
T 2f6i_A          180 SDRDYYMNALEAKQYGIIDEVIETKLPHP  208 (215)
T ss_dssp             HHTTCEECHHHHHHHTSCSEECCCSSCCT
T ss_pred             HCCCCCCCHHHHHHCCCCCEECCCCCCCC
T ss_conf             15881504999998399869821699999


No 7  
>3bpp_A 1510-N membrane protease; specific for A stomatin homolog, archaea, thermostable, catalytic DYAD, hydrolase; 2.30A {Pyrococcus horikoshii} PDB: 2deo_A
Probab=99.93  E-value=6.3e-26  Score=182.82  Aligned_cols=170  Identities=22%  Similarity=0.308  Sum_probs=143.3

Q ss_pred             HHHCCCEEE---ECCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEEE---CCC
Q ss_conf             451467799---87831898999999999997411576976999936876146789999998644873489983---155
Q gi|254780272|r   38 RLLKERIVF---VTGQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCM---GQA  111 (216)
Q Consensus        38 ~L~~~Riif---l~g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~glaIyD~i~~i~~~V~Ti~~---G~a  111 (216)
                      ..+.+++|+   +.|+|+...++.+..+|..++.+ +-+.|.|.||||||++.++..|+|.|+.++.|+.+++.   |.|
T Consensus         3 ~~~~~~~V~vi~i~G~I~~~~~~~i~~~l~~a~~~-~~kaivL~IdSPGG~v~~~~~I~~~i~~~~~~v~~~v~~~~~~A   81 (230)
T 3bpp_A            3 PILAKNIVYVAQIKGQITSYTYDQFDRYITIAEQD-NAEAIIIELDTPGGRADAMMNIVQRIQQSKIPVIIYVYPPGASA   81 (230)
T ss_dssp             ---CCSEEEEEEEESSBCHHHHHHHHHHHHHHHHT-TCSEEEEEEEBSCBCHHHHHHHHHHHHTCSSCEEEEECSTTCEE
T ss_pred             CCCCCCEEEEEEEEEEECHHHHHHHHHHHHHHHHC-CCCEEEEEEECCCCCHHHHHHHHHHHHHCCCCCCEEEEECCHHH
T ss_conf             55578979999987688869999999999999768-99869999859881899999999998604678857999734467


Q ss_pred             CCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCC
Q ss_conf             66520000246777145544156644125666655541289999999999999999999871999899999724585888
Q gi|254780272|r  112 ASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS  191 (216)
Q Consensus       112 aS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~~ls  191 (216)
                      +|+|.+|+++|+  ++++.|+|.++.|+|..+..++....+...+....++..+ +.+++.+|++.+.+++.+.+++|++
T Consensus        82 aS~g~~ia~a~d--~i~~~p~s~iGs~gv~~~~~~~~~~~~~~~~~~~~~~~~~-~~~a~~~g~~~~~~~~~v~~~~~~~  158 (230)
T 3bpp_A           82 ASAGTYIALGSH--LIAMAPGTSIGACRPILGYSQNGSIIEAPPAITNYFIAYI-KSLAQESGRNATIAEEFITKDLSLT  158 (230)
T ss_dssp             ETHHHHHHHTSS--EEEECTTCEEECCCCEEECCSSSCCEECCHHHHHHHHHHH-HHHHHHHTSCHHHHHHHHHTCCEEC
T ss_pred             HHHHHHHHHCCC--EEEECCCCCEEECCCCCCCCCCCHHHHHHHHHHHHHHHHH-HHHHHHHCCCHHHHHHHHHCCCCCC
T ss_conf             777899885089--8997899817564542357885026777888899999999-9999993949999998876687864


Q ss_pred             HHHHHHCCCCCEEECCCCCC
Q ss_conf             89999758864460454225
Q gi|254780272|r  192 ASEACDWGVVDKVLMSRIDI  211 (216)
Q Consensus       192 a~EA~eyGliD~Ii~~~~e~  211 (216)
                      ++||+++|++|.|..+..++
T Consensus       159 ~~eA~~~GlvD~i~~~~~~l  178 (230)
T 3bpp_A          159 PEEALKYGVIEVVARDINEL  178 (230)
T ss_dssp             HHHHHHTTSCSEECSSHHHH
T ss_pred             HHHHHHCCCCCEECCCHHHH
T ss_conf             99999819730023899999


No 8  
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A
Probab=99.44  E-value=4e-13  Score=101.93  Aligned_cols=161  Identities=23%  Similarity=0.219  Sum_probs=113.5

Q ss_pred             EEEECCCCCHH-------HHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCC---CCEEEEEECCCCC
Q ss_conf             79987831898-------9999999999974115769769999368761467899999986448---7348998315566
Q gi|254780272|r   44 IVFVTGQIEDH-------MATLICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIK---PPISTFCMGQAAS  113 (216)
Q Consensus        44 iifl~g~I~~~-------~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~glaIyD~i~~i~---~~V~Ti~~G~aaS  113 (216)
                      +|++.|+|.+.       .+..++.+|.-....+.-|-|-|.||||||++.+.-.|++.++..+   .||.+..-+.|||
T Consensus       305 vi~~~G~I~~g~~~~~~~~~~~~~~~l~~a~~d~~vkavvLrInSpGGs~~as~~i~~~i~~~k~~~KPVv~~~~~~aAS  384 (593)
T 3bf0_A          305 VVFANGAIMDGEETQGNVGGDTTAAQIRDARLDPKVKAIVLRVNSPGGSVTASEVIRAELAAARAAGKPVVVSMGGMAAS  384 (593)
T ss_dssp             EEEEEEEEESSSSCTTSEEHHHHHHHHHHHHHCTTEEEEEEEEEEEEECHHHHHHHHHHHHHHHHTTCCEEEEEEEEEET
T ss_pred             EEEEECCEECCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCCCH
T ss_conf             99963424047776787661788999986650754217999997989857789999999999985499789998786641


Q ss_pred             CCCCCCCCCCCCCEEECCCHHH------HHHHHHHH------------HHHHH-----------HHHHHHHHHHHHHHHH
Q ss_conf             5200002467771455441566------44125666------------65554-----------1289999999999999
Q gi|254780272|r  114 MGSLLLSAGEKGMRFALPNARI------LLHQPSGG------------FSGQA-----------SDIERHAQDIVKIKRR  164 (216)
Q Consensus       114 ~aslIl~aG~~g~R~~~pns~i------MiHqps~~------------~~G~~-----------~di~~~a~el~~~~~~  164 (216)
                      .|-.|.++++  +-++.|++.+      +.+.....            ..|..           .+.+.--..++...+.
T Consensus       385 ggY~ia~~ad--~I~A~p~titGSIGV~~~~~~~~~~~~k~Gi~~~~v~~g~~~~~~~~~~~~~e~~~~~q~~~~~~y~~  462 (593)
T 3bf0_A          385 GGYWISTPAN--YIVANPSTLTGSIGIFGVITTVENSLDSIGVHTDGVSTSPLADVSITRALPPEAQLMMQLSIENGYKR  462 (593)
T ss_dssp             HHHHTTTTCS--EEEECTTCEEECCCEEEEEEECHHHHHHTTCEEECCBSCGGGCCCTTSCCCHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHCCC--EEEECCCCEEEECCEEEECCCHHHHHHHCCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             5557653367--47866865144222047515688888867953666543556767866679989999999999999999


Q ss_pred             HHHHHHHHCCCCHHHHHHHHCCCCCCCHHHHHHCCCCCEEECC
Q ss_conf             9999998719998999997245858888999975886446045
Q gi|254780272|r  165 LNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGVVDKVLMS  207 (216)
Q Consensus       165 l~~i~a~~Tg~~~e~i~~~~~rD~~lsa~EA~eyGliD~Ii~~  207 (216)
                      +.+..++.-+.+.+++.+.. +...+++++|++.||||+|-.-
T Consensus       463 F~~~Va~~R~~~~~~v~~ia-~Grv~tg~~A~~~GLVD~iG~~  504 (593)
T 3bf0_A          463 FITLVADARHSTPEQIDKIA-QGHVWTGQDAKANGLVDSLGDF  504 (593)
T ss_dssp             HHHHHHHHTTCCHHHHHTTC-TTCEEEHHHHHHHTSCSEECCH
T ss_pred             HHHHHHHHCCCCHHHHHHHC-CCCEEEHHHHHHCCCCCCCCCH
T ss_conf             99999863699967878755-8758878999886997545999


No 9  
>2f9i_A Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus}
Probab=98.24  E-value=5.4e-06  Score=56.94  Aligned_cols=111  Identities=19%  Similarity=0.252  Sum_probs=79.0

Q ss_pred             HCCCCCCEEEEEECCCCCH----------HHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHH
Q ss_conf             1157697699993687614----------678999999864487348998315566520000246777145544156644
Q gi|254780272|r   68 AENPQKEISLYINSPGGVV----------TAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL  137 (216)
Q Consensus        68 ~~~~~k~I~l~INSpGG~v----------~~glaIyD~i~~i~~~V~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMi  137 (216)
                      ++.=..||--+|++||-..          .+.-...-.|-.++.|+.+|.+|..+|=|++-++.|+  +.++++||.+-+
T Consensus       156 Aekf~~Piit~IDTpGA~pg~~aEe~Gqa~aIA~~l~~~~~l~vP~isvIiGEGgSGGAlal~~ad--~v~mle~a~ysV  233 (327)
T 2f9i_A          156 AEKFNRPIFTFIDTKGAYPGKAAEERGQSESIATNLIEMASLKVPVIAIVIGEGGSGGALGIGIAN--KVLMLENSTYSV  233 (327)
T ss_dssp             HHHTTCCEEEEEEESCSCCCHHHHHTTHHHHHHHHHHHHHTCSSCEEEEEEEEEBHHHHHTTCCCS--EEEEETTCBCBS
T ss_pred             HHHCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEEEECCC--EEEEECCEEEEE
T ss_conf             997499779984279867887744148999999999998589999799997575553113453378--488745718999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHHHHHCCCCCEEECC
Q ss_conf             1256666555412899999999999999999998719998999997245858888999975886446045
Q gi|254780272|r  138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGVVDKVLMS  207 (216)
Q Consensus       138 Hqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~~lsa~EA~eyGliD~Ii~~  207 (216)
                      =.|.+.+.=       -+                +.....++-.+.+    -++|++.+++|+||+||..
T Consensus       234 isPEg~asI-------lw----------------kd~~~a~eAAe~l----klTA~dLl~lGiID~II~E  276 (327)
T 2f9i_A          234 ISPEGAAAL-------LW----------------KDSNLAKIAAETM----KITAHDIKQLGIIDDVISE  276 (327)
T ss_dssp             SCHHHHHHH-------HS----------------SCGGGHHHHHHHH----TCBHHHHHHTTSSSEEECC
T ss_pred             ECHHHHHHH-------HC----------------CCCHHHHHHHHHC----CCCHHHHHHCCCCEEECCC
T ss_conf             566777788-------54----------------5812589999862----0799999977997287169


No 10 
>3lke_A Enoyl-COA hydratase; nysgrc, target 11251J, structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans}
Probab=98.20  E-value=2.4e-05  Score=52.88  Aligned_cols=143  Identities=17%  Similarity=0.184  Sum_probs=87.7

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEE-EEEECC-------CCCHHHH-------------------HHHHHHHHHCCCC
Q ss_conf             318989999999999974115769769-999368-------7614678-------------------9999998644873
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEIS-LYINSP-------GGVVTAG-------------------MAIYDTMQFIKPP  102 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~-l~INSp-------GG~v~~g-------------------laIyD~i~~i~~~  102 (216)
                      .++.++...+...+..++.. +  ++. +.|.+-       |+++.+.                   ..+...+..++.|
T Consensus        27 als~~~~~el~~~l~~~~~d-~--~v~~vVl~g~g~~~FsaG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~pkP  103 (263)
T 3lke_A           27 GLDAELGTSLLEAIRAGNNE-T--SIHSIILQSKHRAYFSSGPRLEDLLICASDQSDVRLREVLHVLNHCVLEIFTSPKV  103 (263)
T ss_dssp             BCCHHHHHHHHHHHHHHHHC-S--SCCEEEEEESCTTEEECBSCHHHHHHHHHCSSSHHHHHHHHHHHHHHHHHHTCSSE
T ss_pred             CCCHHHHHHHHHHHHHHHCC-C--CCEEEEEECCCCCCCCCCCCHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             98999999999999998509-9--95799996389864168862102320011111577888899999999999839998


Q ss_pred             EEEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHH
Q ss_conf             48998315566520000246777145544156644125666655541289999999999999999999871999899999
Q gi|254780272|r  103 ISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEK  182 (216)
Q Consensus       103 V~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~  182 (216)
                      |...+-|.|.+.|+.|.++++  .|++.+++++-+-....|......-.    ..+-           +..|  ..+..+
T Consensus       104 vIaav~G~a~GgG~~lal~~D--~ria~~~a~f~~pe~~~G~~~~~g~~----~~l~-----------r~~G--~~~a~~  164 (263)
T 3lke_A          104 TVALINGYAYGGGFNMMLACD--RRIALRRAKFLENFHKMGISPDLGAS----YFLP-----------RIIG--YEQTMN  164 (263)
T ss_dssp             EEEEECSEEETHHHHGGGGSS--EEEEETTCEEECCHHHHTCCCCTTHH----HHHH-----------HHHC--HHHHHH
T ss_pred             EEEEECCCCCCCCHHHHHHCC--EEEECCCCEECCCCCEECCCCCCCHH----HHHH-----------HHHH--HHHHHH
T ss_conf             999976835606548874020--10224666142631146537782078----9999-----------9976--899999


Q ss_pred             HHCCCCCCCHHHHHHCCCCCEEECCCCCCCCC
Q ss_conf             72458588889999758864460454225101
Q gi|254780272|r  183 TLDRDHIMSASEACDWGVVDKVLMSRIDIEEK  214 (216)
Q Consensus       183 ~~~rD~~lsa~EA~eyGliD~Ii~~~~e~~~~  214 (216)
                      .+-.-.-++|+||.++||||+|+.+..++.+.
T Consensus       165 l~l~g~~~~a~eA~~~Glv~~vv~~~~~l~~~  196 (263)
T 3lke_A          165 LLLEGKLFTSEEALRLGLIQEICENKQELQER  196 (263)
T ss_dssp             HHHHCCCEEHHHHHHHTSSSEEESSHHHHHHH
T ss_pred             HHHCCCCCCCHHHHHCCCCEEEECCHHHHHHH
T ss_conf             99659974331488779724873998999999


No 11 
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.30A {Thermotoga maritima MSB8} SCOP: c.14.1.4 c.14.1.4
Probab=98.18  E-value=4.2e-05  Score=51.32  Aligned_cols=142  Identities=22%  Similarity=0.308  Sum_probs=93.6

Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCC----------CCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCC
Q ss_conf             83189899999999999741157697699993687----------61467899999986448734899831556652000
Q gi|254780272|r   49 GQIEDHMATLICAQLLFLEAENPQKEISLYINSPG----------GVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLL  118 (216)
Q Consensus        49 g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpG----------G~v~~glaIyD~i~~i~~~V~Ti~~G~aaS~aslI  118 (216)
                      |.++.+.+.....-+...+.  -+-||-.++|+||          |.+..|-.+.+++...+.|+.|+.+|.++|.|.+-
T Consensus       344 G~~~~~~a~Kaarfi~lcd~--~~lPlv~lvDtpGf~~G~~aE~~G~~~~gA~l~~a~a~~~vP~i~vi~gk~~Ggg~~a  421 (527)
T 1vrg_A          344 GVLDIDSSDKAARFIRFLDA--FNIPILTFVDTPGYLPGVAQEHGGIIRHGAKLLYAYSEATVPKITVILRKAYGGAYIA  421 (527)
T ss_dssp             GCBCHHHHHHHHHHHHHHHH--TTCCEEEEEEECCBCCCHHHHHTTHHHHHHHHHHHHHHCCSCEEEEEEEEEEHHHHHH
T ss_pred             CCCCCHHHHHHHHHHHHHHC--CCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHH
T ss_conf             88750478999999998514--5986699950688688789999749999999999998389987999868866587761


Q ss_pred             CCCC--CCCCEEECCCHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHHH
Q ss_conf             0246--7771455441566441256666555-412899999999999999999998719998999997245858888999
Q gi|254780272|r  119 LSAG--EKGMRFALPNARILLHQPSGGFSGQ-ASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA  195 (216)
Q Consensus       119 l~aG--~~g~R~~~pns~iMiHqps~~~~G~-~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~~lsa~EA  195 (216)
                      +++.  ....+++.|++++-.=.|.+.+.=- ..+++ .++.-+..++.+.+-|.                +.+.+|..|
T Consensus       422 m~~~~~~~d~~~Awp~a~~~vm~pegaa~i~~~~~~~-a~~~~~~~~~~~~~~~~----------------~~~~~~~~a  484 (527)
T 1vrg_A          422 MGSKHLGADMVLAWPSAEIAVMGPEGAANIIFKREIE-ASSNPEETRRKLIEEYK----------------QQFANPYIA  484 (527)
T ss_dssp             TTCGGGTCSEEEECTTCEEESSCHHHHHHHHTHHHHH-HSSCHHHHHHHHHHHHH----------------HHTSSHHHH
T ss_pred             CCCCCCCCCEEEECCCCEEEECCHHHHHHHHHHHHHH-CCCCHHHHHHHHHHHHH----------------HHHCCHHHH
T ss_conf             0677778888999787718616999999988431211-55798999999999999----------------985799999


Q ss_pred             HHCCCCCEEECCCC
Q ss_conf             97588644604542
Q gi|254780272|r  196 CDWGVVDKVLMSRI  209 (216)
Q Consensus       196 ~eyGliD~Ii~~~~  209 (216)
                      .+.|+||+||+++.
T Consensus       485 a~~~~iD~VIdP~~  498 (527)
T 1vrg_A          485 ASRGYVDMVIDPRE  498 (527)
T ss_dssp             HHTTSSSEECCGGG
T ss_pred             HHCCCCCEEECHHH
T ss_conf             87578881088899


No 12 
>1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A
Probab=98.14  E-value=6.8e-06  Score=56.31  Aligned_cols=140  Identities=15%  Similarity=0.188  Sum_probs=91.8

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCH----------------------HHHHHHHHHHHHCCCCEEEEE
Q ss_conf             3189899999999999741157697699993687614----------------------678999999864487348998
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVV----------------------TAGMAIYDTMQFIKPPISTFC  107 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v----------------------~~glaIyD~i~~i~~~V~Ti~  107 (216)
                      .++.++-..+...+..++..+ + --.+.|.+.|+.+                      .....++..|..++.||...+
T Consensus        35 al~~~~~~el~~~l~~~~~d~-~-~~~vVl~g~g~~~F~~G~d~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~kpvIaav  112 (272)
T 1hzd_A           35 SLSKNLIKMLSKAVDALKSDK-K-VRTIIIRSEVPGIFCAGADLKERAKMSSSEVGPFVSKIRAVINDIANLPVPTIAAI  112 (272)
T ss_dssp             CBCTTHHHHHHHHHHHHHHCS-S-CSEEEEEESBTEEEECCBCHHHHTTSCHHHHHHHHHHHHHHHHHHHTCSSCEEEEE
T ss_pred             CCCHHHHHHHHHHHHHHHHCC-C-CEEEEEECCCCCCCCCCCCCCHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             999999999999999998599-9-64999962788711355100011001203445667789999999997899899997


Q ss_pred             ECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCC
Q ss_conf             31556652000024677714554415664412566665554128999999999999999999987199989999972458
Q gi|254780272|r  108 MGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD  187 (216)
Q Consensus       108 ~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD  187 (216)
                      -|.|.+-|..|.++++  .|++.++++|-+....-|......-..       .+.+.        .|  ...-.+.+-..
T Consensus       113 ~G~a~GgG~~lal~~D--~~ia~~~a~f~~pe~~~Gl~p~~g~~~-------~l~~~--------ig--~~~a~~lll~g  173 (272)
T 1hzd_A          113 DGLALGGGLELALACD--IRVAASSAKMGLVETKLAIIPGGGGTQ-------RLPRA--------IG--MSLAKELIFSA  173 (272)
T ss_dssp             SEEEETHHHHHHHHSS--EEEEETTCEEECCGGGGTCCCCSSHHH-------HHHHH--------HC--HHHHHHHHHHT
T ss_pred             CCEECCCCCEEECCCC--HHHHCCCCEEECCCCCEEECCCCCCCE-------EECHH--------HH--HHHHHHHHHCC
T ss_conf             8803357751100303--223068988977542651367524410-------43034--------43--99998786128


Q ss_pred             CCCCHHHHHHCCCCCEEECCCCC
Q ss_conf             58888999975886446045422
Q gi|254780272|r  188 HIMSASEACDWGVVDKVLMSRID  210 (216)
Q Consensus       188 ~~lsa~EA~eyGliD~Ii~~~~e  210 (216)
                      ..++|+||+++||||+|+.....
T Consensus       174 ~~i~a~eA~~~Glv~~vv~~~~~  196 (272)
T 1hzd_A          174 RVLDGKEAKAVGLISHVLEQNQE  196 (272)
T ss_dssp             CEEEHHHHHHHTSCSEEECCCTT
T ss_pred             CCCCHHHHHHCCCEEEEECCCHH
T ss_conf             84689999757972698486333


No 13 
>2f9y_A Acetyl-COA carboxylase, carboxyltransferase alpha chain; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4
Probab=98.11  E-value=2.8e-05  Score=52.41  Aligned_cols=127  Identities=17%  Similarity=0.199  Sum_probs=86.9

Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCC----------CCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCC
Q ss_conf             83189899999999999741157697699993687----------61467899999986448734899831556652000
Q gi|254780272|r   49 GQIEDHMATLICAQLLFLEAENPQKEISLYINSPG----------GVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLL  118 (216)
Q Consensus        49 g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpG----------G~v~~glaIyD~i~~i~~~V~Ti~~G~aaS~aslI  118 (216)
                      |.++.+-... ...++-+ .+.-.-||--+|++||          |-..++-....+|-.++.|+.+|.+|.++|-|++-
T Consensus       153 G~~~pegyrK-A~R~m~l-aekf~iPIit~vDTpGa~pG~~aEerG~~~aiA~~l~~~~~l~VP~IsvVigeg~sGGAla  230 (339)
T 2f9y_A          153 GMPAPEGYRK-ALRLMQM-AERFKMPIITFIDTPGAYPGVGAEERGQSEAIARNLREMSRLGVPVVCTVIGEGGSGGALA  230 (339)
T ss_dssp             GCCCHHHHHH-HHHHHHH-HHHTTCCEEEEEEESCSCCSHHHHHTTHHHHHHHHHHHHHTCSSCEEEEEEEEEEHHHHHT
T ss_pred             CCCCHHHHHH-HHHHHHH-HHHCCCCEEEEEECCCCCCCCHHHHCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCEE
T ss_conf             8888799999-9999999-9973996699852798688700022379999999999997699987999977644543211


Q ss_pred             CCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHHHHHC
Q ss_conf             02467771455441566441256666555412899999999999999999998719998999997245858888999975
Q gi|254780272|r  119 LSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDW  198 (216)
Q Consensus       119 l~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~~lsa~EA~ey  198 (216)
                      ++.++  +.++++||.+-.=.|.+.+.=-       +                +.....++..+.+    -++|++.+++
T Consensus       231 m~~~D--~vlmle~A~ySVisPEg~AsIL-------w----------------rd~~~a~~AAe~l----kita~dl~~~  281 (339)
T 2f9y_A          231 IGVGD--KVNMLQYSTYSVISPEGCASIL-------W----------------KSADKAPLAAEAM----GIIRPRLKEL  281 (339)
T ss_dssp             TCCCS--EEEECTTCEEESSCHHHHHHHH-------S----------------SCSTTHHHHHHHH----TCSHHHHHTT
T ss_pred             ECCCC--HHHCCHHHHHEEECHHHCHHHC-------C----------------CCHHHHHHHHHHH----HHCHHHHHHC
T ss_conf             13521--4312302250362433210000-------4----------------7712459999998----7379999977


Q ss_pred             CCCCEEEC
Q ss_conf             88644604
Q gi|254780272|r  199 GVVDKVLM  206 (216)
Q Consensus       199 GliD~Ii~  206 (216)
                      |+||+||.
T Consensus       282 giID~II~  289 (339)
T 2f9y_A          282 KLIDSIIP  289 (339)
T ss_dssp             TSCSCCCC
T ss_pred             CCCEEEEC
T ss_conf             99718705


No 14 
>3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative; 1.76A {Bordetella parapertussis}
Probab=98.08  E-value=5.7e-05  Score=50.45  Aligned_cols=162  Identities=13%  Similarity=0.098  Sum_probs=98.4

Q ss_pred             CCCCCEEEEECCCCCCC-CCHHHHHHCCCEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCC------CCHHH
Q ss_conf             24575797665998401-220034514677998783189899999999999741157697699993687------61467
Q gi|254780272|r   16 LGLVPMVVEQTNRGERS-YDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYINSPG------GVVTA   88 (216)
Q Consensus        16 ~~~~p~~~e~~~~~~~~-~Di~s~L~~~Riifl~g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpG------G~v~~   88 (216)
                      ....|..+|+++.-... +|=+.+         ...++.++...+...+-.++.  ++ ---+.|.+.|      +++.+
T Consensus         4 s~~~~l~~e~~~~v~tiTlnrP~~---------~Nal~~~m~~el~~al~~~~~--~~-v~~vVltg~g~~F~aG~Dl~~   71 (254)
T 3isa_A            4 SASLPLAIERRPAAWTFTLSRPEK---------RNALSAELVEALIDGVDAAHR--EQ-VPLLVFAGAGRNFSAGFDFTD   71 (254)
T ss_dssp             CCCCSEEEEECSSEEEEEECCGGG---------TTCBCHHHHHHHHHHHHHHHH--TT-CSEEEEEESTTCSCCCBCCTT
T ss_pred             CCCCCEEEEEECCEEEEEECCCCC---------CCCCCHHHHHHHHHHHHHHHC--CC-CEEEEEECCCCCCCCCCCHHH
T ss_conf             888726999889999999557565---------789999999999999999757--99-549999788997116987043


Q ss_pred             ---------------HHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             ---------------89999998644873489983155665200002467771455441566441256666555412899
Q gi|254780272|r   89 ---------------GMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIER  153 (216)
Q Consensus        89 ---------------glaIyD~i~~i~~~V~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~  153 (216)
                                     ...++..|..++.||...+-|.|.+.|..+.++++  .|++.++++|-+-...-|...   -.  
T Consensus        72 ~~~~~~~~~~~~~~~~~~l~~~i~~~~kPvIaav~G~a~GgG~~lal~~D--~ria~~~a~f~~pe~~~Gl~p---g~--  144 (254)
T 3isa_A           72 YETQSEGDLLLRMVRIEMLLQRVAGSPSLTLALAHGRNFGAGVDLFAACK--WRYCTPEAGFRMPGLKFGLVL---GT--  144 (254)
T ss_dssp             CTTSCHHHHHHHHHHHHHHHHHHHTCSSEEEEEECSEEETHHHHHHHHSS--EEEECTTCEEECCGGGGTCCC---SH--
T ss_pred             HCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCEEECCCCCCCCCC--EEEECCCCCCCCCCEEEEECC---CC--
T ss_conf             10110012456678999999999858998999679718764762355577--689765435557510250057---76--


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHHHHHCCCCCEEECCCCCCC
Q ss_conf             99999999999999999871999899999724585888899997588644604542251
Q gi|254780272|r  154 HAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGVVDKVLMSRIDIE  212 (216)
Q Consensus       154 ~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~~lsa~EA~eyGliD~Ii~~~~e~~  212 (216)
                        .   .+        .+..|.  .+-.+.+-....++|+||+++||||+|+.. .+++
T Consensus       145 --~---~l--------~r~iG~--~~A~~llltg~~~~a~eA~~~GLv~~vv~~-~~l~  187 (254)
T 3isa_A          145 --R---RF--------RDIVGA--DQALSILGSARAFDADEARRIGFVRDCAAQ-AQWP  187 (254)
T ss_dssp             --H---HH--------HHHHCH--HHHHHHHTTTCEEEHHHHHHTTSSSEECCG-GGHH
T ss_pred             --C---CC--------HHHCCH--HHHHHHHHHCCCCCHHHHHHCCCHHEECCH-HHHH
T ss_conf             --5---43--------444169--999999860677677899976973156288-7999


No 15 
>3h02_A Naphthoate synthase; IDP00995, lyase, structural genomics, center for structural genomics of infectious diseases, csgid; 2.15A {Salmonella typhimurium}
Probab=98.02  E-value=2.4e-05  Score=52.86  Aligned_cols=139  Identities=14%  Similarity=0.088  Sum_probs=89.5

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHH------------------------HHHHHHHHHHCCCCEEE
Q ss_conf             318989999999999974115769769999368761467------------------------89999998644873489
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTA------------------------GMAIYDTMQFIKPPIST  105 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~------------------------glaIyD~i~~i~~~V~T  105 (216)
                      .++.++...+...|..++.. ++ ---+.|.+.|+.+++                        ...++..|..++.||..
T Consensus        50 als~~m~~eL~~~l~~~~~d-~~-v~~vVl~g~g~~~F~aG~d~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~kPvIa  127 (288)
T 3h02_A           50 AFRPLTVKEMIQALADARYD-DN-VGVIILTGEGDKAFCAGGDQKVRGDYGGYQDDSGVHHLNVLDFQRQIRTCPKPVVA  127 (288)
T ss_dssp             CBCHHHHHHHHHHHHHHHHC-TT-CCEEEEEESSSSEEECCBCC---------------CCCTHHHHHHHHHHCSSCEEE
T ss_pred             CCCHHHHHHHHHHHHHHHHC-CC-CCEEEEECCCCCCEECCCCHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             99999999999999999739-99-66899987999742346307766432544201456553236899999709998999


Q ss_pred             EEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHC
Q ss_conf             98315566520000246777145544156644125666655541289999999999999999999871999899999724
Q gi|254780272|r  106 FCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD  185 (216)
Q Consensus       106 i~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~  185 (216)
                      .+-|.|.+.|..|.++++  .|++.++++|-+....-|......-.       ..+.+.        .|  .....+.+-
T Consensus       128 av~G~a~GgG~~la~~cD--~~ia~~~a~f~~pe~~~Gl~p~~~~~-------~~l~~~--------ig--~~~a~~l~l  188 (288)
T 3h02_A          128 MVAGYSIGGGHVLHMMCD--LTIAAENAIFGQTGPKVGSFDGGWGA-------SYMARI--------VG--QKKAREIWF  188 (288)
T ss_dssp             EECSEEETHHHHHHHHSS--EEEEETTCEEECCGGGGTCCCCSHHH-------HHHHHH--------HC--HHHHHHHHH
T ss_pred             EECCEEEEHHHHHHHHCC--EEECCCCCEEECHHHHHCCCCCHHHH-------HHHHHH--------HC--HHHHHHHHH
T ss_conf             988987506389987357--10416985898724421767866589-------999998--------48--999999997


Q ss_pred             CCCCCCHHHHHHCCCCCEEECCCC
Q ss_conf             585888899997588644604542
Q gi|254780272|r  186 RDHIMSASEACDWGVVDKVLMSRI  209 (216)
Q Consensus       186 rD~~lsa~EA~eyGliD~Ii~~~~  209 (216)
                      .-..++|+||+++||||+|+....
T Consensus       189 tg~~~~a~eA~~~Glv~~v~~~~~  212 (288)
T 3h02_A          189 LCRQYDAQQALDMGLVNTVVPLAD  212 (288)
T ss_dssp             HCCCEEHHHHHHTTSSSEEECGGG
T ss_pred             CCCCCCHHHHHHCCCEEEECCHHH
T ss_conf             598415999998899878546366


No 16 
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A*
Probab=98.02  E-value=0.00013  Score=48.24  Aligned_cols=143  Identities=17%  Similarity=0.242  Sum_probs=93.9

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCC----------CCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCC
Q ss_conf             783189899999999999741157697699993687----------6146789999998644873489983155665200
Q gi|254780272|r   48 TGQIEDHMATLICAQLLFLEAENPQKEISLYINSPG----------GVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSL  117 (216)
Q Consensus        48 ~g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpG----------G~v~~glaIyD~i~~i~~~V~Ti~~G~aaS~asl  117 (216)
                      +|.++.+.+.....-+..-++.  +-||-.++|.||          |-+..|-.+.+++...+.|..|+.+|.+++.|.+
T Consensus       339 ~G~l~~~~a~Kaarfi~lcd~~--~iPlv~lvD~pGf~~G~~~E~~Gi~~~gA~~~~A~a~a~vP~isvi~~k~~G~g~~  416 (523)
T 1on3_A          339 SGCLDINASDKAAEFVNFCDSF--NIPLVQLVDVPGFLPGVQQEYGGIIRHGAKMLYAYSEATVPKITVVLRKAYGGSYL  416 (523)
T ss_dssp             GGCBCHHHHHHHHHHHHHHHHT--TCCEEEEEEECCBCCCHHHHHTTHHHHHHHHHHHHHHCCSCEEEEEEEEEEHHHHH
T ss_pred             CCCCCCHHHHHHHHHHHHHHHC--CCEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHH
T ss_conf             6888706789999999988742--87789994278767778999976999999999985367998799985774450231


Q ss_pred             CCCCCC--CCCEEECCCHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHH
Q ss_conf             002467--7714554415664412566665554-1289999999999999999999871999899999724585888899
Q gi|254780272|r  118 LLSAGE--KGMRFALPNARILLHQPSGGFSGQA-SDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE  194 (216)
Q Consensus       118 Il~aG~--~g~R~~~pns~iMiHqps~~~~G~~-~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~~lsa~E  194 (216)
                      -+++..  ....|+.|++++-.=.|.+.+.=-. .+++ .++.-+..+.              +++++.  .+.+.+|-.
T Consensus       417 am~~~~~~~d~~~AwP~a~~~vm~pegaa~i~~r~~~~-a~~~~~~~~~--------------~~~~~~--~~~~~~~~~  479 (523)
T 1on3_A          417 AMCNRDLGADAVYAWPSAEIAVMGAEGAANVIFRKEIK-AADDPDAMRA--------------EKIEEY--QNAFNTPYV  479 (523)
T ss_dssp             TTTCGGGTCSEEEECTTCEEESSCHHHHHHHHTHHHHH-HSSCHHHHHH--------------HHHHHH--HHHHSSHHH
T ss_pred             CCCCCCCCCCEEEECCCCEEEECCHHHHHHHHHCCCCC-CCCCHHHHHH--------------HHHHHH--HHHHCCHHH
T ss_conf             24677788787998675559845999999987412101-7679899999--------------999999--987579999


Q ss_pred             HHHCCCCCEEECCCC
Q ss_conf             997588644604542
Q gi|254780272|r  195 ACDWGVVDKVLMSRI  209 (216)
Q Consensus       195 A~eyGliD~Ii~~~~  209 (216)
                      |.+.|+||+||+++.
T Consensus       480 aa~~g~iD~VIdP~~  494 (523)
T 1on3_A          480 AAARGQVDDVIDPAD  494 (523)
T ss_dssp             HHHTTSSSEECCGGG
T ss_pred             HHHCCCCCEEECHHH
T ss_conf             986678884288799


No 17 
>2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on protein structural and functional analyses; 2.00A {Geobacillus kaustophilus}
Probab=97.97  E-value=6.1e-05  Score=50.27  Aligned_cols=140  Identities=18%  Similarity=0.198  Sum_probs=91.1

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEEE-EECCC------CCHH--------------HHHHHHHHHHHCCCCEEEEEE
Q ss_conf             31898999999999997411576976999-93687------6146--------------789999998644873489983
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISLY-INSPG------GVVT--------------AGMAIYDTMQFIKPPISTFCM  108 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l~-INSpG------G~v~--------------~glaIyD~i~~i~~~V~Ti~~  108 (216)
                      .++.++-..+...+..++..+   ++.+. +.+.|      +++.              ....+++.|..++.||...+-
T Consensus        26 al~~~~~~~l~~~l~~~~~d~---~v~vvvl~g~~~~F~aG~Dl~~~~~~~~~~~~~~~~~~~l~~~l~~~~kP~Iaav~  102 (257)
T 2ej5_A           26 AFTEQMNAEVTKALKQAGADP---NVRCVVITGAGRAFCAGEDLSGVTEEMDHGDVLRSRYAPMMKALHHLEKPVVAAVN  102 (257)
T ss_dssp             CBCHHHHHHHHHHHHHHHHCT---TCCEEEEEESSSCSBCCBCC-------CHHHHHHHTHHHHHHHHHHCCSCEEEEEC
T ss_pred             CCCHHHHHHHHHHHHHHHHCC---CEEEEEEECCCCCCCCCCCHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEC
T ss_conf             999999999999999996498---90899997899886577767986420001356776667899987536995999978


Q ss_pred             CCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCC
Q ss_conf             15566520000246777145544156644125666655541289999999999999999999871999899999724585
Q gi|254780272|r  109 GQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH  188 (216)
Q Consensus       109 G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~  188 (216)
                      |.|.+.|..|.++++  .|++.+++++-+....-|......-..       .        +.+..|.  ....+.+-.-.
T Consensus       103 G~a~GgG~~lal~~D--~~ia~~~a~f~~pe~~~Gi~p~~g~~~-------~--------l~~~~g~--~~a~~l~l~g~  163 (257)
T 2ej5_A          103 GAAAGAGMSLALACD--FRLLSEKASFAPAFIHVGLVPDAGHLY-------Y--------LPRLVGR--AKALELAVLGE  163 (257)
T ss_dssp             SEEETHHHHHHHHSS--EEEEETTCEEECCGGGGTCCCCTTHHH-------H--------HHHHHCH--HHHHHHHHHCC
T ss_pred             CEEEHHHHHHHHHCC--EEEECCCCEEECHHHCCCCCCCCCHHH-------H--------HHHHHCC--CHHHHHHHCCC
T ss_conf             846468899998506--898368878983432618688603999-------9--------9999574--02667864179


Q ss_pred             CCCHHHHHHCCCCCEEECCCCCCC
Q ss_conf             888899997588644604542251
Q gi|254780272|r  189 IMSASEACDWGVVDKVLMSRIDIE  212 (216)
Q Consensus       189 ~lsa~EA~eyGliD~Ii~~~~e~~  212 (216)
                      .++|+||.++|+||+|+.. .++.
T Consensus       164 ~~~a~eA~~~Glv~~v~~~-~~l~  186 (257)
T 2ej5_A          164 KVTAEEAAALGLATKVIPL-SDWE  186 (257)
T ss_dssp             CEEHHHHHHHTCCSEEECG-GGHH
T ss_pred             CCCHHHHHHCCCEEEEECH-HHHH
T ss_conf             8988899878963897287-8999


No 18 
>3gow_A PAAG, probable enoyl-COA hydratase; the spiral fold, the crotonase superfamily, lyase; 1.85A {Thermus thermophilus HB8} PDB: 3hrx_A
Probab=97.97  E-value=7.4e-05  Score=49.77  Aligned_cols=141  Identities=18%  Similarity=0.181  Sum_probs=89.5

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHH--------------------HHHHHHHHHHHCCCCEEEEEEC
Q ss_conf             31898999999999997411576976999936876146--------------------7899999986448734899831
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVT--------------------AGMAIYDTMQFIKPPISTFCMG  109 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~--------------------~glaIyD~i~~i~~~V~Ti~~G  109 (216)
                      .++.++-..+...+-.++..+ +- -.+.|.+.|+...                    ....++..|..++.||...+-|
T Consensus        23 als~~~~~~l~~al~~~~~d~-~v-~~vvl~~~g~~f~~g~dl~~~~~~~~~~~~~~~~~~~~~~~l~~~~kPvIa~v~G  100 (254)
T 3gow_A           23 AITGELLDALYAALKEGEEDR-EV-RALLLTGAGRAFSAGQDLTEFGDRKPDYEAHLRRYNRVVEALSGLEKPLVVAVNG  100 (254)
T ss_dssp             CBCHHHHHHHHHHHHHHHHCT-TC-CEEEEEESTTCSBCCBCGGGTTTSCCCHHHHTHHHHHHHHHHHTCSSCEEEEECS
T ss_pred             CCCHHHHHHHHHHHHHHHHCC-CE-EEEEEECCCCCCCCCCHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             999999999999999997688-93-8999967898756563056521452357899999999999997199989999878


Q ss_pred             CCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCC
Q ss_conf             55665200002467771455441566441256666555412899999999999999999998719998999997245858
Q gi|254780272|r  110 QAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI  189 (216)
Q Consensus       110 ~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~~  189 (216)
                      .|.+-|+.|.++++  .|++.++++|-+-...-|..-...-.    ..+.           +..|  .....+.+-.-..
T Consensus       101 ~a~GgG~~la~~cD--~ria~~~a~f~~pe~~~Gl~p~~g~~----~~l~-----------~~vG--~~~a~~~~ltg~~  161 (254)
T 3gow_A          101 VAAGAGMSLALWGD--LRLAAVGASFTTAFVRIGLVPDSGLS----FLLP-----------RLVG--LAKAQELLLLSPR  161 (254)
T ss_dssp             EEETHHHHHHTTCS--EEEEETTCEEECCGGGGTCCCCTTHH----HHHH-----------HHHC--HHHHHHHHHHCCC
T ss_pred             EEEHHHHHHHHCCC--EEEECCCCEEECHHCCCCCCCCCCHH----HHHH-----------HHHC--HHHHHHHHHCCCE
T ss_conf             42125488775255--15873887898611075768752499----9999-----------9867--6679999863953


Q ss_pred             CCHHHHHHCCCCCEEECCCCCCC
Q ss_conf             88899997588644604542251
Q gi|254780272|r  190 MSASEACDWGVVDKVLMSRIDIE  212 (216)
Q Consensus       190 lsa~EA~eyGliD~Ii~~~~e~~  212 (216)
                      ++|+||.++||||+|+.. .++.
T Consensus       162 ~~a~eA~~~Glv~~vv~~-~~l~  183 (254)
T 3gow_A          162 LSAEEALALGLVHRVVPA-EKLM  183 (254)
T ss_dssp             EEHHHHHHHTSCSEEECG-GGHH
T ss_pred             ECHHHHHHCCCEEEEECC-HHHH
T ss_conf             259999987997998273-6568


No 19 
>2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, structural genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3
Probab=97.96  E-value=0.00012  Score=48.37  Aligned_cols=140  Identities=18%  Similarity=0.189  Sum_probs=89.3

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHH-------------------------HHHHHHHHHCCCCEE
Q ss_conf             3189899999999999741157697699993687614678-------------------------999999864487348
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAG-------------------------MAIYDTMQFIKPPIS  104 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~g-------------------------laIyD~i~~i~~~V~  104 (216)
                      .++.++-..+...|-.++. |  ..+.+.|.+.|+...+|                         ..++..|..++.||.
T Consensus        49 als~~~~~el~~~l~~~~~-d--~~v~vVl~g~g~~FsaG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~kPvI  125 (280)
T 2f6q_A           49 AINTEMYHEIMRALKAASK-D--DSIITVLTGNGDYYSSGNDLTNFTDIPPGGVEEKAKNNAVLLREFVGCFIDFPKPLI  125 (280)
T ss_dssp             CBCHHHHHHHHHHHHHHHH-S--SCSEEEEEESTTCSBCCBCC----CCCTTHHHHHHHHHHHHHHHHHHHHHSCCSCEE
T ss_pred             CCCHHHHHHHHHHHHHHHC-C--CCEEEEEECCCCCCCCCCCHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEE
T ss_conf             9899999999999998744-9--998999968998776898678874132233201457789999999999996899889


Q ss_pred             EEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             99831556652000024677714554415664412566665554128999999999999999999987199989999972
Q gi|254780272|r  105 TFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTL  184 (216)
Q Consensus       105 Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~  184 (216)
                      ..+-|.|.+.|..|.++++  .|++.++++|-+-...-|......-    ..   +        +.+..|.  ....+.+
T Consensus       126 aav~G~a~GgG~~lal~~D--~~ia~~~a~f~~pe~~~Gi~p~~g~----~~---~--------l~~~vG~--~~a~~ll  186 (280)
T 2f6q_A          126 AVVNGPAVGISVTLLGLFD--AVYASDRATFHTPFSHLGQSPEGCS----SY---T--------FPKIMSP--AKATEML  186 (280)
T ss_dssp             EEECSCEETHHHHGGGGCS--EEEEETTCEEECCTGGGTCCCCTTH----HH---H--------HHHHHCH--HHHHHHH
T ss_pred             EEECCEEEECCCCCCCCCC--CCCCCCCCEEECHHHCCCCCCCCCH----HH---H--------HHHHHCH--HHHHHHH
T ss_conf             9976868755541003445--3220568589761432585845166----89---9--------7776186--7779998


Q ss_pred             CCCCCCCHHHHHHCCCCCEEECCCCCCC
Q ss_conf             4585888899997588644604542251
Q gi|254780272|r  185 DRDHIMSASEACDWGVVDKVLMSRIDIE  212 (216)
Q Consensus       185 ~rD~~lsa~EA~eyGliD~Ii~~~~e~~  212 (216)
                      -.-..++|+||+++||||+|+.. .++.
T Consensus       187 l~g~~~~a~eA~~~Glv~~vv~~-~~l~  213 (280)
T 2f6q_A          187 IFGKKLTAGEACAQGLVTEVFPD-STFQ  213 (280)
T ss_dssp             TTCCCEEHHHHHHTTSCSEEECT-TTHH
T ss_pred             HCCCCCCHHHHHHCCCEEEEECH-HHHH
T ss_conf             72798989999877993588085-7999


No 20 
>3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis}
Probab=97.95  E-value=2.1e-05  Score=53.16  Aligned_cols=137  Identities=14%  Similarity=0.155  Sum_probs=87.6

Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHH----------------HHHHHHHHHHCCCCEEEEEECCCC
Q ss_conf             8318989999999999974115769769999368761467----------------899999986448734899831556
Q gi|254780272|r   49 GQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTA----------------GMAIYDTMQFIKPPISTFCMGQAA  112 (216)
Q Consensus        49 g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~----------------glaIyD~i~~i~~~V~Ti~~G~aa  112 (216)
                      -.++.++...+...|-.+  +|++ ---+.|.+.|+...+                ...++..|..++.||...+-|.|.
T Consensus        43 Nal~~~m~~eL~~~l~~~--~d~~-vr~vVl~g~g~~F~aG~Dl~~~~~~~~~~~~~~~~~~~i~~~~kpvIaav~G~a~  119 (264)
T 3he2_A           43 NALNSQLVEELTQAIRKA--GDGS-ARAIVLTGQGTAFCAGADLSGDAFAADYPDRLIELHKAMDASPMPVVGAINGPAI  119 (264)
T ss_dssp             TCBCHHHHHHHHHHHHCC-----C-CSEEEEEESSSCSBCCBCCTTCTTGGGHHHHHHHHHHHHHHCSSCEEEEECSCEE
T ss_pred             CCCCHHHHHHHHHHHHHC--CCCC-CEEEEEECCCCCCCCCCCCHHHHHCCCCHHHHHHHHHHHHHCCCCEEEEECCEEE
T ss_conf             898999999999999970--1899-5599996899851345454344430103589999999998589989999778564


Q ss_pred             CCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCH
Q ss_conf             65200002467771455441566441256666555412899999999999999999998719998999997245858888
Q gi|254780272|r  113 SMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSA  192 (216)
Q Consensus       113 S~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~~lsa  192 (216)
                      +-|.-|.++++  .|++.++++|-+-...-|..   .+.-.    ...+.+        ..|  .....+.+-.-..++|
T Consensus       120 GgG~~lal~~D--~~ia~~~a~f~~pe~~~G~~---p~~g~----~~~l~~--------~iG--~~~a~~lll~g~~~~a  180 (264)
T 3he2_A          120 GAGLQLAMQCD--LRVVAPDAFFQFPTSKYGLA---LDNWS----IRRLSS--------LVG--HGRARAMLLSAEKLTA  180 (264)
T ss_dssp             THHHHHHHHSS--EEEECTTCEEECTHHHHTCC---CCHHH----HHHHHH--------HHC--HHHHHHHHHHCCCEEH
T ss_pred             HHHHHHHHHCC--EEEEECCCCCCCCCCCEEEC---CCHHH----HHHHHH--------HCC--CHHHHHHHHCCCCCCH
T ss_conf             48899998446--66520344454740123006---77168----889999--------819--1677899983897888


Q ss_pred             HHHHHCCCCCEEECC
Q ss_conf             999975886446045
Q gi|254780272|r  193 SEACDWGVVDKVLMS  207 (216)
Q Consensus       193 ~EA~eyGliD~Ii~~  207 (216)
                      +||.++||||+|+..
T Consensus       181 ~eA~~~GLv~~v~~~  195 (264)
T 3he2_A          181 EIALHTGMANRIGTL  195 (264)
T ss_dssp             HHHHHHTSCSEECCH
T ss_pred             HHHHHCCCCCEECCH
T ss_conf             999768946385467


No 21 
>2iex_A Dihydroxynapthoic acid synthetase; crotonase-like family, beta-BETA-alpha, coenzyme biosyntheses, naphthoate synthase; 2.20A {Geobacillus kaustophilus HTA426} PDB: 2uzf_A*
Probab=97.95  E-value=8.4e-05  Score=49.40  Aligned_cols=139  Identities=18%  Similarity=0.194  Sum_probs=89.8

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHH-----------------------HHHHHHHHHHCCCCEEEE
Q ss_conf             318989999999999974115769769999368761467-----------------------899999986448734899
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTA-----------------------GMAIYDTMQFIKPPISTF  106 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~-----------------------glaIyD~i~~i~~~V~Ti  106 (216)
                      .++.++-..+...|..++..+ + ---+.|.+.|+...+                       ...++..|..++.||...
T Consensus        35 als~~m~~~l~~al~~~~~d~-~-v~~vvl~g~g~~f~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~kPvIAa  112 (272)
T 2iex_A           35 AFRPKTVNEMIDAFTKARDDS-N-IGVIILTGAGGKAFCSGGDQKVRGHGGYVGEDEIPRLNVLDLQRLIRVIPKPVIAM  112 (272)
T ss_dssp             CBCHHHHHHHHHHHHHHHHCT-T-CCEEEEEESSSSEEECCBC---------------CCCTHHHHHHHHHHSSSCEEEE
T ss_pred             CCCHHHHHHHHHHHHHHHHCC-C-CEEEEEECCCCCCCCCCCCHHHHHCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             989999999999999986199-9-55999843786540037718776035642024567777778999998399989999


Q ss_pred             EECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHH
Q ss_conf             831556652000024677714554415664412566665---55412899999999999999999998719998999997
Q gi|254780272|r  107 CMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFS---GQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKT  183 (216)
Q Consensus       107 ~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~---G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~  183 (216)
                      +-|.|.+.|..|.++++  .|++.++++|-+-...-|..   |-..       .+.   +.+        |  .....+.
T Consensus       113 v~G~a~GgG~~lal~~D--~ria~~~a~f~~pe~~lGl~p~~~~~~-------~l~---r~v--------g--~~~a~~l  170 (272)
T 2iex_A          113 VAGYAIGGGHVLHVVCD--LTIAADNAIFGQTGPKVGSFDGGYGAG-------YLA---RIV--------G--HKKAREI  170 (272)
T ss_dssp             ECSEEETHHHHHHHHSS--EEEEETTCEEECCHHHHTCCCCSTTTH-------HHH---HHH--------C--HHHHHHH
T ss_pred             ECCEEEHHHHHHHHCCC--CCEECCCCEEECCCCCCCCCCCHHHHH-------HHH---HHH--------H--HHHHHHH
T ss_conf             88984378999986036--445668878987500134076601578-------999---997--------2--9999999


Q ss_pred             HCCCCCCCHHHHHHCCCCCEEECCCCCCCC
Q ss_conf             245858888999975886446045422510
Q gi|254780272|r  184 LDRDHIMSASEACDWGVVDKVLMSRIDIEE  213 (216)
Q Consensus       184 ~~rD~~lsa~EA~eyGliD~Ii~~~~e~~~  213 (216)
                      +-.-.-++|+||+++|+||+|+.. .++.+
T Consensus       171 ll~g~~i~a~eA~~~Glv~~v~~~-~~l~~  199 (272)
T 2iex_A          171 WYLCRQYTAQEALEMGLVNKVVPL-EQLEE  199 (272)
T ss_dssp             HHHCCCEEHHHHHHTTSSSEEECG-GGHHH
T ss_pred             HHCCCCCCHHHHHHCCCEEEEECH-HHHHH
T ss_conf             970886569999767997698077-89999


No 22 
>2fbm_A Y chromosome chromodomain protein 1, telomeric isoform B; acetyltransferase, structural genomics, structural genomics consortium, SGC; 2.28A {Homo sapiens} SCOP: c.14.1.3
Probab=97.94  E-value=7.3e-05  Score=49.81  Aligned_cols=141  Identities=19%  Similarity=0.212  Sum_probs=90.2

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECC------CCCHHH-------------------HHHHHHHHHHCCCCEE
Q ss_conf             318989999999999974115769769999368------761467-------------------8999999864487348
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISLYINSP------GGVVTA-------------------GMAIYDTMQFIKPPIS  104 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSp------GG~v~~-------------------glaIyD~i~~i~~~V~  104 (216)
                      .++.++-..+...|..++.. +.+  .+.|.+.      |+++..                   ...++..|..++.||.
T Consensus        47 al~~~~~~eL~~al~~~~~d-~~~--~vVltg~g~~F~aG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~kPvI  123 (291)
T 2fbm_A           47 ALNTEVIKEIVNALNSAAAD-DSK--LVLFSAAGSVFCCGLDFGYFVKHLRNNRNTASLEMVDTIKNFVNTFIQFKKPIV  123 (291)
T ss_dssp             CBCHHHHHHHHHHHHHHHHS-SCS--EEEEEECSSCSBCCBCHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHCCSCEE
T ss_pred             CCCHHHHHHHHHHHHHHHHC-CCE--EEEEECCCCCEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEE
T ss_conf             98999999999999998739-987--999978899567488755453222232102379999999999999986799899


Q ss_pred             EEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             99831556652000024677714554415664412566665554128999999999999999999987199989999972
Q gi|254780272|r  105 TFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTL  184 (216)
Q Consensus       105 Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~  184 (216)
                      ..+-|.|.+.|+.|+++++  .|++.++++|-+-....|..-...-.    .   .+.+        .-|.  ....+.+
T Consensus       124 Aav~G~a~GgG~~lal~cD--~ria~~~a~f~~pe~~~Gi~p~~~~~----~---~l~r--------~iG~--~~a~~ll  184 (291)
T 2fbm_A          124 VSVNGPAIGLGASILPLCD--LVWANEKAWFQTPYTTFGQSPDGCSS----I---TFPK--------MMGK--ASANEML  184 (291)
T ss_dssp             EEECSCEETHHHHTGGGSS--EEEEETTCEEECCHHHHTCCCCTTHH----H---HHHH--------HHCH--HHHHHHH
T ss_pred             EEECCEECCCCCCEEECCC--EECCCHHHHHHHHHCEECCCCCCCCC----C---CHHH--------HCCH--HHHHHHH
T ss_conf             9979910318873002356--53014433323112000653465443----1---0045--------5045--6887999


Q ss_pred             CCCCCCCHHHHHHCCCCCEEECCCCCCCC
Q ss_conf             45858888999975886446045422510
Q gi|254780272|r  185 DRDHIMSASEACDWGVVDKVLMSRIDIEE  213 (216)
Q Consensus       185 ~rD~~lsa~EA~eyGliD~Ii~~~~e~~~  213 (216)
                      -.-..++|+||+++||||+|+.. .++.+
T Consensus       185 ltg~~~~a~eA~~~Glv~~vv~~-~~l~~  212 (291)
T 2fbm_A          185 IAGRKLTAREACAKGLVSQVFLT-GTFTQ  212 (291)
T ss_dssp             TSCCEEEHHHHHHTTSCSEEECS-TTSHH
T ss_pred             HCCCCCCHHHHHHCCCCCEEECH-HHHHH
T ss_conf             80872459999984993087082-68999


No 23 
>2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA; 1.80A {Geobacillus kaustophilus HTA426} PDB: 2qq3_A
Probab=97.93  E-value=3.5e-05  Score=51.80  Aligned_cols=141  Identities=20%  Similarity=0.196  Sum_probs=89.0

Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHH-------------------HHHHHHHHHHCCCCEEEEEEC
Q ss_conf             8318989999999999974115769769999368761467-------------------899999986448734899831
Q gi|254780272|r   49 GQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTA-------------------GMAIYDTMQFIKPPISTFCMG  109 (216)
Q Consensus        49 g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~-------------------glaIyD~i~~i~~~V~Ti~~G  109 (216)
                      -.++.++-..+...+-.++.. ++ ---+.|.+.|+...+                   .+.++..+...+.||...+-|
T Consensus        27 Nal~~~~~~~l~~~l~~~~~d-~~-~~~vvl~~~~~~f~~g~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~Iaai~G  104 (258)
T 2pbp_A           27 NALSRQMVAEIVAAVEAFDRN-EK-VRVIVLTGRGRAFAAGADIQEMAKDDPIRLEWLNQFADWDRLSIVKTPMIAAVNG  104 (258)
T ss_dssp             TCCCHHHHHHHHHHHHHHHHC-TT-CCEEEEEESTTEEECCCCHHHHHTCCHHHHHHHCTTHHHHHHHTCCSCEEEEECS
T ss_pred             CCCCHHHHHHHHHHHHHHHCC-CC-EEEEEEECCCCCEECCCCHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             999999999999999998609-98-5899990798640127538877313211467777767889985189988999806


Q ss_pred             CCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCC
Q ss_conf             55665200002467771455441566441256666555412899999999999999999998719998999997245858
Q gi|254780272|r  110 QAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI  189 (216)
Q Consensus       110 ~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~~  189 (216)
                      .|.+.|..|.++++  .|++.++++|-+-...-|......-..               .+.+..|.  ..-.+.+-.-..
T Consensus       105 ~a~GgG~~lal~~D--~ria~~~a~f~~pe~~~Gl~p~~g~~~---------------~l~~~iG~--~~a~~l~l~g~~  165 (258)
T 2pbp_A          105 LALGGGFELALSCD--LIVASSAAEFGFPEVNLGVMPGAGGTQ---------------RLTKLIGP--KRALEWLWTGAR  165 (258)
T ss_dssp             EEETHHHHHHHTSS--EEEEETTCEEECGGGGGTCCCCSSHHH---------------HHHHHHCH--HHHHHHHHHCCC
T ss_pred             EEEEHHHHHHHHCC--EEEECCCCEEECCCCCCCCCCCCCHHH---------------HHHHHHCH--HHHHHHHHCCCC
T ss_conf             57616689986278--799879978987311568798722999---------------99998689--999999982997


Q ss_pred             CCHHHHHHCCCCCEEECCCCCC
Q ss_conf             8889999758864460454225
Q gi|254780272|r  190 MSASEACDWGVVDKVLMSRIDI  211 (216)
Q Consensus       190 lsa~EA~eyGliD~Ii~~~~e~  211 (216)
                      ++|+||.++||||+|+.. .++
T Consensus       166 ~~a~eA~~~Glv~~vv~~-~~l  186 (258)
T 2pbp_A          166 MSAKEAEQLGIVNRVVSP-ELL  186 (258)
T ss_dssp             EEHHHHHHTTSCSEEECG-GGH
T ss_pred             CCHHHHHHCCCEEEEECH-HHH
T ss_conf             879999988990187257-888


No 24 
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 1xny_A* 1xnv_A* 1xo6_A
Probab=97.93  E-value=3.1e-05  Score=52.18  Aligned_cols=144  Identities=17%  Similarity=0.274  Sum_probs=92.8

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCC----------CCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCC
Q ss_conf             783189899999999999741157697699993687----------6146789999998644873489983155665200
Q gi|254780272|r   48 TGQIEDHMATLICAQLLFLEAENPQKEISLYINSPG----------GVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSL  117 (216)
Q Consensus        48 ~g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpG----------G~v~~glaIyD~i~~i~~~V~Ti~~G~aaS~asl  117 (216)
                      +|.++.+.+.... +++.|-.. -+-||-.++|+||          |.+.+|-.+++++...+.|+.||.+|.+++.|.+
T Consensus       345 ~G~~~~~~a~Kaa-rfi~lcd~-~~iPlv~lvDtpGf~~G~~~E~~G~~~~gA~l~~a~a~~~vP~isviigka~Ggg~~  422 (530)
T 3iav_A          345 AGCLDITASEKAA-RFVRTCDA-FNVPVLTFVDVPGFLPGVDQEHDGIIRRGAKLIFAYAEATVPLITVITRKAFGGAYV  422 (530)
T ss_dssp             GGCBCHHHHHHHH-HHHHHHHH-TTCCEEEEEEECCBCCCHHHHHTTHHHHHHHHHHHHHHCCSCEEEEEEEEEEHHHHH
T ss_pred             CCCCCCCHHHHHH-HHHHHHHC-CCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHH
T ss_conf             6887855699999-99999863-699658997446767888999976999999999999838998699998985408878


Q ss_pred             CCCCCC--CCCEEECCCHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHH
Q ss_conf             002467--77145544156644125666655-541289999999999999999999871999899999724585888899
Q gi|254780272|r  118 LLSAGE--KGMRFALPNARILLHQPSGGFSG-QASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE  194 (216)
Q Consensus       118 Il~aG~--~g~R~~~pns~iMiHqps~~~~G-~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~~lsa~E  194 (216)
                      .+++..  ....++.|++++-.=.|.+.+.= ...+++...++.+..+..+.+-|.                +...+|..
T Consensus       423 am~~~~~~~d~~~AwP~a~~~vm~~egaa~i~~r~~~~~a~~~~~~~~~~~~~~~~----------------~~~~~~~~  486 (530)
T 3iav_A          423 VMGSKHLGADLNLAWPTAQIAVMGAQGAVNILHRRTIADAGDDAEATRARLIQEYE----------------DALLNPYT  486 (530)
T ss_dssp             HTTCGGGTCSEEEECTTCEEESSCHHHHHHHHTSTTTSTTCTTCHHHHHHHHHHHH----------------HHHSSSHH
T ss_pred             HHCCCCCCCCEEEECCCCEEEECCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHH----------------HHHCCHHH
T ss_conf             74244568887999687759716999999999765564277778999999999999----------------88569899


Q ss_pred             HHHCCCCCEEECCCC
Q ss_conf             997588644604542
Q gi|254780272|r  195 ACDWGVVDKVLMSRI  209 (216)
Q Consensus       195 A~eyGliD~Ii~~~~  209 (216)
                      |.+.|.+|+||.++.
T Consensus       487 aa~~~~vD~vIdP~d  501 (530)
T 3iav_A          487 AAERGYVDAVIMPSD  501 (530)
T ss_dssp             HHHTTSSSEECCGGG
T ss_pred             HHHCCCCCCCCCHHH
T ss_conf             987478787478999


No 25 
>2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A*
Probab=97.93  E-value=0.00021  Score=46.86  Aligned_cols=144  Identities=13%  Similarity=0.210  Sum_probs=92.3

Q ss_pred             EEEECCC-----CCHHHHHHHHHHHHHHHHCCCCCCEE-EEEECCCC-------CHH----------------HHHHHHH
Q ss_conf             7998783-----18989999999999974115769769-99936876-------146----------------7899999
Q gi|254780272|r   44 IVFVTGQ-----IEDHMATLICAQLLFLEAENPQKEIS-LYINSPGG-------VVT----------------AGMAIYD   94 (216)
Q Consensus        44 iifl~g~-----I~~~~a~~iia~Ll~L~~~~~~k~I~-l~INSpGG-------~v~----------------~glaIyD   94 (216)
                      +|-|+-|     ++.++...+...+..++.   ++++. +.|.|.|+       +..                ....++.
T Consensus        12 ~itlnrp~~~Nal~~~~~~~l~~~l~~~~~---d~~v~~vVl~g~g~~~F~aG~dl~~~~~~~~~~~~~~~~~~~~~~~~   88 (250)
T 2a7k_A           12 VITLDHPNKHNPFSRTLETSVKDALARANA---DDSVRAVVVYGGAERSFSAGGDFNEVKQLSRSEDIEEWIDRVIDLYQ   88 (250)
T ss_dssp             EEEECCSSTTCBCCHHHHHHHHHHHHHHHH---CTTCCEEEEECCTTSCSBCBSCHHHHHTC-CHHHHHHHHHHHHHHHH
T ss_pred             EEEECCCCCCCCCCHHHHHHHHHHHHHHHH---CCCCEEEEEECCCCCCEECCCCCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             999748886799999999999999999963---99964999982899966588763333322330568999988999999


Q ss_pred             HHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             98644873489983155665200002467771455441566441256666555412899999999999999999998719
Q gi|254780272|r   95 TMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCG  174 (216)
Q Consensus        95 ~i~~i~~~V~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg  174 (216)
                      .|..++.||...+-|.|.+.|..+.++++  .|++.++++|-+-....|..   .+.-  +..+.   +.        -|
T Consensus        89 ~i~~~~kpvIaai~G~a~GgG~~lal~~D--~ria~~~a~f~~pe~~~Gl~---p~~g--~~~l~---~~--------iG  150 (250)
T 2a7k_A           89 AVLNVNKPTIAAVDGYAIGMGFQFALMFD--QRLMASTANFVMPELKHGIG---CSVG--AAILG---FT--------HG  150 (250)
T ss_dssp             HHHTCCSCEEEEECSEEETHHHHHHTTSS--EEEEETTCEEECCGGGGTCC---CHHH--HHHHH---HH--------HC
T ss_pred             HHHHCCCCEEEEECCEEECCCCHHHHCCC--CCCCCCCCEEEEECCCEEEC---CCHH--HHHHH---HH--------HH
T ss_conf             99967987488667627426443232245--45234142776403555255---7616--87898---87--------33


Q ss_pred             CCHHHHHHHHCCCCCCCHHHHHHCCCCCEEECCCCCC
Q ss_conf             9989999972458588889999758864460454225
Q gi|254780272|r  175 KTYEEVEKTLDRDHIMSASEACDWGVVDKVLMSRIDI  211 (216)
Q Consensus       175 ~~~e~i~~~~~rD~~lsa~EA~eyGliD~Ii~~~~e~  211 (216)
                        .....+.+-.-..++|+||+++||||+|+.. .++
T Consensus       151 --~~~a~~lll~g~~~~a~eA~~~Glv~~v~~~-~~l  184 (250)
T 2a7k_A          151 --FSTMQEIIYQCQSLDAPRCVDYRLVNQVVES-SAL  184 (250)
T ss_dssp             --HHHHHHHHHHCCCBCHHHHHHHTCCSEEECH-HHH
T ss_pred             --HHHHHHHHHCCCCCCHHHHHHCCCCCEEECH-HHH
T ss_conf             --9999999983990068999980997777684-799


No 26 
>1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B*
Probab=97.92  E-value=8e-05  Score=49.53  Aligned_cols=141  Identities=16%  Similarity=0.193  Sum_probs=87.2

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCC------CCHHH--------------------HHHHHHHHHHCCCCE
Q ss_conf             3189899999999999741157697699993687------61467--------------------899999986448734
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISLYINSPG------GVVTA--------------------GMAIYDTMQFIKPPI  103 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpG------G~v~~--------------------glaIyD~i~~i~~~V  103 (216)
                      .++.++-..+...+..++..+.-+  -+.|.|.|      +++.+                    ...++..|..++.|+
T Consensus        26 al~~~~~~el~~~l~~~~~d~~v~--vvvltg~g~~F~aG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~kp~  103 (269)
T 1nzy_A           26 ALSVKAMQEVTDALNRAEEDDSVG--AVMITGAEDAFCAGFYLREIPLDKGVAGVRDHFRIAALWWHQMIHKIIRVKRPV  103 (269)
T ss_dssp             CBCHHHHHHHHHHHHHHHHCTTCC--EEEEEESTTCSBCCBCGGGSCSSSHHHHHHHHHHHHHHHHHHHHHHHHHCSSCE
T ss_pred             CCCHHHHHHHHHHHHHHHHCCCEE--EEEEECCCCCCCCCCCHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCE
T ss_conf             989999999999999998588916--999979998635786488764134543115678888888999999999689999


Q ss_pred             EEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHH
Q ss_conf             89983155665200002467771455441566441256666555412899999999999999999998719998999997
Q gi|254780272|r  104 STFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKT  183 (216)
Q Consensus       104 ~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~  183 (216)
                      ...+-|.|.+-|..|.++++  .|++.+++++-+-....|.........    .+.   +.+        |  .....+.
T Consensus       104 Iaav~G~a~GgG~~lal~~D--~ria~~~a~f~~~~~~~g~~p~~g~~~----~l~---~~i--------G--~~~a~~l  164 (269)
T 1nzy_A          104 LAAINGVAAGGGLGISLASD--MAICADSAKFVCAWHTIGIGNDTATSY----SLA---RIV--------G--MRRAMEL  164 (269)
T ss_dssp             EEEECSEEETHHHHHHHHSS--EEEEETTCEEECCHHHHTCCCCTTHHH----HHH---HHH--------H--HHHHHHH
T ss_pred             EEEEHHHHCCCCHHHHHCCC--HHHHHHHHCCCCCCCEEECCCCCCHHH----HHH---HHC--------C--HHHHHCC
T ss_conf             99733020564056554121--445645301147654262157823899----999---980--------9--4653120


Q ss_pred             HCCCCCCCHHHHHHCCCCCEEECCCCCCC
Q ss_conf             24585888899997588644604542251
Q gi|254780272|r  184 LDRDHIMSASEACDWGVVDKVLMSRIDIE  212 (216)
Q Consensus       184 ~~rD~~lsa~EA~eyGliD~Ii~~~~e~~  212 (216)
                      +-...-++|+||+++||||+|+.. .++.
T Consensus       165 ~ltg~~~~a~eA~~~Glv~~vv~~-~~l~  192 (269)
T 1nzy_A          165 MLTNRTLYPEEAKDWGLVSRVYPK-DEFR  192 (269)
T ss_dssp             HHHCCCBCHHHHHHHTSCSCEECH-HHHH
T ss_pred             CCCCCCCCHHHHHHHCCCCEECCH-HHHH
T ss_conf             234898879999980998875486-8999


No 27 
>3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative; 2.00A {Acinetobacter baumannii atcc 17978}
Probab=97.92  E-value=8.9e-05  Score=49.24  Aligned_cols=139  Identities=15%  Similarity=0.185  Sum_probs=87.4

Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCC------CCHHH-----------------HHHHHHHHHHCCCCEEE
Q ss_conf             83189899999999999741157697699993687------61467-----------------89999998644873489
Q gi|254780272|r   49 GQIEDHMATLICAQLLFLEAENPQKEISLYINSPG------GVVTA-----------------GMAIYDTMQFIKPPIST  105 (216)
Q Consensus        49 g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpG------G~v~~-----------------glaIyD~i~~i~~~V~T  105 (216)
                      ..++.++...+...+..++.. ++-. .+.|.+.|      +++..                 ...++..|..++.||..
T Consensus        27 Nal~~~~~~~l~~~l~~~~~d-~~vr-~vvltg~g~~F~aG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~kPvIa  104 (266)
T 3fdu_A           27 NALYGELYLWIAKALDEADQN-KDVR-VVVLRGAEHDFTAGNDMKDFMGFVQNPNAGPAGQVPPFVLLKSAARLSKPLII  104 (266)
T ss_dssp             TCBCHHHHHHHHHHHHHHHHC-TTCC-EEEEEESSSCSBCCBCHHHHHHHHHSCCCSCGGGSHHHHHHHHHHHCCSCEEE
T ss_pred             CCCCHHHHHHHHHHHHHHHHC-CCCE-EEEEECCCCEEECCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             899999999999999999758-9946-99997898425157316665420013103444432589999999977998799


Q ss_pred             EEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHC
Q ss_conf             98315566520000246777145544156644125666655541289999999999999999999871999899999724
Q gi|254780272|r  106 FCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD  185 (216)
Q Consensus       106 i~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~  185 (216)
                      .+-|.|.+.|.-|.++++  .|++.++++|-+-...-|......-..       .+        .+..|.  .+..+.+-
T Consensus       105 av~G~a~GgG~~lala~D--~ria~~~a~f~~pe~~~Gl~p~~g~~~-------~l--------~~~iG~--~~a~~l~l  165 (266)
T 3fdu_A          105 AVKGVAIGIGVTILLQAD--LVFADNTALFQIPFVSLGLSPEGGASQ-------LL--------VKQAGY--HKAAELLF  165 (266)
T ss_dssp             EECSEEETHHHHGGGGCS--EEEECTTCEEECCTTTTTCCCCTTHHH-------HH--------HHHHCH--HHHHHHHH
T ss_pred             EECCEEEECCCEEECCCC--CCEECCCCEEECCHHHCCCCCCHHHHH-------HH--------HHHHCC--HHHHHHHC
T ss_conf             863847464523221523--111147978978625328882110789-------99--------999550--26532110


Q ss_pred             CCCCCCHHHHHHCCCCCEEECCC
Q ss_conf             58588889999758864460454
Q gi|254780272|r  186 RDHIMSASEACDWGVVDKVLMSR  208 (216)
Q Consensus       186 rD~~lsa~EA~eyGliD~Ii~~~  208 (216)
                      .-..++|+||+++||||+|+..-
T Consensus       166 tg~~~~a~eA~~~Glv~~vv~~~  188 (266)
T 3fdu_A          166 TAKKFNAETALQAGLVNEIVEDA  188 (266)
T ss_dssp             HCCEECHHHHHHTTSCSEECSCH
T ss_pred             CCCEECHHHHHHCCCEEEECCCH
T ss_conf             58562288897789722777848


No 28 
>3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metabolism, lipid metabolism, lyase; 1.80A {Mycobacterium tuberculosis}
Probab=97.91  E-value=4e-05  Score=51.45  Aligned_cols=149  Identities=17%  Similarity=0.215  Sum_probs=91.6

Q ss_pred             CCCEEEE--CCC-----CCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHH-------------------HHHHH
Q ss_conf             4677998--783-----189899999999999741157697699993687614678-------------------99999
Q gi|254780272|r   41 KERIVFV--TGQ-----IEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAG-------------------MAIYD   94 (216)
Q Consensus        41 ~~Riifl--~g~-----I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~g-------------------laIyD   94 (216)
                      +++|..|  +-|     ++.++...+...+..++.. ++- --+.+.+.|+...+|                   ..++.
T Consensus        32 ~~~i~~itlnrP~~~Nal~~~~~~~l~~al~~~~~d-~~v-~~vvl~g~g~~F~aG~Dl~~~~~~~~~~~~~~~~~~~~~  109 (278)
T 3h81_A           32 DQRVGIITLNRPQALNALNSQVMNEVTSAATELDDD-PDI-GAIIITGSAKAFAAGADIKEMADLTFADAFTADFFATWG  109 (278)
T ss_dssp             ETTEEEEEECCGGGTTCBCHHHHHHHHHHHHHHHTC-TTC-CEEEEECCSSEEECCBCSHHHHTCCHHHHHHHTTTGGGH
T ss_pred             ECCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHC-CCE-EEEEEECCCCCCCCCCCHHHHHHCCHHHHHHHHHHHHHH
T ss_conf             999999997688867899999999999999999758-884-899994798740036757876521111213678888877


Q ss_pred             HHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             98644873489983155665200002467771455441566441256666555412899999999999999999998719
Q gi|254780272|r   95 TMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCG  174 (216)
Q Consensus        95 ~i~~i~~~V~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg  174 (216)
                      .|..++.||...+-|.|.+.|+.|.++++  .|++.++++|-+-...-|......-    ...+.   +.+        |
T Consensus       110 ~~~~~~~PvIa~v~G~a~GgG~~lal~~D--~ria~~~a~f~~pe~~~Gl~p~~g~----~~~l~---r~i--------g  172 (278)
T 3h81_A          110 KLAAVRTPTIAAVAGYALGGGCELAMMCD--VLIAADTAKFGQPEIKLGVLPGMGG----SQRLT---RAI--------G  172 (278)
T ss_dssp             HHHTCCSCEEEEECBEEETHHHHHHHHSS--EEEEETTCEEECGGGGGTCCCCSSH----HHHHH---HHH--------C
T ss_pred             HHHCCCCCEEEEECCEECHHHHHHHHHCC--EEEEECCCEEECCCCCCCCCCCCCH----HHHHH---HHH--------C
T ss_conf             75348998999980727179899999789--9998399889785118166864139----99999---984--------8


Q ss_pred             CCHHHHHHHHCCCCCCCHHHHHHCCCCCEEECCCCC
Q ss_conf             998999997245858888999975886446045422
Q gi|254780272|r  175 KTYEEVEKTLDRDHIMSASEACDWGVVDKVLMSRID  210 (216)
Q Consensus       175 ~~~e~i~~~~~rD~~lsa~EA~eyGliD~Ii~~~~e  210 (216)
                        .....+.+-.-..++|+||+++||||+|+.....
T Consensus       173 --~~~a~~l~l~g~~~~a~eA~~~GLv~~vv~~~~~  206 (278)
T 3h81_A          173 --KAKAMDLILTGRTMDAAEAERSGLVSRVVPADDL  206 (278)
T ss_dssp             --HHHHHHHHHHCCCEEHHHHHHHTSCSEEECGGGH
T ss_pred             --HHHHHHHHHHCCCCCHHHHHHCCCCCEECCHHHH
T ss_conf             --9999999982996789999986997250006778


No 29 
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A
Probab=97.90  E-value=4.3e-05  Score=51.24  Aligned_cols=151  Identities=17%  Similarity=0.093  Sum_probs=95.8

Q ss_pred             HHHHHHHHHHHHHHHCCCCCCEEEEEECC-CCCHHHHHHHHHHHHHC---CCCEEEEEECCCCCCCCCCCCCCCCCCEEE
Q ss_conf             89999999999974115769769999368-76146789999998644---873489983155665200002467771455
Q gi|254780272|r   54 HMATLICAQLLFLEAENPQKEISLYINSP-GGVVTAGMAIYDTMQFI---KPPISTFCMGQAASMGSLLLSAGEKGMRFA  129 (216)
Q Consensus        54 ~~a~~iia~Ll~L~~~~~~k~I~l~INSp-GG~v~~glaIyD~i~~i---~~~V~Ti~~G~aaS~aslIl~aG~~g~R~~  129 (216)
                      ..-.+++..|-.....+.-+-|.|.++|+ ||++.....|.++|+..   ..||..++  ..++.+...+++... +-|+
T Consensus        70 ~~l~div~~i~~Aa~D~~IkgIvL~~~~~~gg~~a~~~ei~~al~~fk~sgKpVvA~~--~~~~~~~Y~LAS~AD-~I~~  146 (593)
T 3bf0_A           70 NSLFDIVNTIRQAKDDRNITGIVMDLKNFAGGDQPSMQYIGKALKEFRDSGKPVYAVG--ENYSQGQYYLASFAN-KIWL  146 (593)
T ss_dssp             EEHHHHHHHHHHHHHCTTCCCEEEECTEEEECCHHHHHHHHHHHHHHHHTTCCEEEEE--SCEEHHHHHHHTTSS-EEEE
T ss_pred             CCHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEE--CCCCHHHHHHHHHCC-EEEE
T ss_conf             4499999999998349995089998069888738999999999999997099299996--155213237464389-8998


Q ss_pred             CCCHHHHHHHHHHH------H------------HHH------------HHHH--HHHHHHHHHHHHHHHHHHHHHCCCCH
Q ss_conf             44156644125666------6------------555------------4128--99999999999999999998719998
Q gi|254780272|r  130 LPNARILLHQPSGG------F------------SGQ------------ASDI--ERHAQDIVKIKRRLNEIYVKNCGKTY  177 (216)
Q Consensus       130 ~pns~iMiHqps~~------~------------~G~------------~~di--~~~a~el~~~~~~l~~i~a~~Tg~~~  177 (216)
                      .|.+.+.+.-....      +            .|.            .++-  +..-..+..+.+.+.+..++.-+.+.
T Consensus       147 ~p~g~v~~~G~~~~~~~~k~~LdKlGI~~~v~~~G~yKsa~epf~~~~mS~e~re~~~~ll~~l~~~f~~~Va~~R~l~~  226 (593)
T 3bf0_A          147 SPQGVVDLHGFATNGLYYKSLLDKLKVSTHVFRVGTYKSAVEPFIRDDMSPAAREADSRWIGELWQNYLNTVAANRQIPA  226 (593)
T ss_dssp             CTTCCEECCCCBCCEEECHHHHHHTTCEEEEEEECTTCGGGHHHHCSSCCHHHHHHHHHHHHHHHHHHHHHHHHHHTSCH
T ss_pred             CCCCEEEEEEEEEECCCHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCH
T ss_conf             89966888703886256778999759806999615645667866667899999999999999999999999988627883


Q ss_pred             HHHHHH-------HCCCCCCCHHHHHHCCCCCEEECC
Q ss_conf             999997-------245858888999975886446045
Q gi|254780272|r  178 EEVEKT-------LDRDHIMSASEACDWGVVDKVLMS  207 (216)
Q Consensus       178 e~i~~~-------~~rD~~lsa~EA~eyGliD~Ii~~  207 (216)
                      +.+...       +.....++|++|++.||||++...
T Consensus       227 ~~v~~~~~~~~~~l~~~~~~~a~~Al~~gLVD~l~~~  263 (593)
T 3bf0_A          227 EQVFPGAQGLLEGLTKTGGDTAKYALENKLVDALASS  263 (593)
T ss_dssp             HHHCCHHHHHHHHHHTTTTCHHHHHHHTTSSSEECCH
T ss_pred             HHCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCH
T ss_conf             1122345568888776076149999986554200125


No 30 
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans och 114}
Probab=97.89  E-value=0.00018  Score=47.39  Aligned_cols=136  Identities=20%  Similarity=0.305  Sum_probs=91.2

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCC----------CCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCC
Q ss_conf             783189899999999999741157697699993687----------6146789999998644873489983155665200
Q gi|254780272|r   48 TGQIEDHMATLICAQLLFLEAENPQKEISLYINSPG----------GVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSL  117 (216)
Q Consensus        48 ~g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpG----------G~v~~glaIyD~i~~i~~~V~Ti~~G~aaS~asl  117 (216)
                      +|.++.+.+.....-+...+.  -.-||-.++|.||          |-+..|-.+..++...+.|+.|+.+|.+++.|.+
T Consensus       351 ~G~~~~~~a~Kaarfi~lcd~--f~iPlv~lvD~pGf~~G~~aE~~Giir~ga~l~~A~a~a~vP~itvi~rka~Gga~~  428 (531)
T 3n6r_B          351 AGCLDIDSSRKAARFVRFCDA--FEIPLLTLIDVPGFLPGTSQEYGGVIKHGAKLLYAYGEATVPMVTVITRKAYGGAYV  428 (531)
T ss_dssp             GGCBCHHHHHHHHHHHHHHHH--TTCCEEEEEEECSBCCSHHHHHTTHHHHHHHHHHHHHHCCSCEEEEEEEEEEHHHHH
T ss_pred             CCCCCHHHHHHHHHHHHHHHH--CCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHH
T ss_conf             687304689999999997875--288369994488878898999986999999999999718999899997986419889


Q ss_pred             CCCCCC--CCCEEECCCHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCC
Q ss_conf             002467--7714554415664412566665----5541289999999999999999999871999899999724585888
Q gi|254780272|r  118 LLSAGE--KGMRFALPNARILLHQPSGGFS----GQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS  191 (216)
Q Consensus       118 Il~aG~--~g~R~~~pns~iMiHqps~~~~----G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~~ls  191 (216)
                      .+++..  ...+++.|++++-.=.|.+.+.    +...+-+.       ..+...++               .  +.+.+
T Consensus       429 am~~~~~~~d~~~AwP~a~~~vm~~ega~~i~~~~e~~~~e~-------~~~~~~e~---------------~--~~~~~  484 (531)
T 3n6r_B          429 VMSSKHLRADFNYAWPTAEVAVMGAKGATEIIHRGDLGDPEK-------IAQHTADY---------------E--ERFAN  484 (531)
T ss_dssp             HTTCGGGTCSEEEECTTCEEESSCHHHHHHHHCCTTTTSTTH-------HHHHHHHH---------------H--HHHSS
T ss_pred             HHCCCCCCCCEEEECCCCEEEECCHHHHHHHHHCCCCCCHHH-------HHHHHHHH---------------H--HHHCC
T ss_conf             742666788879997866587369999999874343479678-------99999999---------------9--98549


Q ss_pred             HHHHHHCCCCCEEECCCC
Q ss_conf             899997588644604542
Q gi|254780272|r  192 ASEACDWGVVDKVLMSRI  209 (216)
Q Consensus       192 a~EA~eyGliD~Ii~~~~  209 (216)
                      +-.|.+.|+||+||+++.
T Consensus       485 p~~aa~~~~iD~vIdP~d  502 (531)
T 3n6r_B          485 PFVASERGFVDEVIQPRS  502 (531)
T ss_dssp             SHHHHHHTSSSEECCGGG
T ss_pred             HHHHHHCCCCCEEECHHH
T ss_conf             899986588671078699


No 31 
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A*
Probab=97.86  E-value=0.00061  Score=43.95  Aligned_cols=150  Identities=12%  Similarity=0.154  Sum_probs=89.8

Q ss_pred             EEECCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCC----------CCHHHHHHHHHHHHHCCCCEEEEEECCCCCC
Q ss_conf             998783189899999999999741157697699993687----------6146789999998644873489983155665
Q gi|254780272|r   45 VFVTGQIEDHMATLICAQLLFLEAENPQKEISLYINSPG----------GVVTAGMAIYDTMQFIKPPISTFCMGQAASM  114 (216)
Q Consensus        45 ifl~g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpG----------G~v~~glaIyD~i~~i~~~V~Ti~~G~aaS~  114 (216)
                      .+++|.++.+.+.....-+..-+.  -+-||-.++|.||          |-+..|-.+.+++...+.|+.|+.+|.+++.
T Consensus       383 ~~~~G~l~~~aa~Kaarfi~lcd~--f~lPlv~lvD~pGf~~G~~~E~~Gii~~gA~~~~A~a~a~vP~isvi~rka~Gg  460 (588)
T 3gf3_A          383 VGIGGKLYRQGLIKMNEFVTLCAR--DRIPLIWLQDTTGIDVGDEAEKAELLGLGQSLIYSIENSKLPSLEITIRKASAA  460 (588)
T ss_dssp             EEETTEECHHHHHHHHHHHHHHHH--TTCCEEEEECCCEECCSHHHHHTTHHHHHHHHHHHHHHHCSCEEEEESSEEETT
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHCC--CCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCH
T ss_conf             003786677789999999985154--798769993578877876888714999999999998717999799997875314


Q ss_pred             CCCCCCCCCCCC--EEECCC--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHCCCCHHHHHHHHCCC
Q ss_conf             200002467771--455441--5664412566665554128999999999999---999999987199989999972458
Q gi|254780272|r  115 GSLLLSAGEKGM--RFALPN--ARILLHQPSGGFSGQASDIERHAQDIVKIKR---RLNEIYVKNCGKTYEEVEKTLDRD  187 (216)
Q Consensus       115 aslIl~aG~~g~--R~~~pn--s~iMiHqps~~~~G~~~di~~~a~el~~~~~---~l~~i~a~~Tg~~~e~i~~~~~rD  187 (216)
                      |.+.+++..-+-  .++.|+  +++-.-.|.+.+     ++. ..+++.+..+   ...+..++     .+++.+..+  
T Consensus       461 g~~am~~~~~~~d~~~a~~~p~a~~~vm~~ega~-----~i~-~~~e~~~a~~~~~~~~~~~~~-----~~~~~~~~~--  527 (588)
T 3gf3_A          461 AHYVLGGPQGNNTNVFSIGTGACEYYVMPGETAA-----NAM-YSRKLVKAKKAGEDLQPIIGK-----MNDMIQMYT--  527 (588)
T ss_dssp             HHHHTTCTTCTTTEEEEEECTTCEEESSCHHHHH-----HHH-HHHHHHHC-------CHHHHH-----HHHHHHHHH--
T ss_pred             HHHHHCCCCCCCCEEEECCCCCCEEECCCHHHHH-----HHH-HHHHHHHCCCCCCCHHHHHHH-----HHHHHHHHH--
T ss_conf             5665247556886468767887628425899999-----999-999997531677144589999-----999999999--


Q ss_pred             CCCCHHHHHHCCCCCEEECCCC
Q ss_conf             5888899997588644604542
Q gi|254780272|r  188 HIMSASEACDWGVVDKVLMSRI  209 (216)
Q Consensus       188 ~~lsa~EA~eyGliD~Ii~~~~  209 (216)
                      .-.+|..|-+.|.||+||+++.
T Consensus       528 ~~~~p~~aa~~~~vD~vIdP~~  549 (588)
T 3gf3_A          528 DKSRPKYCTEKGMVDEIVDMTE  549 (588)
T ss_dssp             HTTSHHHHHHTTSSSEECCGGG
T ss_pred             HHCCHHHHHHCCCCCEEECHHH
T ss_conf             8469999986578781278399


No 32 
>3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis}
Probab=97.86  E-value=0.00011  Score=48.58  Aligned_cols=137  Identities=18%  Similarity=0.294  Sum_probs=85.9

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEE-EEECCC------CCHH----------------HHHHHHHHHHHCCCCEEEE
Q ss_conf             3189899999999999741157697699-993687------6146----------------7899999986448734899
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISL-YINSPG------GVVT----------------AGMAIYDTMQFIKPPISTF  106 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l-~INSpG------G~v~----------------~glaIyD~i~~i~~~V~Ti  106 (216)
                      .++.++...+...+-.++..+   ++.+ .|.+.|      +++.                ....++..+...+.||...
T Consensus        28 al~~~~~~~l~~~l~~~~~d~---~vr~vvl~g~g~~F~aG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pvIaa  104 (261)
T 3pea_A           28 AMSSQVMHDVTELIDQVEKDD---NIRVVVIHGEGRFFSAGADIKEFTSVTEAKQATELAQLGQVTFERVEKCSKPVIAA  104 (261)
T ss_dssp             CBCHHHHHHHHHHHHHHHHCT---TCCEEEEEESTTCSBCCBCGGGSSTTCCHHHHHHHHHHHHHHHHHHHTCSSCEEEE
T ss_pred             CCCHHHHHHHHHHHHHHHHCC---CEEEEEEECCCCCCCCCCCHHHHHHCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             899999999999999998688---92899994899973588745554100011100012221246777766247868999


Q ss_pred             EECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCC
Q ss_conf             83155665200002467771455441566441256666555412899999999999999999998719998999997245
Q gi|254780272|r  107 CMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR  186 (216)
Q Consensus       107 ~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~r  186 (216)
                      +-|.|.+.|+.|.++++  .|++.++++|.+-...-|......-..    .+           .+..|.  ....+.+-.
T Consensus       105 v~G~a~GgG~~lal~~D--~ria~~~a~f~~pe~~~Gl~p~~g~~~----~l-----------~r~iG~--~~a~~l~l~  165 (261)
T 3pea_A          105 IHGAALGGGLEFAMSCH--MRFATESAKLGLPELTLGLIPGFAGTQ----RL-----------PRYVGK--AKACEMMLT  165 (261)
T ss_dssp             ECSEEETHHHHHHHHSS--EEEEETTCEEECCGGGGTCCCCSSHHH----HH-----------HHHHCH--HHHHHHHHH
T ss_pred             EEEEEEHHHHHHHHCCC--EEEECCCCEEECCCCCCCCCCCCCHHH----HH-----------HHHHCC--CCCCCHHHC
T ss_conf             94388628888775045--599879998978731567686613999----99-----------999575--523331221


Q ss_pred             CCCCCHHHHHHCCCCCEEECCC
Q ss_conf             8588889999758864460454
Q gi|254780272|r  187 DHIMSASEACDWGVVDKVLMSR  208 (216)
Q Consensus       187 D~~lsa~EA~eyGliD~Ii~~~  208 (216)
                      -.-++|+||+++||||+|+...
T Consensus       166 g~~~~a~eA~~~Glv~~vv~~~  187 (261)
T 3pea_A          166 STPITGAEALKWGLVNGVFAEE  187 (261)
T ss_dssp             CCCEEHHHHHHHTSSSEEECGG
T ss_pred             CCCCCHHHHHHCCCCCCCCCHH
T ss_conf             8714499998649977677858


No 33 
>2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D
Probab=97.86  E-value=0.0003  Score=45.93  Aligned_cols=140  Identities=13%  Similarity=0.087  Sum_probs=82.3

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEE-EEECC------CCCHH----------------HHHHHHHHHHHCCCCEEEE
Q ss_conf             3189899999999999741157697699-99368------76146----------------7899999986448734899
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISL-YINSP------GGVVT----------------AGMAIYDTMQFIKPPISTF  106 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l-~INSp------GG~v~----------------~glaIyD~i~~i~~~V~Ti  106 (216)
                      .++.++-..+...+..++.. +  +|.+ .|.+.      |+++.                .+..++..+..++.||...
T Consensus        47 al~~~~~~eL~~al~~~~~d-~--~i~vvvl~g~g~~FsaG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~PvIa~  123 (263)
T 2j5g_A           47 VFTGKTHREFPDAFYDISRD-R--DNRVVILTGSGDAWMAEIDFPSLGDVTNPREWDKTYWEGKKVLQNLLDIEVPVISA  123 (263)
T ss_dssp             EECHHHHHHHHHHHHHHHHC-T--TCCEEEEECBTTEEECEECSGGGCCTTSHHHHHHHHHHHHHHHHHHHTCCSCEEEE
T ss_pred             CCCHHHHHHHHHHHHHHHHC-C--CCEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             88999999999999999759-9--98599997889975288723133444553101466789999999999669975876


Q ss_pred             EECCCCCCCCCCCCCCCCCCEEECCCHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHC
Q ss_conf             831556652000024677714554415664-4125666655541289999999999999999999871999899999724
Q gi|254780272|r  107 CMGQAASMGSLLLSAGEKGMRFALPNARIL-LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD  185 (216)
Q Consensus       107 ~~G~aaS~aslIl~aG~~g~R~~~pns~iM-iHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~  185 (216)
                      +-|.|.+-+ .++++++  .|++.+++++. +-....|..   .+.-... .+.   +.+-          .....+.+-
T Consensus       124 v~G~a~GGg-~lal~cD--~~ia~~~a~f~~~pe~~~G~~---p~~g~~~-~l~---~~iG----------~~~a~~lll  183 (263)
T 2j5g_A          124 VNGAALLHS-EYILTTD--IILASENTVFQDMPHLNAGIV---PGDGVHI-LWP---LALG----------LYRGRYFLF  183 (263)
T ss_dssp             ECSEECSCG-GGGGGCS--EEEEETTCEECCCHHHHHTCC---CCSSHHH-HHH---HHHH----------HHHHHHHHH
T ss_pred             ECCCEEEEE-EECCCCC--EEEECCCCEEEECHHHCCCCC---CCCCCHH-HHH---HHHH----------HHHHHHHHH
T ss_conf             188547887-7425563--478647866876411111667---6756077-889---8846----------999976561


Q ss_pred             CCCCCCHHHHHHCCCCCEEECCCCCCCC
Q ss_conf             5858888999975886446045422510
Q gi|254780272|r  186 RDHIMSASEACDWGVVDKVLMSRIDIEE  213 (216)
Q Consensus       186 rD~~lsa~EA~eyGliD~Ii~~~~e~~~  213 (216)
                      .-..++|+||+++||||+|++. .++.+
T Consensus       184 tg~~i~a~eA~~~Glv~~vv~~-~~l~~  210 (263)
T 2j5g_A          184 TQEKLTAQQAYELNVVHEVLPQ-SKLME  210 (263)
T ss_dssp             TTCCEEHHHHHHTTSCSEEECG-GGHHH
T ss_pred             CCCCCCHHHHHHCCCCEEEECH-HHHHH
T ss_conf             3980129999777993098787-89999


No 34 
>1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3
Probab=97.85  E-value=0.0001  Score=48.81  Aligned_cols=138  Identities=20%  Similarity=0.230  Sum_probs=91.9

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHH------------------------HHHHHHHHHHCCCCEEE
Q ss_conf             318989999999999974115769769999368761467------------------------89999998644873489
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTA------------------------GMAIYDTMQFIKPPIST  105 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~------------------------glaIyD~i~~i~~~V~T  105 (216)
                      .++.++-..+...+-.++.. ++ ---+.|.|.|+...+                        ...++..+..++.||..
T Consensus        22 al~~~~~~el~~~l~~~~~d-~~-v~~vvi~g~g~~f~~g~dl~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~kpvIa   99 (253)
T 1uiy_A           22 PLSPEMALSLLQALDDLEAD-PG-VRAVVLTGRGKAFSAGADLAFLERVTELGAEENYRHSLSLMRLFHRVYTYPKPTVA   99 (253)
T ss_dssp             CCCHHHHHHHHHHHHHHHHC-TT-CCEEEEEESSSCSBCCCCHHHHHHHTTSCHHHHHHHHHHHHHHHHHHHHCSSCEEE
T ss_pred             CCCHHHHHHHHHHHHHHHHC-CC-CEEEEEECCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             98999999999999999739-99-65999978886644564067664123455301223212366899999968998899


Q ss_pred             EEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHC
Q ss_conf             98315566520000246777145544156644125666655541289999999999999999999871999899999724
Q gi|254780272|r  106 FCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD  185 (216)
Q Consensus       106 i~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~  185 (216)
                      .+-|.|.+.|..|.++++  .|++.+++++-+.....|...-   .-  ...+.           +..|  ..+..+.+-
T Consensus       100 ai~G~a~GgG~~lal~cD--~ria~~~a~~~~pe~~~g~~~~---~g--~~~l~-----------~~iG--~~~a~~l~l  159 (253)
T 1uiy_A          100 AVNGPAVAGGAGLALACD--LVVMDEEARLGYTEVKIGFVAA---LV--SVILV-----------RAVG--EKAAKDLLL  159 (253)
T ss_dssp             EECSCEETHHHHHHHTSS--EEEEETTCEEECCHHHHTCCCH---HH--HHHHH-----------HHSC--HHHHHHHHH
T ss_pred             EECCEEEHHHHHHHHHCC--EEEECCCCCCCCCCCEEEECCC---HH--HHHHH-----------HHHC--HHHHHHHHH
T ss_conf             993857628899997347--8895455511574000622674---59--99999-----------9878--999999873


Q ss_pred             CCCCCCHHHHHHCCCCCEEECCCC
Q ss_conf             585888899997588644604542
Q gi|254780272|r  186 RDHIMSASEACDWGVVDKVLMSRI  209 (216)
Q Consensus       186 rD~~lsa~EA~eyGliD~Ii~~~~  209 (216)
                      .-..++|+||.++|+||+|+.+..
T Consensus       160 ~g~~~~a~eA~~~Glv~~v~~~~~  183 (253)
T 1uiy_A          160 TGRLVEAREAKALGLVNRIAPPGK  183 (253)
T ss_dssp             HCCEEEHHHHHHHTSCSEEECTTC
T ss_pred             CCCCCCHHHHHHCCCCCEECCHHH
T ss_conf             298577999986799638657688


No 35 
>3ome_A Enoyl-COA hydratase; ssgcid, structural genomics, structural genomics center for infectious disease, lyase; 2.05A {Mycobacterium smegmatis str}
Probab=97.84  E-value=7.9e-05  Score=49.56  Aligned_cols=148  Identities=16%  Similarity=0.163  Sum_probs=89.8

Q ss_pred             HCCCEEEEC-------CCCCHHHHHHHHHHHHHHHHCCCCCCEE-EEEECCC------CCHHH-----------------
Q ss_conf             146779987-------8318989999999999974115769769-9993687------61467-----------------
Q gi|254780272|r   40 LKERIVFVT-------GQIEDHMATLICAQLLFLEAENPQKEIS-LYINSPG------GVVTA-----------------   88 (216)
Q Consensus        40 ~~~Riifl~-------g~I~~~~a~~iia~Ll~L~~~~~~k~I~-l~INSpG------G~v~~-----------------   88 (216)
                      .++++..|.       -.++.++...+...+-.++. |++  +. +.|.+.|      +++..                 
T Consensus        29 ~~~~Va~ItlnrP~~~Nals~~~~~eL~~al~~~~~-d~~--v~~vVltg~g~~F~~G~dl~~~~~~~~~~~~~~~~~~~  105 (282)
T 3ome_A           29 VADSIATITLNRPEAANAQNPELLDELDAAWTRAAE-DNE--VKVIILRANGKHFSAGHDLRGGGEVPEKISLEFIIQHE  105 (282)
T ss_dssp             EETTEEEEEECCGGGTTCBCHHHHHHHHHHHHHHHH-CTT--CCEEEEEESSSCSBCCBCCC-------CCCHHHHHHHH
T ss_pred             EECCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHH-CCC--EEEEEEECCCCCEECCCHHHHCCCCCCCCCHHHHHHHH
T ss_conf             999999999758464689999999999999999986-889--17999826877401352243124444332024557889


Q ss_pred             ---HHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHH
Q ss_conf             ---899999986448734899831556652000024677714554415664412566665-5541289999999999999
Q gi|254780272|r   89 ---GMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFS-GQASDIERHAQDIVKIKRR  164 (216)
Q Consensus        89 ---glaIyD~i~~i~~~V~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~-G~~~di~~~a~el~~~~~~  164 (216)
                         ...+...+..++.||...+-|.|.+.|+.|+++++  .|++.+++++-+-....+.. +...-+   ...+-  ..+
T Consensus       106 ~~~~~~~~~~l~~~~kPvIaav~G~a~GgG~~lal~~D--~ria~~~a~~~~~e~~~g~~~~~~~~l---~~~~g--~~~  178 (282)
T 3ome_A          106 ARRYLDYTLRWRNVPKPSIAAVQGRCISGGLLLCWPCD--LILASDDALFSDPVALMGIGGVEYHGH---TWELG--PRK  178 (282)
T ss_dssp             HHHTTHHHHHHHHCSSCEEEEECSEEEGGGHHHHTTSS--EEEEETTCEEECCGGGGTCSSCSSCCH---HHHHC--HHH
T ss_pred             HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHCC--HHHHCCCCEEECCCCEEECCCCHHHHH---HHHHH--HHH
T ss_conf             99999999999819998999965831326899976004--155355767634523561064302578---88861--789


Q ss_pred             HHHHHHHHCCCCHHHHHHHHCCCCCCCHHHHHHCCCCCEEECCCCCCCC
Q ss_conf             9999998719998999997245858888999975886446045422510
Q gi|254780272|r  165 LNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGVVDKVLMSRIDIEE  213 (216)
Q Consensus       165 l~~i~a~~Tg~~~e~i~~~~~rD~~lsa~EA~eyGliD~Ii~~~~e~~~  213 (216)
                      ..+++  -||.             -++|+||+++||||+|+.. .++.+
T Consensus       179 A~~ll--ltG~-------------~~~a~eA~~~Glv~~vv~~-~~l~~  211 (282)
T 3ome_A          179 AKEIL--FTGR-------------ALTAEEAERTGMVNRVVAR-DELDA  211 (282)
T ss_dssp             HHHHH--HHCC-------------EEEHHHHHHHTSCSEEECG-GGHHH
T ss_pred             HHHHH--HHCC-------------CCCHHHHHHCCCCCEEECH-HHHHH
T ss_conf             99999--7288-------------5679998654996674176-89999


No 36 
>3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis}
Probab=97.84  E-value=0.00012  Score=48.36  Aligned_cols=136  Identities=15%  Similarity=0.231  Sum_probs=90.2

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEE-EEEECCC------CCHHH----------------HHHHHHHHHHCCCCEEEE
Q ss_conf             318989999999999974115769769-9993687------61467----------------899999986448734899
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEIS-LYINSPG------GVVTA----------------GMAIYDTMQFIKPPISTF  106 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~-l~INSpG------G~v~~----------------glaIyD~i~~i~~~V~Ti  106 (216)
                      .++.++-..+...+-.++.. +  ++. +.|.+.|      +++..                ...++..|..++.||...
T Consensus        49 als~~~~~eL~~al~~~~~d-~--~vrvvvl~g~g~~FsaG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~kPvIaa  125 (286)
T 3myb_A           49 ALSEAMLAALGEAFGTLAED-E--SVRAVVLAASGKAFCAGHDLKEMRAEPSREYYEKLFARCTDVMLAIQRLPAPVIAR  125 (286)
T ss_dssp             CBCHHHHHHHHHHHHHHHTC-T--TCCEEEEEECSSCSBCCBCHHHHHSSCCHHHHHHHHHHHHHHHHHHHHSSSCEEEE
T ss_pred             CCCHHHHHHHHHHHHHHHHC-C--CCEEEEEECCCCCCCCCCCHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             98999999999999999748-9--95699995699971378788998346767788888877789999998499988999


Q ss_pred             EECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCC
Q ss_conf             83155665200002467771455441566441256666555412899999999999999999998719998999997245
Q gi|254780272|r  107 CMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR  186 (216)
Q Consensus       107 ~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~r  186 (216)
                      +-|.|.+.|+-|.++++  .|++.++++|-+....-|......     .-           .+.+.-  ......+.+-.
T Consensus       126 v~G~a~GgG~~lalacD--~ria~~~a~f~~pe~~lGl~p~~g-----~~-----------~l~~~v--G~~~a~~lllt  185 (286)
T 3myb_A          126 VHGIATAAGCQLVAMCD--LAVATRDARFAVSGINVGLFCSTP-----GV-----------ALSRNV--GRKAAFEMLVT  185 (286)
T ss_dssp             ECSCEETHHHHHHHHSS--EEEEETTCEEECGGGGGTCCCHHH-----HH-----------HHTTTS--CHHHHHHHHHH
T ss_pred             ECCEEEHHHHHHHHHCC--EEEECCCCEEECCCEEECCCCCCC-----CC-----------CHHHHH--CHHHHHHHHHC
T ss_conf             88987526688987166--689769988988630155067876-----54-----------147671--89999999556


Q ss_pred             CCCCCHHHHHHCCCCCEEECCC
Q ss_conf             8588889999758864460454
Q gi|254780272|r  187 DHIMSASEACDWGVVDKVLMSR  208 (216)
Q Consensus       187 D~~lsa~EA~eyGliD~Ii~~~  208 (216)
                      -..++|+||+++||||+|+...
T Consensus       186 g~~~~a~eA~~~Glv~~vv~~~  207 (286)
T 3myb_A          186 GEFVSADDAKGLGLVNRVVAPK  207 (286)
T ss_dssp             CCCEEHHHHHHHTSCSEEECGG
T ss_pred             CCEECHHHHHHCCCCEECCCHH
T ss_conf             9755778998779974517867


No 37 
>1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A
Probab=97.84  E-value=0.00045  Score=44.82  Aligned_cols=142  Identities=16%  Similarity=0.182  Sum_probs=85.2

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCE-EEEEECCCCC-------H---------------HHHHHHHHHHHHCCCCEEEE
Q ss_conf             31898999999999997411576976-9999368761-------4---------------67899999986448734899
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEI-SLYINSPGGV-------V---------------TAGMAIYDTMQFIKPPISTF  106 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I-~l~INSpGG~-------v---------------~~glaIyD~i~~i~~~V~Ti  106 (216)
                      .++.++...+...+..++..   .++ -+.|.|.|+.       +               .....++..|..++.||...
T Consensus        27 al~~~~~~~l~~~l~~~~~d---~~v~~vvl~g~g~~~FsaG~Dl~~~~~~~~~~~~~~~~~~~~~~~~i~~~~kpvIa~  103 (260)
T 1sg4_A           27 SLSLEFLTELVISLEKLEND---KSFRGVILTSDRPGVFSAGLDLTEMCGRSPAHYAGYWKAVQELWLRLYQSNLVLVSA  103 (260)
T ss_dssp             EECHHHHHHHHHHHHHHHHC---TTCCEEEEEESSTEESCCEECGGGGSSCCHHHHHHHHHHHHHHHHHHHTCSSEEEEE
T ss_pred             CCCHHHHHHHHHHHHHHHHC---CCCEEEEEECCCCCCEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             89999999999999999858---995599998289994528997655421010012221256789999975589978998


Q ss_pred             EECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCC
Q ss_conf             83155665200002467771455441566441256666555412899999999999999999998719998999997245
Q gi|254780272|r  107 CMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR  186 (216)
Q Consensus       107 ~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~r  186 (216)
                      +-|.|.+.|+-|.++++  .|++.+++++.+-.|.... |-......    ...+        .+..|.  ....+.+-.
T Consensus       104 v~G~a~GgG~~la~~~D--~ria~~~ak~~~~~pe~~~-Gl~p~~g~----~~~l--------~~~iG~--~~a~~l~lt  166 (260)
T 1sg4_A          104 INGACPAGGCLVALTCD--YRILADNPRYCIGLNETQL-GIIAPFWL----KDTL--------ENTIGH--RAAERALQL  166 (260)
T ss_dssp             ECEEBCHHHHHHHTTSS--EEEEECCTTCCBSCCGGGG-TCCCCHHH----HHHH--------HHHHCH--HHHHHHHHH
T ss_pred             ECCCEECCCCHHHCCCC--EEEECCCCCCCCCCCCCCC-CCCCCHHH----HHHH--------HHHCCH--HHHHHHHHH
T ss_conf             56731056311110233--2342222322111322344-86788104----5557--------776089--999999982


Q ss_pred             CCCCCHHHHHHCCCCCEEECCCCCCC
Q ss_conf             85888899997588644604542251
Q gi|254780272|r  187 DHIMSASEACDWGVVDKVLMSRIDIE  212 (216)
Q Consensus       187 D~~lsa~EA~eyGliD~Ii~~~~e~~  212 (216)
                      -.-++|+||+++||||+|+.. .++.
T Consensus       167 g~~~~a~eA~~~Glv~~vv~~-~~l~  191 (260)
T 1sg4_A          167 GLLFPPAEALQVGIVDQVVPE-EQVQ  191 (260)
T ss_dssp             TCCBCHHHHHHHTSSSEEECG-GGHH
T ss_pred             CCCCCHHHHHHCCCCEEECCH-HHHH
T ss_conf             898870677547840464886-7899


No 38 
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A
Probab=97.83  E-value=0.00016  Score=47.57  Aligned_cols=144  Identities=18%  Similarity=0.259  Sum_probs=95.2

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCC----------CCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCC
Q ss_conf             783189899999999999741157697699993687----------6146789999998644873489983155665200
Q gi|254780272|r   48 TGQIEDHMATLICAQLLFLEAENPQKEISLYINSPG----------GVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSL  117 (216)
Q Consensus        48 ~g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpG----------G~v~~glaIyD~i~~i~~~V~Ti~~G~aaS~asl  117 (216)
                      +|.++.+.+.....-+..-+..  .-||-.++|+||          |-+..|-.+..++...+.|+.||.+|.+++.|.+
T Consensus       360 ~G~l~~~aa~Kaarfi~lcd~f--~iPlv~lvD~pGf~~G~~~E~~gi~~~ga~l~~A~a~a~vP~itvi~rka~G~g~~  437 (548)
T 2bzr_A          360 AGCLDINASEKAARFVRTCDCF--NIPIVMLVDVPGFLPGTDQEYNGIIRRGAKLLYAYGEATVPKITVITRKAYGGAYC  437 (548)
T ss_dssp             GGCBCHHHHHHHHHHHHHHHHT--TCCEEEEEEECCBCCCHHHHHTTHHHHHHHHHHHHHHCCSCEEEEEEEEEEHHHHH
T ss_pred             CCCCCCHHHHHHHHHHHHHHHC--CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHH
T ss_conf             6787806789999999998743--89816997489878768999974999999999999828988699997886545766


Q ss_pred             CCCCCC--CCCEEECCCHHHHHHHHHHHHHH-HHHHHH---HHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCC
Q ss_conf             002467--77145544156644125666655-541289---999999999999999999871999899999724585888
Q gi|254780272|r  118 LLSAGE--KGMRFALPNARILLHQPSGGFSG-QASDIE---RHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS  191 (216)
Q Consensus       118 Il~aG~--~g~R~~~pns~iMiHqps~~~~G-~~~di~---~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~~ls  191 (216)
                      .+++..  ....++.|++++-.=.|.+.+.= ...++.   ...++.+.++..+.+-|.                +...+
T Consensus       438 am~~~~~~~d~~~AwP~a~~~vm~~egaa~i~~~~~l~~a~~~~~~~~~~~~~~~~~~~----------------~~~~~  501 (548)
T 2bzr_A          438 VMGSKDMGCDVNLAWPTAQIAVMGASGAVGFVYRQQLAEAAANGEDIDKLRLRLQQEYE----------------DTLVN  501 (548)
T ss_dssp             HTTCGGGTCSEEEECTTCEEESSCHHHHHHHHTCCC----------CHHHHHHHHHHHH----------------HHHSB
T ss_pred             HHCCCCCCCCEEEECCCCEEEECCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHH----------------HHHCC
T ss_conf             52576678887998576548507999999999899987511166587899999999999----------------86479


Q ss_pred             HHHHHHCCCCCEEECCCC
Q ss_conf             899997588644604542
Q gi|254780272|r  192 ASEACDWGVVDKVLMSRI  209 (216)
Q Consensus       192 a~EA~eyGliD~Ii~~~~  209 (216)
                      |-.|.+.|.||+||+++.
T Consensus       502 ~~~aa~~~~iD~VIdP~d  519 (548)
T 2bzr_A          502 PYVAAERGYVGAVIPPSH  519 (548)
T ss_dssp             SHHHHHTTSSSEECCGGG
T ss_pred             HHHHHHCCCCCCEECHHH
T ss_conf             999987288780377899


No 39 
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4
Probab=97.83  E-value=0.00025  Score=46.39  Aligned_cols=146  Identities=10%  Similarity=0.150  Sum_probs=90.9

Q ss_pred             ECCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCC----------CCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCC
Q ss_conf             8783189899999999999741157697699993687----------614678999999864487348998315566520
Q gi|254780272|r   47 VTGQIEDHMATLICAQLLFLEAENPQKEISLYINSPG----------GVVTAGMAIYDTMQFIKPPISTFCMGQAASMGS  116 (216)
Q Consensus        47 l~g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpG----------G~v~~glaIyD~i~~i~~~V~Ti~~G~aaS~as  116 (216)
                      .+|.++.+.+.....-+...+.  -.-||-.++|.||          |-+..|-.+.+++...+.|+.||.+|.+++.|.
T Consensus       383 ~gG~l~~~sa~Kaarfi~lcd~--~~iPlv~lvD~pGf~~G~~~E~~Giir~gA~l~~A~a~a~vP~itvi~rkayGga~  460 (587)
T 1pix_A          383 IGGKLYRQGLVKMNEFVTLCAR--DRLPIVWIQDTTGIDVGNDAEKAELLGLGQSLIYSIQTSHIPQFEITLRKGTAAAH  460 (587)
T ss_dssp             ETTEECHHHHHHHHHHHHHHHH--TTCCEEEEECCCEECCSHHHHHTTHHHHHHHHHHHHHTCCCCEEEEECSEEETTHH
T ss_pred             CCCCCCHHHHHHHHHHHHHHHH--CCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHH
T ss_conf             6896687899999999998764--29966897158887887699998899999999988873799979999798531677


Q ss_pred             CCCCCCCCC----CEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCC-----C
Q ss_conf             000246777----1455441566441256666555412899999999999999999998719998999997245-----8
Q gi|254780272|r  117 LLLSAGEKG----MRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR-----D  187 (216)
Q Consensus       117 lIl~aG~~g----~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~r-----D  187 (216)
                      +.+++..-+    ..++.|++++-.-.|.+.+     ++. ..+++.+         ++..++..+++.+..+.     .
T Consensus       461 ~am~~~~~~~~~~~~~a~p~a~i~vm~~e~av-----~i~-~~~~~~~---------~~~~~~~~~~~~~~~~~~~~~~~  525 (587)
T 1pix_A          461 YVLGGPQGNDTNAFSIGTAATEIAVMNGETAA-----TAM-YSRRLAK---------DRKAGKDLQPTIDKMNNLIQAFY  525 (587)
T ss_dssp             HHTTCTTCTTTEEEEEECTTCEEESSCHHHHH-----HHH-HHHHHHH---------HHHTTCCCHHHHHHHHHHHHHHH
T ss_pred             HHHCCCCCCCCEEEEECCCCCCCCCCCHHHHH-----HHH-HHHHHHH---------CCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             87347656886137721887626157999999-----999-8887652---------21445244589999999999998


Q ss_pred             CCCCHHHHHHCCCCCEEECCCC
Q ss_conf             5888899997588644604542
Q gi|254780272|r  188 HIMSASEACDWGVVDKVLMSRI  209 (216)
Q Consensus       188 ~~lsa~EA~eyGliD~Ii~~~~  209 (216)
                      .-.+|..|-+.|+||+||+++.
T Consensus       526 ~~~~p~~aa~~g~vD~iIdP~~  547 (587)
T 1pix_A          526 TKSRPKVCAELGLVDEIVDMNK  547 (587)
T ss_dssp             HTTSHHHHHHHTSSSEECCTTT
T ss_pred             HHCCHHHHHHCCCCCEEECHHH
T ss_conf             7369999997288681288399


No 40 
>3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A
Probab=97.82  E-value=0.00011  Score=48.76  Aligned_cols=147  Identities=12%  Similarity=0.140  Sum_probs=92.5

Q ss_pred             CCCEEEE--CC-----CCCHHHHHHHHHHHHHHHHCCCCCCEE-EEEECCC------CCHHH------------------
Q ss_conf             4677998--78-----318989999999999974115769769-9993687------61467------------------
Q gi|254780272|r   41 KERIVFV--TG-----QIEDHMATLICAQLLFLEAENPQKEIS-LYINSPG------GVVTA------------------   88 (216)
Q Consensus        41 ~~Riifl--~g-----~I~~~~a~~iia~Ll~L~~~~~~k~I~-l~INSpG------G~v~~------------------   88 (216)
                      +++|..|  +.     .++.++-..+...|-.++.. +  +|. +.|.+.|      +++.+                  
T Consensus        42 ~~~Va~ItLnrP~~~Nals~~m~~el~~~l~~~~~d-~--~vrviVltG~G~~F~aG~Dl~~~~~~~~~~~~~~~~~~~~  118 (333)
T 3njd_A           42 TDRVARITFNRPEKGNAIVADTPLELSALVERADLD-P--DVHVILVSGRGEGFCAGFDLSAYAEGSSSAGGGSPYEGTV  118 (333)
T ss_dssp             ETTEEEEEECCGGGTTCBCTHHHHHHHHHHHHHHHC-T--TCCEEEEEESTTSSBCCBC---------------CCTTST
T ss_pred             ECCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHC-C--CCEEEEEECCCCCCCCCCCHHHHHHCCCCCCCCCCCHHHH
T ss_conf             999999997675647899999999999999999729-9--9459999789998558887688761232334554200011


Q ss_pred             ---------------------------HHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHH
Q ss_conf             ---------------------------89999998644873489983155665200002467771455441566441256
Q gi|254780272|r   89 ---------------------------GMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPS  141 (216)
Q Consensus        89 ---------------------------glaIyD~i~~i~~~V~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps  141 (216)
                                                 ...++..|..++.||...+-|.|.+.|+-|.++++  .|++.++++|-+-...
T Consensus       119 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~kPvIAaV~G~a~GgG~~lal~~D--~ria~~~a~f~~pe~~  196 (333)
T 3njd_A          119 LSGKTQALNHLPDEPWDPMVDYQMMSRFVRGFASLMHCDKPTVVKIHGYCVAGGTDIALHAD--QVIAAADAKIGYPPMR  196 (333)
T ss_dssp             TCHHHHHHTTCSSSCCCHHHHHHHHHHHHHHHTHHHHSSSCEEEEECSEEETHHHHHHTTSS--EEEECTTCEEECGGGG
T ss_pred             HHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCEEEECCCEECCCCC--EEEECCCCEEECCCEE
T ss_conf             10145542035422345267899999999999999958998899978878624331103577--7998799889887044


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHHHHHCCCCCEEECCCCCCCC
Q ss_conf             666555412899999999999999999998719998999997245858888999975886446045422510
Q gi|254780272|r  142 GGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGVVDKVLMSRIDIEE  213 (216)
Q Consensus       142 ~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~~lsa~EA~eyGliD~Ii~~~~e~~~  213 (216)
                      .|..   ....    .+           .+.-  ......+.+-.-..++|+||+++||||+|+.. .++.+
T Consensus       197 ~G~~---p~~~----~l-----------~r~i--G~~~A~~llltg~~i~A~eA~~~Glv~~vv~~-~~l~~  247 (333)
T 3njd_A          197 VWGV---PAAG----LW-----------AHRL--GDQRAKRLLFTGDCITGAQAAEWGLAVEAPDP-ADLDA  247 (333)
T ss_dssp             TTCC---CTTC----CH-----------HHHH--CHHHHHHHHTTCCEEEHHHHHHTTSSSBCCCG-GGHHH
T ss_pred             ECCC---CCCC----HH-----------HHHH--CHHHHHHHHHHCCCCHHHHHHHCCCEEEECCH-HHHHH
T ss_conf             1267---7520----56-----------5651--57989999860883029999987990196287-78999


No 41 
>2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, alternative splicing, fatty acid metabolism, enoyl coenzyme A hydratase; 2.3A {Homo sapiens}
Probab=97.80  E-value=8.6e-05  Score=49.33  Aligned_cols=135  Identities=15%  Similarity=0.169  Sum_probs=86.5

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCE-EEEEECCCCCHHH----------------------HHHHHHHHHHCCCCEEEE
Q ss_conf             31898999999999997411576976-9999368761467----------------------899999986448734899
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEI-SLYINSPGGVVTA----------------------GMAIYDTMQFIKPPISTF  106 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I-~l~INSpGG~v~~----------------------glaIyD~i~~i~~~V~Ti  106 (216)
                      .++.++-..+...+-.++.   +.++ -+.|.+.|+...+                      ...++..|..++.||...
T Consensus        56 als~~~~~~l~~~l~~~~~---d~~v~vvvltg~g~~F~aG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~kPvIAa  132 (287)
T 2vx2_A           56 TLSLAMLKSLQSDILHDAD---SNDLKVIIISAEGPVFSSGHDLKELTEEQGRDYHAEVFQTCSKVMMHIRNHPVPVIAM  132 (287)
T ss_dssp             CCCHHHHHHHHHHHHTTTT---CTTCCEEEEEESSSEEECCSCCC-CCGGGCHHHHHHHHHHHHHHHHHHHTCSSCEEEE
T ss_pred             CCCHHHHHHHHHHHHHHHH---CCCCEEEEEECCCCCCCCCCCCHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             9999999999999999850---8996699997889986477541222000012466777767999999997289877999


Q ss_pred             EECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCC
Q ss_conf             83155665200002467771455441566441256666555412899999999999999999998719998999997245
Q gi|254780272|r  107 CMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR  186 (216)
Q Consensus       107 ~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~r  186 (216)
                      +-|.|.+.|..|.++++  .|++.++++|-+-...-|....   .-. . .           +.+..  +.....+.+-.
T Consensus       133 v~G~a~GgG~~lal~cD--~ria~~~a~f~~pe~~~Gl~p~---~g~-~-~-----------l~r~l--g~~~a~~lllt  192 (287)
T 2vx2_A          133 VNGLATAAGCQLVASCD--IAVASDKSSFATPGVNVGLFCS---TPG-V-A-----------LARAV--PRKVALEMLFT  192 (287)
T ss_dssp             ECSEEETHHHHHHHHSS--EEEEETTCEEECCGGGGTCCCH---HHH-H-H-----------HHTTS--CHHHHHHHHHH
T ss_pred             ECCEEEHHHHHHHHHCC--CCEECCCCEEECHHHCCCCCCC---CHH-H-H-----------HHHHH--HHHHHHHHHHC
T ss_conf             68866166788876056--4537788689871115270787---227-8-8-----------99999--99999999983


Q ss_pred             CCCCCHHHHHHCCCCCEEECC
Q ss_conf             858888999975886446045
Q gi|254780272|r  187 DHIMSASEACDWGVVDKVLMS  207 (216)
Q Consensus       187 D~~lsa~EA~eyGliD~Ii~~  207 (216)
                      -..++|+||.++||||+|+..
T Consensus       193 g~~~~a~eA~~~GLv~~vv~~  213 (287)
T 2vx2_A          193 GEPISAQEALLHGLLSKVVPE  213 (287)
T ss_dssp             CCCEEHHHHHHHTSCSEEECG
T ss_pred             CCCCCHHHHHHCCCEEEECCH
T ss_conf             994788999878770261786


No 42 
>1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus HB8} SCOP: c.14.1.3
Probab=97.78  E-value=0.00011  Score=48.68  Aligned_cols=140  Identities=14%  Similarity=0.087  Sum_probs=87.5

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCE-EEEEECC------CCCHHH-----------------HHHHHHHHHHCCCCEEE
Q ss_conf             31898999999999997411576976-9999368------761467-----------------89999998644873489
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEI-SLYINSP------GGVVTA-----------------GMAIYDTMQFIKPPIST  105 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I-~l~INSp------GG~v~~-----------------glaIyD~i~~i~~~V~T  105 (216)
                      .++.++...+...+..++..   .+| -+.|.+.      |+++..                 +..++..|..++.||..
T Consensus        33 al~~~~~~el~~~l~~~~~d---~~vr~vvl~g~g~~FsaG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~kPvIa  109 (264)
T 1wz8_A           33 AMPPALHRGLARVWRDLEAV---EGVRAVLLRGEGGVFSAGGSFGLIEEMRASHEALLRVFWEARDLVLGPLNFPRPVVA  109 (264)
T ss_dssp             CBCHHHHHHHHHHHHHHTTC---TTCSEEEEEEGGGCCBCCBCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHSSSCEEE
T ss_pred             CCCHHHHHHHHHHHHHHHHC---CCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             88999999999999998668---998699997899984389975202554334778888899999999999978998999


Q ss_pred             EEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHC
Q ss_conf             98315566520000246777145544156644125666655541289999999999999999999871999899999724
Q gi|254780272|r  106 FCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD  185 (216)
Q Consensus       106 i~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~  185 (216)
                      .+-|.|.+.|..+.++++  .|++.++++|-+-...-|......-..       .+..        ..|.  ..-.+.+-
T Consensus       110 av~G~a~GgG~~lal~~D--~~ia~~~a~f~~pe~~~G~~p~~g~~~-------~l~~--------~~G~--~~a~~l~l  170 (264)
T 1wz8_A          110 AVEKVAVGAGLALALAAD--IAVVGKGTRLLDGHLRLGVAAGDHAVL-------LWPL--------LVGM--AKAKYHLL  170 (264)
T ss_dssp             EECSEEETHHHHHHHHSS--EEEEETTCEEECCHHHHTSCCTTTHHH-------HTHH--------HHCH--HHHHHHHH
T ss_pred             EECCCCCHHHHHHHHHHC--CCCHHHHHHHCCCCCCCCCCCCCCHHH-------HHHH--------HHHH--HHHHHHHH
T ss_conf             974840528889998644--030115554325321117788842789-------9999--------9988--89999998


Q ss_pred             CCCCCCHHHHHHCCCCCEEECCCCCCC
Q ss_conf             585888899997588644604542251
Q gi|254780272|r  186 RDHIMSASEACDWGVVDKVLMSRIDIE  212 (216)
Q Consensus       186 rD~~lsa~EA~eyGliD~Ii~~~~e~~  212 (216)
                      .-..++|+||+++|+||+|+.. .++.
T Consensus       171 tg~~i~a~eA~~~Glv~~vv~~-~~l~  196 (264)
T 1wz8_A          171 LNEPLTGEEAERLGLVALAVED-EKVY  196 (264)
T ss_dssp             HTCCEEHHHHHHHTSSSEEECG-GGHH
T ss_pred             CCCCCCHHHHHHCCCCCEECCH-HHHH
T ss_conf             0996269999984996475287-8998


No 43 
>1q52_A MENB; lyase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.80A {Mycobacterium tuberculosis H37RV} SCOP: c.14.1.3 PDB: 1q51_A 1rjm_A* 1rjn_A*
Probab=97.78  E-value=0.00024  Score=46.52  Aligned_cols=170  Identities=15%  Similarity=0.183  Sum_probs=98.1

Q ss_pred             CCCCEEEEECCCCCCCCCH-HHHHHCCCEEE--ECC-----CCCHHHHHHHHHHHHHHHHCCCCCCEEEEE-E-------
Q ss_conf             4575797665998401220-03451467799--878-----318989999999999974115769769999-3-------
Q gi|254780272|r   17 GLVPMVVEQTNRGERSYDI-YSRLLKERIVF--VTG-----QIEDHMATLICAQLLFLEAENPQKEISLYI-N-------   80 (216)
Q Consensus        17 ~~~p~~~e~~~~~~~~~Di-~s~L~~~Riif--l~g-----~I~~~~a~~iia~Ll~L~~~~~~k~I~l~I-N-------   80 (216)
                      |..|......+.-++..|| |.+-..+.|.-  |+-     .++.++...+...|..++.. +  ++.+.| .       
T Consensus        19 p~~~~~~~~~~~~~~~~di~~~~~~ddgVa~ItLNrP~~~NAl~~~m~~eL~~al~~~~~d-~--~vrvvVltG~~~~~~   95 (314)
T 1q52_A           19 PFDAKAWRLVDGFDDLTDITYHRHVDDATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMS-P--DVGVVLLTGNGPSPK   95 (314)
T ss_dssp             CCCGGGEEECTTCTTCSSEEEEEESSSSEEEEEECCGGGTTCCCHHHHHHHHHHHHHHHHC-T--TCCEEEEEECCCCTT
T ss_pred             CCCCCCCCCCCCCCCCCCEEEEEEEECCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHC-C--CCCEEEEECCCCCCC
T ss_conf             9982004225777877516999973399899995587756898999999999999999749-9--975899957887665


Q ss_pred             ------CCCCCHHH--------------------------HHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCEE
Q ss_conf             ------68761467--------------------------8999999864487348998315566520000246777145
Q gi|254780272|r   81 ------SPGGVVTA--------------------------GMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF  128 (216)
Q Consensus        81 ------SpGG~v~~--------------------------glaIyD~i~~i~~~V~Ti~~G~aaS~aslIl~aG~~g~R~  128 (216)
                            |.|+++..                          ...+++.|..++.||...+-|.|.+.|..|.++++  .|+
T Consensus        96 sgG~~FcaG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~kPvIaav~G~a~GgG~~lalacD--~~i  173 (314)
T 1q52_A           96 DGGWAFCSGGDQRIRGRSGYQYASGDTADTVDVARAGRLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCD--LTL  173 (314)
T ss_dssp             TCCCEEECCC-----------------------------CHHHHHHHHHHSSSEEEEEECSEEETHHHHHHHHSS--EEE
T ss_pred             CCCCCCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCEEEECHHHHHHHCC--CHH
T ss_conf             521023347675665312444333342012667888889999999999858998899983766102138876123--112


Q ss_pred             ECCCH-HHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHHHHHCCCCCEE
Q ss_conf             54415-66441256666---555412899999999999999999998719998999997245858888999975886446
Q gi|254780272|r  129 ALPNA-RILLHQPSGGF---SGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGVVDKV  204 (216)
Q Consensus       129 ~~pns-~iMiHqps~~~---~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~~lsa~EA~eyGliD~I  204 (216)
                      +.+++ ++-+-....|.   .|-..-+                  .+..|.  ....+.+-.-..++|+||+++||||+|
T Consensus       174 as~~a~~f~~pe~~lGl~p~~g~~~~L------------------~~~vG~--~~A~~llltg~~i~a~eA~~~Glv~~v  233 (314)
T 1q52_A          174 ASREYARFKQTDADVGSFDGGYGSAYL------------------ARQVGQ--KFAREIFFLGRTYTAEQMHQMGAVNAV  233 (314)
T ss_dssp             EETTTCEEECCGGGGTCCCCSTTTHHH------------------HHHHCH--HHHHHHHHHCCEECHHHHHHHTSCSEE
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCHHHHH------------------HHHHHH--HHHHHHHHHCCCCCHHHHHCCCCEEEE
T ss_conf             100377766444045878885069999------------------998569--999999985898888897307832796


Q ss_pred             ECCCCCCC
Q ss_conf             04542251
Q gi|254780272|r  205 LMSRIDIE  212 (216)
Q Consensus       205 i~~~~e~~  212 (216)
                      +.. .++.
T Consensus       234 v~~-~el~  240 (314)
T 1q52_A          234 AEH-AELE  240 (314)
T ss_dssp             ECG-GGHH
T ss_pred             CCH-HHHH
T ss_conf             387-8999


No 44 
>1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A
Probab=97.76  E-value=5.2e-05  Score=50.72  Aligned_cols=141  Identities=15%  Similarity=0.170  Sum_probs=89.8

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECC------CCCHHH--------------------------HHHHHHHHH
Q ss_conf             318989999999999974115769769999368------761467--------------------------899999986
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISLYINSP------GGVVTA--------------------------GMAIYDTMQ   97 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSp------GG~v~~--------------------------glaIyD~i~   97 (216)
                      .++.++...+...+..++.. ++-. .+.|.+.      ||+..+                          ...++..|.
T Consensus        27 als~~~~~~l~~~l~~~~~d-~~v~-~vVltg~g~~F~aG~dl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~  104 (275)
T 1dci_A           27 AMNRAFWRELVECFQKISKD-SDCR-AVVVSGAGKMFTSGIDLMDMASDILQPPGDDVARIAWYLRDLISRYQKTFTVIE  104 (275)
T ss_dssp             CBCHHHHHHHHHHHHHHHTC-TTCC-EEEEEESTTCSBCCBCHHHHHHHHTSCCCSSHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHHHC-CCCE-EEEEECCCCCCCCCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999758-9967-999967898741664388874011345421000256778888999999999997


Q ss_pred             HCCCCEEEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCH
Q ss_conf             44873489983155665200002467771455441566441256666555412899999999999999999998719998
Q gi|254780272|r   98 FIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTY  177 (216)
Q Consensus        98 ~i~~~V~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~  177 (216)
                      .++.||...+-|.|.+-|.-|.++++  .|++.++++|-+-...-|......-.   .            .+....|. .
T Consensus       105 ~~~kPvIaav~G~a~GGG~~lal~~D--~ria~~~a~f~~pe~~~Gl~p~~g~~---~------------~l~~~~g~-~  166 (275)
T 1dci_A          105 KCPKPVIAAIHGGCIGGGVDLISACD--IRYCTQDAFFQVKEVDVGLAADVGTL---Q------------RLPKVIGN-R  166 (275)
T ss_dssp             HSSSCEEEEECSEEETHHHHHHTTSS--EEEEETTCEEECCGGGGTSCCCSSHH---H------------HGGGTCSC-H
T ss_pred             HCCCCEEEEECCEEEHHHHHHHHCCC--EEEECCCCCEECCCEEECCCCCCCCH---H------------HHHHHHCC-H
T ss_conf             38998999988962306489875446--51104787223632146456465627---7------------89998520-6


Q ss_pred             HHHHHHHCCCCCCCHHHHHHCCCCCEEECCCCC
Q ss_conf             999997245858888999975886446045422
Q gi|254780272|r  178 EEVEKTLDRDHIMSASEACDWGVVDKVLMSRID  210 (216)
Q Consensus       178 e~i~~~~~rD~~lsa~EA~eyGliD~Ii~~~~e  210 (216)
                      ....+.+-.-..++|+||+++|+||+|+.....
T Consensus       167 ~~~~~ll~~g~~~~a~eA~~~Glv~~vv~~~~~  199 (275)
T 1dci_A          167 SLVNELTFTARKMMADEALDSGLVSRVFPDKDV  199 (275)
T ss_dssp             HHHHHHHHHCCEEEHHHHHHHTSSSEEESSHHH
T ss_pred             HHHHHHHHCCCCCCHHHHHHCCCEEEEECCHHH
T ss_conf             665666621566687788768953697185788


No 45 
>2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A
Probab=97.76  E-value=0.00017  Score=47.54  Aligned_cols=140  Identities=19%  Similarity=0.182  Sum_probs=87.6

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCC------CHHH-------------------HHHHHHHHHHCCCCEE
Q ss_conf             31898999999999997411576976999936876------1467-------------------8999999864487348
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISLYINSPGG------VVTA-------------------GMAIYDTMQFIKPPIS  104 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG------~v~~-------------------glaIyD~i~~i~~~V~  104 (216)
                      .++.++-..+...+-.++.. +.+  -+.|.+.|+      |+..                   ...++..|..++.||.
T Consensus        29 al~~~~~~el~~al~~~~~d-~~~--~vVl~g~g~~F~aG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~kPvI  105 (261)
T 2gtr_A           29 SLNPEVMREVQSALSTAAAD-DSK--LVLLSAVGSVFCCGLDFIYFIRRLTDDRKRESTKMAEAIRNFVNTFIQFKKPII  105 (261)
T ss_dssp             EECHHHHHHHHHHHHHHHHS-SCS--CEEEEESSSCSBCEECHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHCCSCEE
T ss_pred             CCCHHHHHHHHHHHHHHHCC-CCE--EEEEECCCCCEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCEE
T ss_conf             88999999999999998629-976--999978998646688873542211233202478999999887678750999899


Q ss_pred             EEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             99831556652000024677714554415664412566665554128999999999999999999987199989999972
Q gi|254780272|r  105 TFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTL  184 (216)
Q Consensus       105 Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~  184 (216)
                      ..+-|.|.+.|..|.++++  .|++.+++++-+.....|......-.    ..+.+           ..|  .....+.+
T Consensus       106 aav~G~a~GgG~~lal~~D--~~ia~~~a~f~~pe~~~Gl~p~~g~~----~~l~r-----------~~G--~~~a~~l~  166 (261)
T 2gtr_A          106 VAVNGPAIGLGASILPLCD--VVWANEKAWFQTPYTTFGQSPDGCST----VMFPK-----------IMG--GASANEML  166 (261)
T ss_dssp             EEECSCEETHHHHTGGGSS--EEEEETTCEEECCTTTTTCCCCTTHH----HHHHH-----------HHC--HHHHHHHH
T ss_pred             EEECCEEEECCCHHHHCHH--HHHHHHHHHHHHHHCCCCCCCCCCHH----HHHHH-----------HCC--CCCCCCCC
T ss_conf             9987814662117530001--41233545655321014777884347----78999-----------819--52224542


Q ss_pred             CCCCCCCHHHHHHCCCCCEEECCCCCCC
Q ss_conf             4585888899997588644604542251
Q gi|254780272|r  185 DRDHIMSASEACDWGVVDKVLMSRIDIE  212 (216)
Q Consensus       185 ~rD~~lsa~EA~eyGliD~Ii~~~~e~~  212 (216)
                      -...-++|+||+++||||+|+.+ .++.
T Consensus       167 l~g~~~~a~eA~~~Glv~~vv~~-~~l~  193 (261)
T 2gtr_A          167 LSGRKLTAQEACGKGLVSQVFWP-GTFT  193 (261)
T ss_dssp             HHCCCEEHHHHHHTTSCSEEECG-GGHH
T ss_pred             CCCCCCCHHHHHHCCCEEEEECH-HHHH
T ss_conf             35676778899767973687081-8899


No 46 
>3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomics, center for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis}
Probab=97.75  E-value=0.00034  Score=45.60  Aligned_cols=140  Identities=17%  Similarity=0.177  Sum_probs=85.7

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEE-EEEECCCCCH----------------------HHHHHHHHHHHHCCCCEEEE
Q ss_conf             318989999999999974115769769-9993687614----------------------67899999986448734899
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEIS-LYINSPGGVV----------------------TAGMAIYDTMQFIKPPISTF  106 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~-l~INSpGG~v----------------------~~glaIyD~i~~i~~~V~Ti  106 (216)
                      .++.++...+...+..++..   .++. +.|.+.|+..                      ......+..+...+.||...
T Consensus        32 al~~~~~~~L~~~l~~~~~d---~~v~~vvl~g~g~~~f~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~kpvIaa  108 (265)
T 3kqf_A           32 SLSLALLEELQNILTQINEE---ANTRVVILTGAGEKAFCAGADLKERAGMNEEQVRHAVSMIRTTMEMVEQLPQPVIAA  108 (265)
T ss_dssp             CBCHHHHHHHHHHHHHHHTC---TTCCEEEEEESSSSEEECCBCHHHHTTCCHHHHHHHHHHHHHHHHHHHTCSSCEEEE
T ss_pred             CCCHHHHHHHHHHHHHHHHC---CCCEEEEEECCCCCCEECCCHHHHHHHCCCCCCCCCHHHHHHHHHHHHHCCCCEEEE
T ss_conf             99999999999999998648---995699996589961324312555420000110000135657999999689888999


Q ss_pred             EECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCC
Q ss_conf             83155665200002467771455441566441256666555412899999999999999999998719998999997245
Q gi|254780272|r  107 CMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR  186 (216)
Q Consensus       107 ~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~r  186 (216)
                      +-|.|.+.|+.|.++++  .|++.++++|-+-...-|......-.    ..+           .+..|.  ....+.+-.
T Consensus       109 V~G~a~GgG~~lal~~D--~ria~~~a~f~~pe~~~Gl~p~~g~~----~~l-----------~~~vG~--~~a~~lllt  169 (265)
T 3kqf_A          109 INGIALGGGTELSLACD--FRIAAESASLGLTETTLAIIPGAGGT----QRL-----------PRLIGV--GRAKELIYT  169 (265)
T ss_dssp             ECSEEETHHHHHHHHSS--EEEEETTCEEECCGGGGTCCCCSSHH----HHH-----------HHHHCH--HHHHHHHHH
T ss_pred             EEEEEEEHHHHHHHHCC--EEEECCCCEEECCCCCCCCCCCCCHH----HHH-----------HHHHHH--HHHHHHHHH
T ss_conf             96689517889987378--89976998898864487208884288----870-----------887329--999999984


Q ss_pred             CCCCCHHHHHHCCCCCEEECCCCCCC
Q ss_conf             85888899997588644604542251
Q gi|254780272|r  187 DHIMSASEACDWGVVDKVLMSRIDIE  212 (216)
Q Consensus       187 D~~lsa~EA~eyGliD~Ii~~~~e~~  212 (216)
                      -.-++|+||+++||||+|+.. .++.
T Consensus       170 g~~~~a~ea~~~Glv~~vv~~-~~l~  194 (265)
T 3kqf_A          170 GRRISAQEAKEYGLVEFVVPV-HLLE  194 (265)
T ss_dssp             CCCEEHHHHHHHTSCSEEECG-GGHH
T ss_pred             CCCCCHHHHHHCCCCCEECCH-HHHH
T ss_conf             886788999974997676687-8999


No 47 
>3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis}
Probab=97.72  E-value=0.0001  Score=48.89  Aligned_cols=135  Identities=16%  Similarity=0.209  Sum_probs=85.5

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCE-EEEEECCCCCHH-------------------HHHHHHHHHHHCCCCEEEEEEC
Q ss_conf             31898999999999997411576976-999936876146-------------------7899999986448734899831
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEI-SLYINSPGGVVT-------------------AGMAIYDTMQFIKPPISTFCMG  109 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I-~l~INSpGG~v~-------------------~glaIyD~i~~i~~~V~Ti~~G  109 (216)
                      .++.++...+...+-.++..+   ++ .+.|.+.|....                   ....++..+..++.||...+-|
T Consensus        33 al~~~~~~~l~~~l~~~~~d~---~v~~vvl~g~g~~f~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~kPvIa~i~G  109 (263)
T 3moy_A           33 ALNQTLEAEVLDAARDFDADL---EIGAIVVTGSERAFAAGADIAEMVTLTPHQARERNLLSGWDSLTQVRKPIVAAVAG  109 (263)
T ss_dssp             CBCHHHHHHHHHHHHHHHHCT---TCCEEEEECCSSEEEESBCHHHHTTCCHHHHHHTTTTHHHHHHTTCCSCEEEEECB
T ss_pred             CCCHHHHHHHHHHHHHHHHCC---CEEEEEEECCCCCCCCCCCHHHHCCCCCCHHHHHCCCCCHHHHHCCCCCEEEEECC
T ss_conf             989999999999999873289---81699986785454167633542035631022201210023430499979999886


Q ss_pred             CCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCC
Q ss_conf             556652000024677714554415664412566665---55412899999999999999999998719998999997245
Q gi|254780272|r  110 QAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFS---GQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR  186 (216)
Q Consensus       110 ~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~---G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~r  186 (216)
                      .|.+.|..|.++++  .|++.++++|-+-...-|..   |-..-+       .+.           .|.  ....+.+-.
T Consensus       110 ~a~GgG~~lal~cD--~ria~~~a~f~~pe~~~Gl~p~~g~~~~l-------~~~-----------vg~--~~a~~l~l~  167 (263)
T 3moy_A          110 YALGGGCELAMLCD--LVIAADTARFGQPEITLGILPGLGGTQRL-------TRA-----------VGK--AKAMDLCLT  167 (263)
T ss_dssp             EEETHHHHHHHHSS--EEEEETTCEEECGGGGGTCCCSSSTTTHH-------HHH-----------HCH--HHHHHHHHH
T ss_pred             CCHHHHHHHHHHCC--EEEEECCCEEECCCCCCCCCCCCCHHHHH-------HHH-----------HHH--HHHHHHHHC
T ss_conf             15399999999789--99982998998964180658550289999-------998-----------529--999999982


Q ss_pred             CCCCCHHHHHHCCCCCEEECCCC
Q ss_conf             85888899997588644604542
Q gi|254780272|r  187 DHIMSASEACDWGVVDKVLMSRI  209 (216)
Q Consensus       187 D~~lsa~EA~eyGliD~Ii~~~~  209 (216)
                      -.-++|+||+++||||+|+....
T Consensus       168 g~~~~a~eA~~~Glv~~vv~~~e  190 (263)
T 3moy_A          168 GRSLTAEEAERVGLVSRIVPAAD  190 (263)
T ss_dssp             CCEEEHHHHHHTTSCSEEECGGG
T ss_pred             CCCCCHHHHHHCCCCEEEECCCH
T ss_conf             99788999998799679504200


No 48 
>1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A
Probab=97.72  E-value=0.00058  Score=44.12  Aligned_cols=139  Identities=13%  Similarity=0.116  Sum_probs=82.5

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEE-EEEECCCCCHH---------------------HHHHHHHHHHHCCCCEEEEE
Q ss_conf             318989999999999974115769769-99936876146---------------------78999999864487348998
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEIS-LYINSPGGVVT---------------------AGMAIYDTMQFIKPPISTFC  107 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~-l~INSpGG~v~---------------------~glaIyD~i~~i~~~V~Ti~  107 (216)
                      .++.++...+...+-.++..+   ++. +.|.+.|+...                     .+..++..|..++.||...+
T Consensus        39 al~~~~~~el~~~l~~~~~d~---~v~~vvltg~g~~FsaG~Dl~~~~~~~~~~~~~~~~~~~~~~~~l~~~~kpvIa~v  115 (257)
T 1szo_A           39 VWTSTAHDELAYCFHDIACDR---ENKVVILTGTGPSFCNEIDFTSFNLGTPHDWDEIIFEGQRLLNNLLSIEVPVIAAV  115 (257)
T ss_dssp             EECHHHHHHHHHHHHHHHHCT---TCCEEEEECBTTBSBCEECGGGSCCSSHHHHHHHHHHHHHHHHHHHHCCSCEEEEE
T ss_pred             CCCHHHHHHHHHHHHHHHHCC---CCEEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             999999999999999997499---95499996688762157644332344411477889999999999870897189997


Q ss_pred             ECCCCCCCCCCCCCCCCCCEEECCCHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCC
Q ss_conf             3155665200002467771455441566441-256666555412899999999999999999998719998999997245
Q gi|254780272|r  108 MGQAASMGSLLLSAGEKGMRFALPNARILLH-QPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR  186 (216)
Q Consensus       108 ~G~aaS~aslIl~aG~~g~R~~~pns~iMiH-qps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~r  186 (216)
                      -|.|++ |..|+++++  .|++.+++++... ....|...   +.-. ...+.   +.        .|  .....+.+-.
T Consensus       116 ~g~~~G-G~~lal~~D--~ria~~~a~f~~~pe~~~g~~p---~~g~-~~~l~---r~--------ig--~~~a~~l~l~  175 (257)
T 1szo_A          116 NGPVTN-APEIPVMSD--IVLAAESATFQDGPHFPSGIVP---GDGA-HVVWP---HV--------LG--SNRGRYFLLT  175 (257)
T ss_dssp             CSCBCS-STHHHHTSS--EEEEETTCEEECTTSGGGTCCC---TTTH-HHHHH---HH--------HC--HHHHHHHHHT
T ss_pred             ECCCCE-EEEEECCCC--EEEECCCCEEECCCCCCCCCCC---CCCC-CCHHH---HH--------CC--HHHHHHHHHC
T ss_conf             135550-577505776--4898588867537732446477---6542-11107---76--------08--9999989863


Q ss_pred             CCCCCHHHHHHCCCCCEEECCCCCCC
Q ss_conf             85888899997588644604542251
Q gi|254780272|r  187 DHIMSASEACDWGVVDKVLMSRIDIE  212 (216)
Q Consensus       187 D~~lsa~EA~eyGliD~Ii~~~~e~~  212 (216)
                      -..++|+||+++||||+|+.. .++.
T Consensus       176 g~~~~a~eA~~~Glv~~vv~~-~~l~  200 (257)
T 1szo_A          176 GQELDARTALDYGAVNEVLSE-QELL  200 (257)
T ss_dssp             TCEEEHHHHHHHTSCSEEECH-HHHH
T ss_pred             CCCCCHHHHHHCCCCCEEECH-HHHH
T ss_conf             981639999856998877676-8999


No 49 
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A*
Probab=97.71  E-value=0.00039  Score=45.19  Aligned_cols=136  Identities=15%  Similarity=0.144  Sum_probs=86.3

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEE-EEEECCC------CCHHH------------------HHHHHHHHHHCCCCEE
Q ss_conf             318989999999999974115769769-9993687------61467------------------8999999864487348
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEIS-LYINSPG------GVVTA------------------GMAIYDTMQFIKPPIS  104 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~-l~INSpG------G~v~~------------------glaIyD~i~~i~~~V~  104 (216)
                      .++.++-..+...+-.++..+   ++. +.|.|.|      +|+..                  +..++..|..++.||.
T Consensus        31 al~~~~~~el~~~l~~~~~d~---~v~~vVl~g~g~~F~aG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~PvI  107 (715)
T 1wdk_A           31 KFNRLTLNELRQAVDAIKADA---SVKGVIVSSGKDVFIVGADITEFVENFKLPDAELIAGNLEANKIFSDFEDLNVPTV  107 (715)
T ss_dssp             BCCHHHHHHHHHHHHHHHHCT---TCCEEEEEESSSSSBBCCCHHHHHHHTTSCHHHHHHHHHHHHHHHHHHHTCSSCEE
T ss_pred             CCCHHHHHHHHHHHHHHHHCC---CCEEEEEECCCCCEEECCCHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEE
T ss_conf             989999999999999997488---97699998889971658098989635578867888767899999999984999899


Q ss_pred             EEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             99831556652000024677714554415664412566665554128999999999999999999987199989999972
Q gi|254780272|r  105 TFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTL  184 (216)
Q Consensus       105 Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~  184 (216)
                      ...-|.|.+.|.-|.++++  .|++.++++|-+-...-|......-.    ..+-           +..|.  ..-.+.+
T Consensus       108 Aai~G~a~GgG~elalacD--~ria~~~a~f~~pev~lGl~p~~gg~----~~l~-----------r~iG~--~~a~~l~  168 (715)
T 1wdk_A          108 AAINGIALGGGLEMCLAAD--FRVMADSAKIGLPEVKLGIYPGFGGT----VRLP-----------RLIGV--DNAVEWI  168 (715)
T ss_dssp             EEECSCEETHHHHHHHTSS--EEEEETTCEEECGGGGGTCCCCSSHH----HHHH-----------HHHCH--HHHHHHH
T ss_pred             EEECCHHHHHHHHHHHHCC--EEEEECCCEEECHHHHHCCCCCCCCC----EECH-----------HHCCH--HHHHHHH
T ss_conf             9978633299999999789--99982998998867763888887744----5510-----------10243--6788863


Q ss_pred             CCCCCCCHHHHHHCCCCCEEECC
Q ss_conf             45858888999975886446045
Q gi|254780272|r  185 DRDHIMSASEACDWGVVDKVLMS  207 (216)
Q Consensus       185 ~rD~~lsa~EA~eyGliD~Ii~~  207 (216)
                      -....++|+||+++||||+|+..
T Consensus       169 ltg~~~~a~eA~~~Glvd~vv~~  191 (715)
T 1wdk_A          169 ASGKENRAEDALKVSAVDAVVTA  191 (715)
T ss_dssp             HHCCCEEHHHHHHTTSSSEEECG
T ss_pred             CCCCCCHHHHHHHCCCCCCCCCH
T ss_conf             02334049999985997424888


No 50 
>2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C*
Probab=97.70  E-value=9.9e-05  Score=48.96  Aligned_cols=140  Identities=11%  Similarity=0.123  Sum_probs=85.5

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEEEE-EC------CCCCHHHHH--------------------HHHHHHHHCCCC
Q ss_conf             318989999999999974115769769999-36------876146789--------------------999998644873
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISLYI-NS------PGGVVTAGM--------------------AIYDTMQFIKPP  102 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l~I-NS------pGG~v~~gl--------------------aIyD~i~~i~~~  102 (216)
                      .++.++-..+...+..++.   +.++.+.| .+      .|+++.+..                    .++..|..++.|
T Consensus        32 al~~~~~~~l~~al~~~~~---d~~v~vvvl~g~g~~F~aG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~kP  108 (276)
T 2j5i_A           32 AMSPTLNREMIDVLETLEQ---DPAAGVLVLTGAGEAWTAGMDLKEYFREVDAGPEILQEKIRREASQWQWKLLRMYAKP  108 (276)
T ss_dssp             CBCHHHHHHHHHHHHHHHT---CTTEEEEEEEESTTCSBCCBCHHHHHHHHHHSCTTHHHHHHHHHHHHHTTTTTTCSSC
T ss_pred             CCCHHHHHHHHHHHHHHHH---CCCCEEEEEECCCCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             8899999999999999973---9991799997898864178878998641002210356666677788899999978998


Q ss_pred             EEEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHH
Q ss_conf             48998315566520000246777145544156644125666655541289999999999999999999871999899999
Q gi|254780272|r  103 ISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEK  182 (216)
Q Consensus       103 V~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~  182 (216)
                      |...+-|.|.+.|+.|+++++  .|++.++++|-+.....|......-.    .           .+.+..|.  ....+
T Consensus       109 vIaav~G~a~GgG~~lal~cD--~ria~~~a~f~~pe~~~G~~p~~~~~----~-----------~l~~~~g~--~~a~~  169 (276)
T 2j5i_A          109 TIAMVNGWCFGGGFSPLVACD--LAICADEATFGLSEINWGIPPGNLVS----K-----------AMADTVGH--RQSLM  169 (276)
T ss_dssp             EEEEECSCEEGGGHHHHHHSS--EEEEETTCEEECGGGGGTCCCCTTHH----H-----------HHHHHSCH--HHHHH
T ss_pred             EEEECCCCEEHHHHHHHHCCC--HHEECCCCCEECCCCCCCCCCCCCHH----H-----------HHHHHHCH--HHHHH
T ss_conf             999469945004348775344--10067888400332323248861179----9-----------99998281--45545


Q ss_pred             HHCCCCCCCHHHHHHCCCCCEEECCCCCCC
Q ss_conf             724585888899997588644604542251
Q gi|254780272|r  183 TLDRDHIMSASEACDWGVVDKVLMSRIDIE  212 (216)
Q Consensus       183 ~~~rD~~lsa~EA~eyGliD~Ii~~~~e~~  212 (216)
                      .+-.-..++|+||+++||||+|+.. .++.
T Consensus       170 lll~g~~~~a~eA~~~Glv~~vv~~-~el~  198 (276)
T 2j5i_A          170 YIMTGKTFGGQKAAEMGLVNESVPL-AQLR  198 (276)
T ss_dssp             HHHHCCEEEHHHHHHHTSSSEEECH-HHHH
T ss_pred             HHCCCCCCCHHHHHHCCCCCEECCC-HHHH
T ss_conf             5305887874689972993476381-2659


No 51 
>3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, quercetin, structural genomics consortium, SGC, alternative splicing; HET: QUE; 1.50A {Homo sapiens}
Probab=97.69  E-value=0.00036  Score=45.38  Aligned_cols=137  Identities=15%  Similarity=0.168  Sum_probs=87.1

Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECC-------CCCHHH------------------HHHHHHHHHHCCCCE
Q ss_conf             8318989999999999974115769769999368-------761467------------------899999986448734
Q gi|254780272|r   49 GQIEDHMATLICAQLLFLEAENPQKEISLYINSP-------GGVVTA------------------GMAIYDTMQFIKPPI  103 (216)
Q Consensus        49 g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSp-------GG~v~~------------------glaIyD~i~~i~~~V  103 (216)
                      ..++.++...+...|-.++.. ++ --.+.|.+-       ||++..                  ...+...|..++.||
T Consensus        28 Nal~~~m~~eL~~~l~~~~~d-~~-v~~vvltga~g~~FcaG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~kPv  105 (363)
T 3bpt_A           28 NALTLNMIRQIYPQLKKWEQD-PE-TFLIIIKGAGGKAFCAGGDIRVISEAEKAKQKIAPVFFREEYMLNNAVGSCQKPY  105 (363)
T ss_dssp             TCBCHHHHHHHHHHHHHHHHC-TT-CCEEEEEETTSSEEECCBCHHHHHHHHTSSCCCHHHHHHHHHHHHHHHHTCSSCE
T ss_pred             CCCCHHHHHHHHHHHHHHHHC-CC-CEEEEEECCCCCCEECCCCHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCCCE
T ss_conf             899999999999999999849-99-7699996689982117816787741223321003677767768999999689989


Q ss_pred             EEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHH
Q ss_conf             89983155665200002467771455441566441256666555412899999999999999999998719998999997
Q gi|254780272|r  104 STFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKT  183 (216)
Q Consensus       104 ~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~  183 (216)
                      ...+-|.|.+.|.-|.++++  .|++.++++|-+-...-|....   .-. ...+.+           ..|+ .  -...
T Consensus       106 Iaav~G~a~GgG~~la~~~D--~~ia~~~a~f~~pe~~~Gl~P~---~g~-~~~l~r-----------l~g~-~--a~~l  165 (363)
T 3bpt_A          106 VALIHGITMGGGVGLSVHGQ--FRVATEKCLFAMPETAIGLFPD---VGG-GYFLPR-----------LQGK-L--GYFL  165 (363)
T ss_dssp             EEEECSEEETHHHHTTTTSS--EEEECTTCEEECCGGGTTSCCC---TTH-HHHHHH-----------SSTT-H--HHHH
T ss_pred             EEECCCCEEECCHHHHCCCE--EEECCCCCEEECCHHCCCCCCC---CCC-EEEECC-----------HHHH-H--HHHH
T ss_conf             98069947351255520331--3103897489241322146888---760-234210-----------3369-9--9999


Q ss_pred             HCCCCCCCHHHHHHCCCCCEEECC
Q ss_conf             245858888999975886446045
Q gi|254780272|r  184 LDRDHIMSASEACDWGVVDKVLMS  207 (216)
Q Consensus       184 ~~rD~~lsa~EA~eyGliD~Ii~~  207 (216)
                      +-.-..++|+||+++||||+++.+
T Consensus       166 ~ltg~~~~a~eA~~~Glv~~vv~~  189 (363)
T 3bpt_A          166 ALTGFRLKGRDVYRAGIATHFVDS  189 (363)
T ss_dssp             HHHCCCEETHHHHHTTSCSEECCG
T ss_pred             HHHCCCCHHHHHHHCCCCEEECCH
T ss_conf             984897439999985997086385


No 52 
>3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis}
Probab=97.69  E-value=0.00018  Score=47.30  Aligned_cols=138  Identities=14%  Similarity=0.103  Sum_probs=85.4

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCC------CCHHH-----------------HHHHHHHHHHCCCCEEEE
Q ss_conf             3189899999999999741157697699993687------61467-----------------899999986448734899
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISLYINSPG------GVVTA-----------------GMAIYDTMQFIKPPISTF  106 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpG------G~v~~-----------------glaIyD~i~~i~~~V~Ti  106 (216)
                      .++.++...+..-+-.++  +++ ---+.|.+.|      +++..                 ...++..|...+.||...
T Consensus        30 al~~~~~~el~~~l~~~~--~~~-v~vvvl~g~g~~F~aG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~kpvIaa  106 (267)
T 3hp0_A           30 TINDTLIEECLQVLNQCE--TST-VTVVVLEGLPEVFCFGADFQEIYQEMKRGRKQASSQEPLYDLWMKLQTGPYVTISH  106 (267)
T ss_dssp             CBCSHHHHHHHHHHHHHH--HSS-CCEEEEECCSSCSBCCBCHHHHHHTTTTTCCSCCCCHHHHHHHHHHHHSSSEEEEE
T ss_pred             CCCHHHHHHHHHHHHHHH--CCC-CEEEEEECCCCCEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             999999999999999974--699-55999978998734799732252002210022232168999999997389888999


Q ss_pred             EECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCC
Q ss_conf             83155665200002467771455441566441256666555412899999999999999999998719998999997245
Q gi|254780272|r  107 CMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR  186 (216)
Q Consensus       107 ~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~r  186 (216)
                      +-|.|.+-|+.|.++++  .|++.++++|-+.....|...   +.-  ...+           .+.-|.  ....+.+-.
T Consensus       107 v~G~a~GgG~~lalacD--~ria~~~a~f~~pe~~~Gl~p---~~g--~~~l-----------~r~iG~--~~a~~l~lt  166 (267)
T 3hp0_A          107 VRGKVNAGGLGFVSATD--IAIADQTASFSLSELLFGLYP---ACV--LPFL-----------IRRIGR--QKAHYMTLM  166 (267)
T ss_dssp             ECSEEETTHHHHHHHSS--EEEECTTCEEECCGGGGTCCC---TTT--HHHH-----------HHHHCH--HHHHHHHHH
T ss_pred             EECCEECCHHHHHHHHH--HHHHHHCCCCCCCCCCCCCCC---CCH--HHHH-----------HHHHCH--HHHHHHHHH
T ss_conf             65632313068777647--666654011147412506788---702--4358-----------777296--999999862


Q ss_pred             CCCCCHHHHHHCCCCCEEECCCCC
Q ss_conf             858888999975886446045422
Q gi|254780272|r  187 DHIMSASEACDWGVVDKVLMSRID  210 (216)
Q Consensus       187 D~~lsa~EA~eyGliD~Ii~~~~e  210 (216)
                      -..++|+||+++||||+|+....+
T Consensus       167 g~~i~a~eA~~~Glv~~vv~~~d~  190 (267)
T 3hp0_A          167 TKPISVQEASEWGLIDAFDAESDV  190 (267)
T ss_dssp             CCCBCHHHHHHHTSSSCBCSCTTH
T ss_pred             CCCCCHHHHHHCCCCCEECCCHHH
T ss_conf             897889999888994676695599


No 53 
>3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis}
Probab=97.68  E-value=0.00018  Score=47.25  Aligned_cols=140  Identities=18%  Similarity=0.155  Sum_probs=83.7

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEE-EEEECCCCCHHH-------------------------HHHHHHHHHHCCCCE
Q ss_conf             318989999999999974115769769-999368761467-------------------------899999986448734
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEIS-LYINSPGGVVTA-------------------------GMAIYDTMQFIKPPI  103 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~-l~INSpGG~v~~-------------------------glaIyD~i~~i~~~V  103 (216)
                      .++.++...+...+..++.   +.+|. +.|.|.||.+++                         ...++..|..++.||
T Consensus        30 al~~~m~~eL~~al~~~~~---d~~v~vvVl~g~g~~~FsaG~Dl~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~kPv  106 (289)
T 3h0u_A           30 LIGPEVVRDLVALLEELAH---PTAPRVVIFDSADADFFFPHVDMTKVPEYTAEAAKAGGPGDASLGMLFRKLSQLPAVT  106 (289)
T ss_dssp             CBCHHHHHHHHHHHHHTTS---TTSCSEEEEEECSSSEEECSBCTTCHHHHHHHHHTTSSTTCCSHHHHHHHHHTCSSEE
T ss_pred             CCCHHHHHHHHHHHHHHHC---CCCCEEEEEECCCCCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCE
T ss_conf             8999999999999999853---9895699992789980114015454443201013433456789999999999689989


Q ss_pred             EEEEECCCCCCCCCCCCCCCCCCEEECC-CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHH
Q ss_conf             8998315566520000246777145544-156644125666655541289999999999999999999871999899999
Q gi|254780272|r  104 STFCMGQAASMGSLLLSAGEKGMRFALP-NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEK  182 (216)
Q Consensus       104 ~Ti~~G~aaS~aslIl~aG~~g~R~~~p-ns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~  182 (216)
                      ...+-|.|.+.|..|.++++  .|++.+ ++++-+-....|......-..    .+.           +..|.  ....+
T Consensus       107 Iaav~G~a~GgG~~lal~cD--~~iaa~e~a~f~~pe~~~Gl~p~~g~~~----~l~-----------r~iG~--~~a~~  167 (289)
T 3h0u_A          107 IAKLRGRARGAGSEFLLACD--MRFASRENAILGQPEVGIGAPPGAGAIQ----HLT-----------RLLGR--GRALE  167 (289)
T ss_dssp             EEEECSEEETHHHHHHHHSS--EEEEETTTCEEECTHHHHTSCCCSSHHH----HHH-----------HHHCH--HHHHH
T ss_pred             EEECCCCCCCCHHHHHHHCC--EEEECCCCCEEECCCCCCCCCCCCCHHH----HHH-----------HHHHH--HHHHH
T ss_conf             98059952463037877177--1356358861536644652588864257----777-----------65109--99999


Q ss_pred             HHCCCCCCCHHHHHHCCCCCEEECCCCCCC
Q ss_conf             724585888899997588644604542251
Q gi|254780272|r  183 TLDRDHIMSASEACDWGVVDKVLMSRIDIE  212 (216)
Q Consensus       183 ~~~rD~~lsa~EA~eyGliD~Ii~~~~e~~  212 (216)
                      .+-.-..++|+||+++||||+|+.. .++.
T Consensus       168 llltg~~~~a~eA~~~Glv~~vv~~-~~l~  196 (289)
T 3h0u_A          168 AVLTSSDFDADLAERYGWVNRAVPD-AELD  196 (289)
T ss_dssp             HHHHCCCEEHHHHHHHTSSSEEECH-HHHH
T ss_pred             HHHCCCCCCHHHHHHCCCCCEEECH-HHHH
T ss_conf             9983994769999987997187188-7999


No 54 
>3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics, protein structure initiative; 1.58A {Legionella pneumophila subsp}
Probab=97.67  E-value=0.00022  Score=46.79  Aligned_cols=140  Identities=13%  Similarity=0.130  Sum_probs=88.0

Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCCE-EEEEECCC------CCHHH------------------HHHHHHHHHHCCCCE
Q ss_conf             831898999999999997411576976-99993687------61467------------------899999986448734
Q gi|254780272|r   49 GQIEDHMATLICAQLLFLEAENPQKEI-SLYINSPG------GVVTA------------------GMAIYDTMQFIKPPI  103 (216)
Q Consensus        49 g~I~~~~a~~iia~Ll~L~~~~~~k~I-~l~INSpG------G~v~~------------------glaIyD~i~~i~~~V  103 (216)
                      -.++.++...+...+..++..   .++ -+.|.|.|      +++..                  ...++..+..++.||
T Consensus        26 Nal~~~~~~~l~~~l~~~~~d---~~v~~vVl~g~~~~F~aG~dl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~kPv  102 (268)
T 3i47_A           26 NAFDNQLLTEMRIRLDSAIND---TNVRVIVLKANGKHFSAGADLTWMQSMANFTEEENLEDSLVLGNLMYSISQSPKPT  102 (268)
T ss_dssp             TCBCHHHHHHHHHHHHHHHHC---TTCSEEEEEECSSCSBCSBCHHHHHHHHTCCHHHHHHHHHHHHHHHHHHHHCSSCE
T ss_pred             CCCCHHHHHHHHHHHHHHHHC---CCCEEEEEECCCCCCCCCCHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCE
T ss_conf             999999999999999999749---99069999167776335641554311122210000246788999999998489878


Q ss_pred             EEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHH
Q ss_conf             89983155665200002467771455441566441256666555412899999999999999999998719998999997
Q gi|254780272|r  104 STFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKT  183 (216)
Q Consensus       104 ~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~  183 (216)
                      ...+-|.|.+.|+.|.++++  .|++.++++|-+-....|...   +... ...+..            .|  .......
T Consensus       103 Iaav~G~a~GgG~~lal~cD--~ria~~~a~f~~pe~~~G~~p---~~~~-~~~~~~------------ig--~~~a~~l  162 (268)
T 3i47_A          103 IAMVQGAAFGGGAGLAAACD--IAIASTSARFCFSEVKLGLIP---AVIS-PYVVRA------------IG--ERAAKML  162 (268)
T ss_dssp             EEEECSEEETHHHHHHHHSS--EEEEETTCEEECCGGGGTCCC---TTTH-HHHHHH------------HC--HHHHHHH
T ss_pred             EEEECCEEEECCCHHHCCCC--EEECCCCCEEECCEEEEEECC---CCCH-HHHCHH------------HH--HHHHHHH
T ss_conf             99967858505521110442--456279979987424566457---6421-322203------------45--6678998


Q ss_pred             HCCCCCCCHHHHHHCCCCCEEECCCCCCC
Q ss_conf             24585888899997588644604542251
Q gi|254780272|r  184 LDRDHIMSASEACDWGVVDKVLMSRIDIE  212 (216)
Q Consensus       184 ~~rD~~lsa~EA~eyGliD~Ii~~~~e~~  212 (216)
                      +-.-..++|+||.++||||+|+.. .++.
T Consensus       163 ~ltg~~~~a~eA~~~Glv~~vv~~-~~l~  190 (268)
T 3i47_A          163 FMSAEVFDATRAYSLNLVQHCVPD-DTLL  190 (268)
T ss_dssp             HHHCCEEEHHHHHHTTSCSEEECG-GGHH
T ss_pred             HHCCCCCCHHHHHHCCCEEEEECH-HHHH
T ss_conf             760897888999777981086084-7999


No 55 
>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans}
Probab=97.67  E-value=0.00032  Score=45.71  Aligned_cols=146  Identities=11%  Similarity=0.086  Sum_probs=88.7

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEE-EEEECCC-------CCHHH-------------------HHHHHHHHHHCCCC
Q ss_conf             318989999999999974115769769-9993687-------61467-------------------89999998644873
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEIS-LYINSPG-------GVVTA-------------------GMAIYDTMQFIKPP  102 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~-l~INSpG-------G~v~~-------------------glaIyD~i~~i~~~  102 (216)
                      .++.++-..+...+.-++.++|+  |. +.|.|-|       +++..                   ...+.+.++.++.|
T Consensus        54 Als~~m~~EL~dAl~~l~~d~pd--VrvVVLtGag~raFcAGaDL~e~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~kP  131 (556)
T 2w3p_A           54 SYDLGVDIELHDAIQRIRFEHPE--VRTVVLTSLKDRVFCSGANIFMLGLSTHAWKVNFCKFTNETRNGLEDSSRHSGLK  131 (556)
T ss_dssp             EECHHHHHHHHHHHHHHHHHCTT--CCEEEEEESSSSEEECEECHHHHHHSCHHHHHHHHHHHHHHHHHHHHHHHHTSCE
T ss_pred             CCCHHHHHHHHHHHHHHHHCCCC--EEEEEEEECCCCEEECCCCHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             89999999999999999827998--4899998089991656848886742574015668999999999999999838998


Q ss_pred             EEEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHH
Q ss_conf             48998315566520000246777145544156644125666655541289999999999999999999871999899999
Q gi|254780272|r  103 ISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEK  182 (216)
Q Consensus       103 V~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~  182 (216)
                      |...+-|.|.+.|.-+.++++  .|++..+....+-.|.....|-.........            +....+.......+
T Consensus       132 vIAAVnG~A~GGG~eLALaCD--~rIavad~~a~~~lPEv~~lGl~PG~ggt~R------------~~l~r~VG~a~A~e  197 (556)
T 2w3p_A          132 FLAAVNGACAGGGYELALACD--EIYLVDDRSSSVSLPEVPLLGVLPGTGGLTR------------VTDKRKVRHDRADI  197 (556)
T ss_dssp             EEEEECSEEETHHHHHHHHSS--EEEEECSSSCEEECCHHHHHSSCCTTTHHHH------------HHHTSCCCHHHHHH
T ss_pred             EEEEECCEEEECCCHHHCCCC--CEECCCCCCCCCCCCCCCCCCCCCCCCHHHH------------HHHHHHHHHHHHHH
T ss_conf             999975858661206440657--2030434442002642113677897434256------------66664512999999


Q ss_pred             HHCCCCCCCHHHHHHCCCCCEEECCCCCCC
Q ss_conf             724585888899997588644604542251
Q gi|254780272|r  183 TLDRDHIMSASEACDWGVVDKVLMSRIDIE  212 (216)
Q Consensus       183 ~~~rD~~lsa~EA~eyGliD~Ii~~~~e~~  212 (216)
                      .+-.-..++|+||+++||||+|+.+ .++.
T Consensus       198 llltGe~i~AeeA~~~GLVd~VVp~-eeL~  226 (556)
T 2w3p_A          198 FCTVVEGVRGERAKAWRLVDEVVKP-NQFD  226 (556)
T ss_dssp             HTTCSSCEEHHHHHHTTSCSEEECH-HHHH
T ss_pred             HHHCCCCCCHHHHHHCCCCCEECCH-HHHH
T ss_conf             9982997479999976971177284-6999


No 56 
>3ff6_A Acetyl-COA carboxylase 2; ACC2, ACC, metabolic disorder, fatty acid metabolism, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis; HET: RCP; 3.19A {Homo sapiens}
Probab=97.65  E-value=0.00091  Score=42.88  Aligned_cols=158  Identities=13%  Similarity=0.091  Sum_probs=91.8

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCC----------CCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCC
Q ss_conf             783189899999999999741157697699993687----------6146789999998644873489983155665200
Q gi|254780272|r   48 TGQIEDHMATLICAQLLFLEAENPQKEISLYINSPG----------GVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSL  117 (216)
Q Consensus        48 ~g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpG----------G~v~~glaIyD~i~~i~~~V~Ti~~G~aaS~asl  117 (216)
                      +|.++.+.+.....-+...+.  -.-||-++.|.||          |-...|-.+.+++...+.|+.|+..|.+.+-|..
T Consensus       435 GGv~~pdsa~KaArfI~lcd~--~~lPLv~LvD~pGF~~G~~~E~~Gilk~GA~iv~Ala~~~vP~itvI~~~g~~~GGa  512 (760)
T 3ff6_A          435 GQVWFPDSAYKTAQAIKDFNR--EKLPLMIFANWRGFSGGMKDMYDQVLKFGAYIVDGLRQYKQPILIYIPPYAELRGGS  512 (760)
T ss_dssp             TTCBCHHHHHHHHHHHHHHHH--TTCCEEEECCCCCBCCSHHHHHTTHHHHHHHHHHHHHTCCSCEEEEECTTCEEEHHH
T ss_pred             CCCCCHHHHHHHHHHHHHHCC--CCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCEECCCC
T ss_conf             782557999999999998454--699859995488766668999848999999999999708998799995873533644


Q ss_pred             CCCCC-CCC----CEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC--CH-------------
Q ss_conf             00246-777----14554415664412566665554128999999999999999999987199--98-------------
Q gi|254780272|r  118 LLSAG-EKG----MRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGK--TY-------------  177 (216)
Q Consensus       118 Il~aG-~~g----~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~--~~-------------  177 (216)
                      -.+.| ...    .-|+.|+|++-+-.|.+.+.=...+ +...+.+.+....+.++..+....  +.             
T Consensus       513 ~vv~~~~~~~~~~~vyAwp~A~~gVl~pegav~I~fr~-~~~~~~~~r~d~~~~~l~~~l~~~~~~~~~~~~~~~~~~~r  591 (760)
T 3ff6_A          513 WVVIDATINPLCIEMYADKESRGGVLEPEGTVEIKFRK-KDLIKSMRRIDPAYKKLMEQLGEPDLSDKDRKDLEGRLKAR  591 (760)
T ss_dssp             HHTTCGGGSTTTEEEEEETTCEEESSCHHHHHHHHSCH-HHHHHHHHHHCGGGGHHHHHHTSCCCCHHHHHHHHHHHHHH
T ss_pred             EEECCCCCCCCCCEEEECCCCEEECCCHHHHHHHHHHH-HHHHHHHHCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHH
T ss_conf             46416655776655888662006347899987867501-54443331000567788887414443356788899999999


Q ss_pred             -----HHHHHHH--CCCCCCCHHHHHHCCCCCEEECCC
Q ss_conf             -----9999972--458588889999758864460454
Q gi|254780272|r  178 -----EEVEKTL--DRDHIMSASEACDWGVVDKVLMSR  208 (216)
Q Consensus       178 -----e~i~~~~--~rD~~lsa~EA~eyGliD~Ii~~~  208 (216)
                           +...+..  -.|.+-++..|.+.|.||+||+.+
T Consensus       592 e~~l~~~y~~va~~fadlhd~~~raa~~G~Id~vI~p~  629 (760)
T 3ff6_A          592 EDLLLPIYHQVAVQFADFHDTPGRMLEKGVISDILEWK  629 (760)
T ss_dssp             HHHHHHHHHHHHHHHHHHHSSHHHHHHTTSSSEEECGG
T ss_pred             HHHHHHHHHHHHHHHHHHHCCHHHHHHCCCCCCCCCHH
T ss_conf             98877888999999998516899999658177305859


No 57 
>3p85_A Enoyl-COA hydratase; ssgcid, mycobacerium avium, structural seattle structural genomics center for infectious disease,; HET: 1PE; 1.90A {Mycobacterium avium}
Probab=97.65  E-value=2.6e-05  Score=52.61  Aligned_cols=142  Identities=15%  Similarity=0.134  Sum_probs=88.3

Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHHH------------HHHHHCCCCEEEEEECCCCCCCC
Q ss_conf             831898999999999997411576976999936876146789999------------99864487348998315566520
Q gi|254780272|r   49 GQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIY------------DTMQFIKPPISTFCMGQAASMGS  116 (216)
Q Consensus        49 g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~glaIy------------D~i~~i~~~V~Ti~~G~aaS~as  116 (216)
                      ..++.++...+...|..++..+.-+  -+.|.+.|+...+|.-+-            ..+..++.||...+-|.|.+.|+
T Consensus        47 Nal~~~~~~el~~al~~~~~d~~vr--~vvltg~g~~F~aG~dl~~~~~~~~~~~~~~~~~~~~kPvIaav~G~a~GgG~  124 (270)
T 3p85_A           47 NALSAALRDRFFGALADAETDDDVD--VVIITGADPVFCAGLDLKELGGSSALPDISPRWPALTKPVIGAINGAAVTGGL  124 (270)
T ss_dssp             TCBCHHHHHHHHHHHHHHHHCTTCS--EEEEEESTTCSBCCBCTTTC------CCCCCCCCCCSSCEEEEECSEEETHHH
T ss_pred             CCCCHHHHHHHHHHHHHHHHCCCEE--EEEEECCCCCCCCCCCHHHHCCCHHHHHHHHHHHHCCCCEEEEECCEEEHHHH
T ss_conf             9989999999999999997598916--99997998672467514541221134568999986899999998897550779


Q ss_pred             CCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHHHH
Q ss_conf             00024677714554415664412566665554128999999999999999999987199989999972458588889999
Q gi|254780272|r  117 LLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC  196 (216)
Q Consensus       117 lIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~~lsa~EA~  196 (216)
                      .|.++++  .|++.++++|-+....-|..-...-..       ++.+.+          ......+.+-.-..++|+||+
T Consensus       125 ~lal~~D--~ria~~~a~f~~pe~~lGl~p~~g~~~-------~l~~~i----------g~~~a~~llltg~~~~a~eA~  185 (270)
T 3p85_A          125 ELALYCD--ILIASENARFADTHARVGLLPTWGLSV-------RLPQKV----------GIGLARRMSLTGDYLSAADAL  185 (270)
T ss_dssp             HHHHHSS--EEEEETTCEEECCTTTTTCCCCSSHHH-------HHHHHH----------CHHHHHHHHHHCCCEEHHHHH
T ss_pred             HHHHHCC--EEEECCCCEEECHHHHHCCCCCCCCCE-------EEEECC----------CCCHHHCCCCCCCCCCHHHHH
T ss_conf             9986267--589668877988567518776657532-------320012----------320211110037858789998


Q ss_pred             HCCCCCEEECCCCCCC
Q ss_conf             7588644604542251
Q gi|254780272|r  197 DWGVVDKVLMSRIDIE  212 (216)
Q Consensus       197 eyGliD~Ii~~~~e~~  212 (216)
                      ++||||+|+.. .++.
T Consensus       186 ~~Glv~~vv~~-~~l~  200 (270)
T 3p85_A          186 RAGLVTEVVPH-DQLL  200 (270)
T ss_dssp             HHTSCSEEECG-GGHH
T ss_pred             HCCCEEEEECH-HHHH
T ss_conf             77991297187-8999


No 58 
>3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.80A {Streptomyces avermitilis}
Probab=97.65  E-value=0.00033  Score=45.67  Aligned_cols=137  Identities=15%  Similarity=0.193  Sum_probs=82.1

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCE-EEEEECCCCCHHH---------------------------HHHHHHHHHHCCC
Q ss_conf             31898999999999997411576976-9999368761467---------------------------8999999864487
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEI-SLYINSPGGVVTA---------------------------GMAIYDTMQFIKP  101 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I-~l~INSpGG~v~~---------------------------glaIyD~i~~i~~  101 (216)
                      .++.++...+...+..++.. +  .+ -+.|.|.|+..++                           ...+++.|..++.
T Consensus        31 al~~~~~~~L~~al~~~~~d-~--~vr~vVl~g~g~~ffs~G~dl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~pk  107 (287)
T 3gkb_A           31 VIGATMMRELRTVLTTLADD-S--SVRVIVFSSADPEFFLAHVDMRIGEKMDALQELAASAPADVNVFQAVGELIRHQPQ  107 (287)
T ss_dssp             CBCHHHHHHHHHHHHHHHTC-T--TCCEEEEEESSSSEEECCBCTTGGGSHHHHHHHHHTSCTTCCTTHHHHHHHHHCSS
T ss_pred             CCCHHHHHHHHHHHHHHHHC-C--CCEEEEEECCCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             89999999999999999868-9--94599996789885500327887652001033332107788999999999983999


Q ss_pred             CEEEEEECCCCCCCCCCCCCCCCCCEEECC-CHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCH
Q ss_conf             348998315566520000246777145544-1566441256666---555412899999999999999999998719998
Q gi|254780272|r  102 PISTFCMGQAASMGSLLLSAGEKGMRFALP-NARILLHQPSGGF---SGQASDIERHAQDIVKIKRRLNEIYVKNCGKTY  177 (216)
Q Consensus       102 ~V~Ti~~G~aaS~aslIl~aG~~g~R~~~p-ns~iMiHqps~~~---~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~  177 (216)
                      ||...+-|.|.+.|.-|+++++  .|++.+ +++|-+-...-|.   .|-..       .+.           +..|.  
T Consensus       108 PvIaav~G~a~GgG~~lalacD--~ria~~~~a~f~~pe~~~Gl~p~~g~~~-------~l~-----------~~iG~--  165 (287)
T 3gkb_A          108 VTIVKLAGKARGGGAEFVAAAD--MAFAAAETAGLGQIEALMGIIPGGGGTQ-------YLR-----------GRVGR--  165 (287)
T ss_dssp             EEEEEECSEEETHHHHHHHHSS--EEEEETTTCEEECGGGGGTSCCCSSHHH-------HHH-----------HHHCH--
T ss_pred             CEEEEECCCEEEECCHHCCCCC--CCCCCHHHHCCCCCEEEECCCCCHHHHH-------HHH-----------HHCCH--
T ss_conf             8899957947860511210466--3432101001357411346588646899-------999-----------97188--


Q ss_pred             HHHHHHHCCCCCCCHHHHHHCCCCCEEECCCCCCC
Q ss_conf             99999724585888899997588644604542251
Q gi|254780272|r  178 EEVEKTLDRDHIMSASEACDWGVVDKVLMSRIDIE  212 (216)
Q Consensus       178 e~i~~~~~rD~~lsa~EA~eyGliD~Ii~~~~e~~  212 (216)
                      ....+.+-....++|+||+++||||+|+.. .++.
T Consensus       166 ~~a~~llltg~~~~a~eA~~~Glv~~vv~~-~~l~  199 (287)
T 3gkb_A          166 NRALEVVLTADLFDAETAASYGWINRALPA-DELD  199 (287)
T ss_dssp             HHHHHHHHHCCCEEHHHHHHHTSSSEEECH-HHHH
T ss_pred             HHHHHHHHCCCCCCHHHHHHCCCCEEEECH-HHHH
T ss_conf             889999865884468999985990498387-8999


No 59 
>2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula 19L} PDB: 2q34_A 2q2x_A
Probab=97.61  E-value=0.00012  Score=48.44  Aligned_cols=140  Identities=11%  Similarity=0.105  Sum_probs=86.9

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEE-EEEECCCCCHHHH----------------HHHHHHHHHCCCCEEEEEECCCC
Q ss_conf             318989999999999974115769769-9993687614678----------------99999986448734899831556
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEIS-LYINSPGGVVTAG----------------MAIYDTMQFIKPPISTFCMGQAA  112 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~-l~INSpGG~v~~g----------------laIyD~i~~i~~~V~Ti~~G~aa  112 (216)
                      .++.++...+...+-.++.. +  ++. +.|.+.|+..-+|                +.++..|..++.||...+-|.|.
T Consensus        26 al~~~~~~el~~~~~~~~~d-~--~v~~vvl~g~g~~F~aG~Dl~~~~~~~~~~~~~~~~~~~l~~~~kPvIaav~G~a~  102 (243)
T 2q35_A           26 GFSPSIVEGLRHCFSVVAQN-Q--QYKVVILTGYGNYFSSGASKEFLIRKTRGEVEVLDLSGLILDCEIPIIAAMQGHSF  102 (243)
T ss_dssp             BSCHHHHHHHHHHHHHHHHC-T--TCCEEEEECBTTEEECBSCHHHHHHHHTTCCCCCCCHHHHHTCCSCEEEEECSEEE
T ss_pred             CCCHHHHHHHHHHHHHHHHC-C--CCEEEEEECCCCCEECCCCHHHHHCCCHHHHHHHHHHHHHHHCCCCEEEEECCEEE
T ss_conf             98999999999999999769-8--96799997889844798844544202211378999999998489989999688577


Q ss_pred             CCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCH
Q ss_conf             65200002467771455441566441256666555412899999999999999999998719998999997245858888
Q gi|254780272|r  113 SMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSA  192 (216)
Q Consensus       113 S~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~~lsa  192 (216)
                      +.|..|.++++  .|++.++++|.+-...-|......-    ...+.   +        ..|.  ....+.+-.-..++|
T Consensus       103 GgG~~lal~~D--~~ia~~~a~f~~pe~~~Gl~p~~~~----~~~l~---~--------~iG~--~~a~~l~ltg~~~~a  163 (243)
T 2q35_A          103 GGGLLLGLYAD--FVVFSQESVYATNFMKYGFTPVGAT----SLILR---E--------KLGS--ELAQEMIYTGENYRG  163 (243)
T ss_dssp             THHHHHHHTSS--EEEEESSSEEECCHHHHTSCCCSSH----HHHHH---H--------HHCH--HHHHHHHHHCCCEEH
T ss_pred             ECCCHHCCCCC--EEEECCCCEECCCCCCCCCCCCCCC----CEECC---C--------CCCH--HHHHHHHHCCCCCCH
T ss_conf             16662020466--7875243433165003145556764----11212---2--------3453--888776503898989


Q ss_pred             HHHHHCCCCCEEECCCCCCC
Q ss_conf             99997588644604542251
Q gi|254780272|r  193 SEACDWGVVDKVLMSRIDIE  212 (216)
Q Consensus       193 ~EA~eyGliD~Ii~~~~e~~  212 (216)
                      +||.++||||+|+.. .++.
T Consensus       164 ~eA~~~Glv~~vv~~-~~l~  182 (243)
T 2q35_A          164 KELAERGIPFPVVSR-QDVL  182 (243)
T ss_dssp             HHHHHTTCSSCEECH-HHHH
T ss_pred             HHHHHCCCCEECCCH-HHHH
T ss_conf             999977994070885-7899


No 60 
>1x0u_A Hypothetical methylmalonyl-COA decarboxylase alpha subunit; lyase; 2.20A {Sulfolobus tokodaii str}
Probab=97.61  E-value=0.00011  Score=48.64  Aligned_cols=143  Identities=17%  Similarity=0.240  Sum_probs=90.9

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCC----------CCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCC
Q ss_conf             783189899999999999741157697699993687----------6146789999998644873489983155665200
Q gi|254780272|r   48 TGQIEDHMATLICAQLLFLEAENPQKEISLYINSPG----------GVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSL  117 (216)
Q Consensus        48 ~g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpG----------G~v~~glaIyD~i~~i~~~V~Ti~~G~aaS~asl  117 (216)
                      +|.++.+.+.....-+..-+.  -.-||-.++|+||          |-+.+|-.+.+++...+.|+.|+.+|.+++.|.+
T Consensus       338 ~G~~~~~~a~Kaarfi~lcd~--~~iPlv~lvDtpGf~~G~~~E~~Gi~~~ga~~~~a~a~~~vP~isvi~~~~~Ggg~~  415 (522)
T 1x0u_A          338 GGSIDIDAADKAARFIRFCDA--FNIPLISLVDTPGYVPGTDQEYKGIIRHGAKMLYAFAEATVPKITVIVRKSYGGAHI  415 (522)
T ss_dssp             GGCBCHHHHHHHHHHHHHHHH--TTCCEEEEEEECCBCCSHHHHHTTHHHHHHHHHHHHHHCCSCEEEEEEEEEEHHHHH
T ss_pred             CCCCCHHHHHHHHHHHHHHCC--CCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHH
T ss_conf             787773779999999973300--275479984278777767999972999999999999838998799986765466777


Q ss_pred             CCCCCC--CCCEEECCCHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHH
Q ss_conf             002467--7714554415664412566665554-1289999999999999999999871999899999724585888899
Q gi|254780272|r  118 LLSAGE--KGMRFALPNARILLHQPSGGFSGQA-SDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE  194 (216)
Q Consensus       118 Il~aG~--~g~R~~~pns~iMiHqps~~~~G~~-~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~~lsa~E  194 (216)
                      -+++..  ....++.|++++-.-.|.+.+.=-. .+++. +++-              ...-.+++.+..  +...++..
T Consensus       416 am~~~~~~~d~~~awP~a~~~vm~pEgaa~i~~r~~l~~-a~~~--------------~~~~~~~~~~~~--~~~~~~~~  478 (522)
T 1x0u_A          416 AMSIKSLGADLVYAWPTAEIAVTGPEGAVRILYRKEIQQ-ASNP--------------DDVLKQRIAEYR--KLFANPYW  478 (522)
T ss_dssp             HTCCGGGTCSEEEECTTCEEESSCHHHHHHHHTSSSSSS-SSSS--------------SSSSHHHHHHHH--HHHSSSHH
T ss_pred             HHCCCCCCCCEEEECCCCEEEECCHHHHHHHHHHHHHHH-CCCH--------------HHHHHHHHHHHH--HHHCCHHH
T ss_conf             542667788879996757798459999999986765643-7898--------------999999999999--87579999


Q ss_pred             HHHCCCCCEEECCCC
Q ss_conf             997588644604542
Q gi|254780272|r  195 ACDWGVVDKVLMSRI  209 (216)
Q Consensus       195 A~eyGliD~Ii~~~~  209 (216)
                      |.+.|+||+||+++.
T Consensus       479 aa~~g~iD~VIdP~~  493 (522)
T 1x0u_A          479 AAEKGLVDDVIEPKD  493 (522)
T ss_dssp             HHHTTSSSEECCGGG
T ss_pred             HHHCCCCCEEECHHH
T ss_conf             986688573288799


No 61 
>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium}
Probab=97.58  E-value=0.00053  Score=44.34  Aligned_cols=137  Identities=15%  Similarity=0.277  Sum_probs=87.8

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCE-EEEEECCCCCHHHH---------------HHHHHHHHHCCCCEEEEEECCCCC
Q ss_conf             31898999999999997411576976-99993687614678---------------999999864487348998315566
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEI-SLYINSPGGVVTAG---------------MAIYDTMQFIKPPISTFCMGQAAS  113 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I-~l~INSpGG~v~~g---------------laIyD~i~~i~~~V~Ti~~G~aaS  113 (216)
                      .++.++...+...+-.++.   +.++ .+.|.+.|....+|               ......+..++.||...+-|.|.+
T Consensus        29 al~~~~~~~l~~~l~~~~~---d~~v~~vVl~g~g~~f~~g~~~~~~~~~~~~~~~~~~~~~l~~~~kPvIaav~G~a~G  105 (255)
T 3p5m_A           29 AVDTPMLEELSVHIRDAEA---DESVRAVLLTGAGRAFCSGGDLTGGDTAGAADAANRVVRAITSLPKPVIAGVHGAAVG  105 (255)
T ss_dssp             EECHHHHHHHHHHHHHHHH---CTTCCEEEEEESSSCSBCEECC---CHHHHHHHHHHHHHHHHHCSSCEEEEECSEEET
T ss_pred             CCCHHHHHHHHHHHHHHHH---CCCCEEEEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCEEEE
T ss_conf             9899999999999999974---9992799996667653357743012223431257799999981999899997898873


Q ss_pred             CCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCHH
Q ss_conf             52000024677714554415664412566665554128999999999999999999987199989999972458588889
Q gi|254780272|r  114 MGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSAS  193 (216)
Q Consensus       114 ~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~~lsa~  193 (216)
                      .|..+.++++  .|++.++++|-+-...-|..-...-.       ..+.+.+        |.  ....+.+---..++|+
T Consensus       106 gG~~lal~~D--~ria~~~a~f~~pe~~~Gl~p~~g~~-------~~l~~~~--------g~--~~a~~~~l~g~~~~a~  166 (255)
T 3p5m_A          106 FGCSLALACD--LVVAAPASYFQLAFTRVGLMPDGGAS-------ALLPLLI--------GR--ARTSRMAMTAEKISAA  166 (255)
T ss_dssp             HHHHHHHHSS--EEEECTTCEEECGGGGGTCCCCTTHH-------HHTHHHH--------CH--HHHHHHHHHCCCEEHH
T ss_pred             HHHHHHHHCC--EEEECCCCEEECCCCCCCCCCCCCCC-------CCCCCCC--------CC--CCHHHHHCCCCCCCHH
T ss_conf             7789987378--89978998896772040646555763-------2455445--------43--1002111137878899


Q ss_pred             HHHHCCCCCEEECCC
Q ss_conf             999758864460454
Q gi|254780272|r  194 EACDWGVVDKVLMSR  208 (216)
Q Consensus       194 EA~eyGliD~Ii~~~  208 (216)
                      ||.++||||+|+...
T Consensus       167 ea~~~Glv~~vv~~~  181 (255)
T 3p5m_A          167 TAFEWGMISHITSAD  181 (255)
T ss_dssp             HHHHTTSCSEECCTT
T ss_pred             HHHHCCCCCEEECHH
T ss_conf             998769934881827


No 62 
>3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV}
Probab=97.55  E-value=0.00063  Score=43.87  Aligned_cols=140  Identities=17%  Similarity=0.228  Sum_probs=85.6

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCC------CCH--------------HHHHHHHHHHHHCCCCEEEEEEC
Q ss_conf             3189899999999999741157697699993687------614--------------67899999986448734899831
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISLYINSPG------GVV--------------TAGMAIYDTMQFIKPPISTFCMG  109 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpG------G~v--------------~~glaIyD~i~~i~~~V~Ti~~G  109 (216)
                      .++.++-..+...+-.++.   ++.+ +.+.+.|      +++              .....++..+..++.|+...+-|
T Consensus        28 al~~~~~~~l~~~l~~~~~---d~~V-vi~s~~~~~Fs~G~dl~~~~~~~~~~~~~~~~~~~l~~~l~~~~~p~Ia~v~G  103 (232)
T 3ot6_A           28 AISPDVIIAFNAALDQAEK---DRAI-VIVTGQPGILSGGYDLKVMTSSAEAAINLVAQGSTLARRMLSHPFPIIVACPG  103 (232)
T ss_dssp             CBCHHHHHHHHHHHHHHHH---TTCE-EEEECBTEEEECCBCHHHHHHCHHHHHHHHHHHHHHHHHHHTCSSCEEEECCE
T ss_pred             CCCHHHHHHHHHHHHHHCC---CCEE-EEEECCCCCEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             8999999999999998554---9829-99977999676432243111111246677678999999997089977999806


Q ss_pred             CCCCCCCCCCCCCCCCCEEECCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCC
Q ss_conf             55665200002467771455441-56644125666655541289999999999999999999871999899999724585
Q gi|254780272|r  110 QAASMGSLLLSAGEKGMRFALPN-ARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH  188 (216)
Q Consensus       110 ~aaS~aslIl~aG~~g~R~~~pn-s~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~  188 (216)
                      .|.+.|..|.++++  .|++.++ +++-+.....|......-    ..   .+.+        ..  +.....+.+-...
T Consensus       104 ~~~GgG~~lal~~D--~ria~~~~~~~~~pe~~~Gi~p~~~~----~~---~l~~--------~i--g~~~a~~l~ltg~  164 (232)
T 3ot6_A          104 HAVAKGAFLLLSAD--YRIGVAGPFSIGLNEVQIGMTMHHAG----IE---LARD--------RL--RKSAFNRSVINAE  164 (232)
T ss_dssp             EEETHHHHHHTTSS--EEEEECSSCCEECCTTTTTCCCCHHH----HH---HHHH--------HS--CHHHHHHHHTSCC
T ss_pred             CEECCCCHHHHHCC--CHHHHHCCCCCCCCCEEECCCCCCCH----HH---HHHH--------HC--CHHHHHHHHHCCC
T ss_conf             35066214455146--13453055433230015666567634----45---7777--------72--7257778987089


Q ss_pred             CCCHHHHHHCCCCCEEECCCCCCCC
Q ss_conf             8888999975886446045422510
Q gi|254780272|r  189 IMSASEACDWGVVDKVLMSRIDIEE  213 (216)
Q Consensus       189 ~lsa~EA~eyGliD~Ii~~~~e~~~  213 (216)
                      .++|+||+++||||+|+.. .++.+
T Consensus       165 ~~~a~eA~~~Glv~~v~~~-~~l~~  188 (232)
T 3ot6_A          165 MFDPEGAMAAGFLDKVVSV-EELQG  188 (232)
T ss_dssp             EECHHHHHHHTSCSEEECT-TTHHH
T ss_pred             CCCHHHHHHCCCCCEEECH-HHHHH
T ss_conf             8989999977997587087-89999


No 63 
>3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure initiative; 2.00A {Rhodopseudomonas palustris}
Probab=97.53  E-value=0.00014  Score=47.93  Aligned_cols=139  Identities=17%  Similarity=0.161  Sum_probs=86.7

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCC------CCHH---------------HHHHHHHHHHHCCCCEEEEEE
Q ss_conf             3189899999999999741157697699993687------6146---------------789999998644873489983
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISLYINSPG------GVVT---------------AGMAIYDTMQFIKPPISTFCM  108 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpG------G~v~---------------~glaIyD~i~~i~~~V~Ti~~  108 (216)
                      .++.++...+...|   +..+++ -=-+.|.+.|      +++.               ....+++.|..++.||...+-
T Consensus        39 al~~~~~~~L~~al---~~~d~~-~rvvvl~g~g~~FsaG~Dl~~~~~~~~~~~~~~~~~~~~~~~~i~~~~kPvIaav~  114 (275)
T 3hin_A           39 ALNDGLMAALKDCL---TDIPDQ-IRAVVIHGIGDHFSAGLDLSELRERDATEGLVHSQTWHRVFDKIQYCRVPVIAALK  114 (275)
T ss_dssp             CBCHHHHHHHHHHT---SSCCTT-CCEEEEEESSSCSBCCBCGGGCCCCCHHHHHHHHHHHHHHHHHHHTCSSCEEEEEC
T ss_pred             CCCHHHHHHHHHHH---HHCCCC-CCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             98999999999999---841668-84899967899745888367753200123355667899999999718998899986


Q ss_pred             CCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCC
Q ss_conf             15566520000246777145544156644125666655541289999999999999999999871999899999724585
Q gi|254780272|r  109 GQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH  188 (216)
Q Consensus       109 G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~  188 (216)
                      |.|.+.|..|.++++  .|++.+++++-+.....|......-..    .+-           +..|.  ....+.+-.-.
T Consensus       115 G~a~GgG~~lal~cD--~ria~~~a~f~~pe~~~Gl~p~~~~~~----~l~-----------~~iG~--~~a~~l~ltg~  175 (275)
T 3hin_A          115 GAVIGGGLELACAAH--IRVAEASAYYALPEGSRGIFVGGGGSV----RLP-----------RLIGV--ARMADMMLTGR  175 (275)
T ss_dssp             SEEETHHHHHHHHSS--EEEEETTCEEECGGGGGTCCCCSSHHH----HHH-----------HHHCH--HHHHHHHHHCC
T ss_pred             CEEEHHHHHHHHHCC--CCHHHHHCHHHHHHCEEEECCCHHHHH----HHH-----------HHHCH--HHHHHHHHHCC
T ss_conf             877428899998226--133755233242211062256548888----899-----------87054--67766764089


Q ss_pred             CCCHHHHHHCCCCCEEECCCCCCC
Q ss_conf             888899997588644604542251
Q gi|254780272|r  189 IMSASEACDWGVVDKVLMSRIDIE  212 (216)
Q Consensus       189 ~lsa~EA~eyGliD~Ii~~~~e~~  212 (216)
                      .++|+||+++||||+|+.. .++.
T Consensus       176 ~~~A~eA~~~Glv~~vv~~-~~l~  198 (275)
T 3hin_A          176 VYSAAEGVVHGFSQYLIEN-GSAY  198 (275)
T ss_dssp             CEEHHHHHHHTSCSEEESS-SCHH
T ss_pred             CCCHHHHHHCCCCCEECCH-HHHH
T ss_conf             6869999983996876682-5899


No 64 
>3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein structure initiative; 2.05A {Streptomyces coelicolor A3}
Probab=97.53  E-value=0.00047  Score=44.66  Aligned_cols=150  Identities=17%  Similarity=0.174  Sum_probs=90.3

Q ss_pred             CCCEEEE--CCC-----CCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHH------------------------
Q ss_conf             4677998--783-----189899999999999741157697699993687614678------------------------
Q gi|254780272|r   41 KERIVFV--TGQ-----IEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAG------------------------   89 (216)
Q Consensus        41 ~~Riifl--~g~-----I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~g------------------------   89 (216)
                      +++|..|  +.|     ++.++...+...|-.++.. ++- -.+.|.+.|....+|                        
T Consensus        24 ~~~V~~ItlnrP~~~Nals~~~~~el~~al~~~~~d-~~v-~~vVitg~g~~F~aG~Dl~~~~~~~~~~~~~~~~~~~~~  101 (279)
T 3g64_A           24 TDGVATVTLARPDKLNALTFEAYADLRDLLAELSRR-RAV-RALVLAGEGRGFCSGGDVDEIIGATLSMDTARLLDFNRM  101 (279)
T ss_dssp             ETTEEEEEESCGGGTTCBCHHHHHHHHHHHHHHHHT-TCC-SEEEEEECSSCSBCCBCTTTTHHHHTTCCHHHHHHHHHH
T ss_pred             ECCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHC-CCC-EEEEEECCCCCEEECCCHHHHHHCCCCCHHHHHHHHHHH
T ss_conf             899999997488767898999999999999999609-995-799994798736812505754311210002455555555


Q ss_pred             -HHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             -9999998644873489983155665200002467771455441566441256666-55541289999999999999999
Q gi|254780272|r   90 -MAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGF-SGQASDIERHAQDIVKIKRRLNE  167 (216)
Q Consensus        90 -laIyD~i~~i~~~V~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~-~G~~~di~~~a~el~~~~~~l~~  167 (216)
                       ..++..|+.++.||...+-|.|.+-|.-|.++++  .|++.++++|-+-...-|. .|...-    ...+-        
T Consensus       102 ~~~~~~~i~~~~kPvIaav~G~a~GgG~~lal~cD--~~ia~~~a~f~~pe~~~G~~p~~~g~----~~~l~--------  167 (279)
T 3g64_A          102 TGQVVRAVRECPFPVIAALHGVAAGAGAVLALAAD--FRVADPSTRFAFLFTRVGLSGGDMGA----AYLLP--------  167 (279)
T ss_dssp             HHHHHHHHHHSSSCEEEEECSEEETHHHHHHHHSS--EEEECTTCEEECCGGGGTCCSCCTTH----HHHHH--------
T ss_pred             HHHHHHHHHHCCCCEEEEECCEEEHHHHHHHHHCC--EEECCCCCEEECCHHHCCCCCCCCHH----HHHHH--------
T ss_conf             66666788719998999978965303289987346--76416456553621102847652239----99999--------


Q ss_pred             HHHHHCCCCHHHHHHHHCCCCCCCHHHHHHCCCCCEEECCCCCCC
Q ss_conf             999871999899999724585888899997588644604542251
Q gi|254780272|r  168 IYVKNCGKTYEEVEKTLDRDHIMSASEACDWGVVDKVLMSRIDIE  212 (216)
Q Consensus       168 i~a~~Tg~~~e~i~~~~~rD~~lsa~EA~eyGliD~Ii~~~~e~~  212 (216)
                         +..|.  ....+.+-.-..++|+||+++||||+|+.. .++.
T Consensus       168 ---r~iG~--~~a~~l~l~g~~i~a~eA~~~Glv~~vv~~-~~l~  206 (279)
T 3g64_A          168 ---RVVGL--GHATRLLMLGDTVRAPEAERIGLISELTEE-GRAD  206 (279)
T ss_dssp             ---HHHCH--HHHHHHHHHCCCEEHHHHHHHTCCSEECCT-TCHH
T ss_pred             ---HHHCH--HHHHHHHHCCCCCCHHHHHHCCCCCCCCCH-HHHH
T ss_conf             ---98485--799999981899989999974995403587-8999


No 65 
>2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabolism, lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus HTA426}
Probab=97.53  E-value=0.0016  Score=41.31  Aligned_cols=140  Identities=14%  Similarity=0.112  Sum_probs=81.9

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEE-EEECC-------CCCHHH---------------HHHHHHHHHHCCCCEEEE
Q ss_conf             3189899999999999741157697699-99368-------761467---------------899999986448734899
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISL-YINSP-------GGVVTA---------------GMAIYDTMQFIKPPISTF  106 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l-~INSp-------GG~v~~---------------glaIyD~i~~i~~~V~Ti  106 (216)
                      .++.++...+...+..++.   +.+|.. .|-|.       |+|+..               ...++..|..++.||...
T Consensus        31 al~~~m~~~l~~~l~~~~~---d~~vr~vil~g~g~~~F~aG~Dl~~~~~~~~~~~~~~~~~~~~~~~~i~~~~kpvIaa  107 (265)
T 2ppy_A           31 SYDLEFYKEFNAAIDDIRF---DPDIKVVIVMSDVPKFFSAGADINFLRSADPRFKTQFCLFCNETLDKIARSPQVYIAC  107 (265)
T ss_dssp             CBCHHHHHHHHHHHHHHHT---CTTCCEEEEEECSTTEEECCBCHHHHTTSCHHHHHHHHHHHHHHHHHHHHSSSEEEEE
T ss_pred             CCCHHHHHHHHHHHHHHHH---CCCCEEEEEECCCCCEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             9999999999999999984---9996599996178960567852102101005678899998889999986089878999


Q ss_pred             EECCCCCCCCCCCCCCCCCCEEECC-CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHC
Q ss_conf             8315566520000246777145544-156644125666655541289999999999999999999871999899999724
Q gi|254780272|r  107 CMGQAASMGSLLLSAGEKGMRFALP-NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD  185 (216)
Q Consensus       107 ~~G~aaS~aslIl~aG~~g~R~~~p-ns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~  185 (216)
                      +-|.|...|+.+.++++  .|++.. .+++.+.....|......-..    .+.+           ..|..  ...+.+-
T Consensus       108 v~G~a~GgG~~lal~~D--~ri~~~~~a~~~~pe~~~Gl~p~~~~~~----~l~r-----------~vG~~--~a~~l~l  168 (265)
T 2ppy_A          108 LEGHTVGGGLEMALACD--LRFMGDEAGKIGLPEVSLGVLAGTGGTQ----RLAR-----------LIGYS--RALDMNI  168 (265)
T ss_dssp             ECSEEETHHHHHHHTSS--EEEEETTCCCEECCGGGGTCCCTTTHHH----HHHH-----------HHCHH--HHHHHHH
T ss_pred             ECCEECCCCCEEECCCC--EEEEECCCCCCCCCCCEECCCCCCCHHH----HHHH-----------HHCHH--HHHHHHH
T ss_conf             81723368634410242--6899515423447203567788856899----9999-----------85899--9999997


Q ss_pred             CCCCCCHHHHHHCCCCCEEECCCCCC
Q ss_conf             58588889999758864460454225
Q gi|254780272|r  186 RDHIMSASEACDWGVVDKVLMSRIDI  211 (216)
Q Consensus       186 rD~~lsa~EA~eyGliD~Ii~~~~e~  211 (216)
                      .-..++|+||+++||||+|+......
T Consensus       169 tg~~~~a~eA~~~Glv~~v~~~~~~~  194 (265)
T 2ppy_A          169 TGETITPQEALEIGLVNRVFPQAETR  194 (265)
T ss_dssp             HCCCBCHHHHHHHTSSSEEECGGGHH
T ss_pred             CCCCCCHHHHHHCCCEEEECCHHHHH
T ss_conf             59977899999869924634828999


No 66 
>2x58_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, lyase, isomerase, peroxisome; HET: ADP COA; 2.80A {Rattus norvegicus}
Probab=97.53  E-value=0.00031  Score=45.86  Aligned_cols=137  Identities=20%  Similarity=0.199  Sum_probs=88.6

Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCCE-EEEEECCCCCHHH---------------HHHHHHHHHHCCCCEEEEEECCCC
Q ss_conf             831898999999999997411576976-9999368761467---------------899999986448734899831556
Q gi|254780272|r   49 GQIEDHMATLICAQLLFLEAENPQKEI-SLYINSPGGVVTA---------------GMAIYDTMQFIKPPISTFCMGQAA  112 (216)
Q Consensus        49 g~I~~~~a~~iia~Ll~L~~~~~~k~I-~l~INSpGG~v~~---------------glaIyD~i~~i~~~V~Ti~~G~aa  112 (216)
                      -.++.++...+...+-.++..   .++ -+.|.|.|+...+               .-.+++.|..++.||...+-|.|.
T Consensus        27 Nal~~~~~~~l~~~l~~~~~d---~~v~~vvltg~g~~F~aG~Dl~~~~~~~~~~~~~~~~~~i~~~~kPvIaav~G~a~  103 (727)
T 2x58_A           27 NAVSPTVIREVRNGLQKAGSD---HTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVAL  103 (727)
T ss_dssp             TCBCHHHHHHHHHHHHHHHSC---TTCCEEEEEESTTCSBCCBCGGGCSSSCSCSHHHHHHHHHHTCSSCEEEEECSEEE
T ss_pred             CCCCHHHHHHHHHHHHHHHHC---CCCEEEEEECCCCCCCCCCCHHHHHCCCCHHHHHHHHHHHHHCCCCEEEEECCHHH
T ss_conf             789999999999999998648---99769999898997556808575653590579999999999499989999884532


Q ss_pred             CCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCH
Q ss_conf             65200002467771455441566441256666555412899999999999999999998719998999997245858888
Q gi|254780272|r  113 SMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSA  192 (216)
Q Consensus       113 S~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~~lsa  192 (216)
                      +.|.-|.++++  .|++.++++|-+-...-|..-...-.    .   ++        .+..|.  ..-.+.+-.-..++|
T Consensus       104 GgG~elalacD--~ria~~~a~~g~pev~lGl~p~~ggt----~---~l--------~r~iG~--~~a~~l~l~g~~~~a  164 (727)
T 2x58_A          104 GGGLELALGCH--YRIANAKARVGLPEVTLGILPGARGT----Q---LL--------PRVVGV--PVALDLITSGKYLSA  164 (727)
T ss_dssp             THHHHHHHHSS--EEEEETTCEEECCGGGGTCCCTTTHH----H---HH--------HHHHCH--HHHHHHHHHCCEEEH
T ss_pred             HHHHHHHHHCC--EEEECCCCEEECCCCCCCCCCCCCHH----H---HH--------HHHCCH--HHHHHHHHCCCCCCH
T ss_conf             99999999659--89975997998830051618861699----9---99--------885257--789998753787878


Q ss_pred             HHHHHCCCCCEEECC
Q ss_conf             999975886446045
Q gi|254780272|r  193 SEACDWGVVDKVLMS  207 (216)
Q Consensus       193 ~EA~eyGliD~Ii~~  207 (216)
                      +||+++||||+|+..
T Consensus       165 ~~A~~~Glvd~v~~~  179 (727)
T 2x58_A          165 DEALRLGILDAVVKS  179 (727)
T ss_dssp             HHHHTTTSCSEEESS
T ss_pred             HHHHHCCCCCEECCC
T ss_conf             999865997176475


No 67 
>3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa}
Probab=97.52  E-value=0.00014  Score=48.09  Aligned_cols=135  Identities=14%  Similarity=0.190  Sum_probs=85.8

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHHHHH----------------------HHHCCCCEEEEE
Q ss_conf             3189899999999999741157697699993687614678999999----------------------864487348998
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDT----------------------MQFIKPPISTFC  107 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~glaIyD~----------------------i~~i~~~V~Ti~  107 (216)
                      .++.++...+...+-.++..+ + ---+.|.+.|+..-+|.-+-+.                      +..++.||...+
T Consensus        35 als~~~~~~l~~~l~~~~~d~-~-~~~vvl~g~g~~FsaG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~kPvIa~v  112 (258)
T 3lao_A           35 AFDSAMLADLALAMGEYERSE-E-SRCAVLFAHGEHFTAGLDLMELAPKLAASGFRYPDGGVDPWGVVQPRRSKPLVVAV  112 (258)
T ss_dssp             CBCHHHHHHHHHHHHHHHHCT-T-CCEEEEEESSSCSBCCBCHHHHGGGCBTTBCCCCTTCCCTTSCSSSCCCSCEEEEE
T ss_pred             CCCHHHHHHHHHHHHHHHHCC-C-CEEEEEECCCCCCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             989999999999999997399-9-65999977998661587466525333035677665333489999873899889998


Q ss_pred             ECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             31556652000024677714554415664412566665---554128999999999999999999987199989999972
Q gi|254780272|r  108 MGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFS---GQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTL  184 (216)
Q Consensus       108 ~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~---G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~  184 (216)
                      -|.|.+.|+.|.++++  .|++.++++|-+....-|..   |-..-+   .+               ..|  .....+.+
T Consensus       113 ~G~a~GgG~~lal~~D--~~ia~~~a~f~~pe~~~G~~p~~~~~~~l---~r---------------~ig--~~~a~~l~  170 (258)
T 3lao_A          113 QGTCWTAGIELMLNAD--IAVAARGTRFAHLEVLRGIPPLGGSTVRF---PR---------------AAG--WTDAMRYI  170 (258)
T ss_dssp             CSEEETHHHHHHHTSS--EEEEETTCEEECGGGGTCCCSSCCCCSHH---HH---------------HHC--HHHHHHHH
T ss_pred             ECEEECCCCHHHHCCC--HHHHHHCCEEECHHHCCCCCCCCCHHHHH---HH---------------HHC--HHHHHHHH
T ss_conf             1826037644310335--22130136771643300788420068888---88---------------846--78999884


Q ss_pred             CCCCCCCHHHHHHCCCCCEEECCC
Q ss_conf             458588889999758864460454
Q gi|254780272|r  185 DRDHIMSASEACDWGVVDKVLMSR  208 (216)
Q Consensus       185 ~rD~~lsa~EA~eyGliD~Ii~~~  208 (216)
                      -.-..++|+||+++||||+|+.+.
T Consensus       171 ltg~~~~a~eA~~~Glv~~vv~~~  194 (258)
T 3lao_A          171 LTGDEFDADEALRMRLLTEVVEPG  194 (258)
T ss_dssp             TTCCCEEHHHHHHTTSCSEEECTT
T ss_pred             CCCCCCCHHHHHHCCCEEEEECCC
T ss_conf             128805699997779920884820


No 68 
>3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium 104}
Probab=97.43  E-value=0.00048  Score=44.61  Aligned_cols=136  Identities=12%  Similarity=0.126  Sum_probs=84.7

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECC------CCCHHH--------------------HHHHHHHHHHCCCCE
Q ss_conf             318989999999999974115769769999368------761467--------------------899999986448734
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISLYINSP------GGVVTA--------------------GMAIYDTMQFIKPPI  103 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSp------GG~v~~--------------------glaIyD~i~~i~~~V  103 (216)
                      .++.++...+...+-.++.. ++-. .+.|.+.      |+++..                    ...++..|...+.||
T Consensus        34 al~~~~~~~l~~~l~~~~~d-~~v~-vvvl~g~g~~F~aG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~kPv  111 (267)
T 3oc7_A           34 ALSTALVSQLHQGLRDASSD-PAVR-VVVLAHTGGTFCAGADLSEAGSGGSPSSAYDMAVERAREMAALMRAIVESRLPV  111 (267)
T ss_dssp             CBCHHHHHHHHHHHHHHHHC-TTCC-EEEEEECSSEEECCBC-----------CHHHHHHHHHHHHHHHHHHHHHCSSCE
T ss_pred             CCCHHHHHHHHHHHHHHHHC-CCCE-EEEEECCCCCCCCCCCHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCE
T ss_conf             98999999999999999659-9955-999978899774898779875324430246778999999999999999779988


Q ss_pred             EEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHH
Q ss_conf             89983155665200002467771455441566441256666555412899999999999999999998719998999997
Q gi|254780272|r  104 STFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKT  183 (216)
Q Consensus       104 ~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~  183 (216)
                      ...+-|.|.+.|+-|.++++  .|++.+++++-+.....|......-.....+-..                  ....+.
T Consensus       112 Ia~v~G~a~GgG~~la~~~D--~ria~~~a~f~~~~~~~Gl~p~~g~~~~~~~~~~------------------~~~~~l  171 (267)
T 3oc7_A          112 IAAIDGHVRAGGFGLVGACD--IAVAGPRSSFALTEARIGVAPAIISLTLLPKLSA------------------RAAARY  171 (267)
T ss_dssp             EEEECSEEETTHHHHHHHSS--EEEECTTCEEECCGGGGTCCCTTTHHHHTTTSCH------------------HHHHHH
T ss_pred             EEEEECEECCCCHHHHHHCC--CCEECCCCCEEHHHHCCCCCCCCHHHHHHHHHHH------------------HHHHHH
T ss_conf             99982766115337765123--0111775431125302077873018899999889------------------999999


Q ss_pred             HCCCCCCCHHHHHHCCCCCEEECC
Q ss_conf             245858888999975886446045
Q gi|254780272|r  184 LDRDHIMSASEACDWGVVDKVLMS  207 (216)
Q Consensus       184 ~~rD~~lsa~EA~eyGliD~Ii~~  207 (216)
                      +-...-++++||+++||||++++.
T Consensus       172 lltg~~~~a~eA~~~Glv~~v~e~  195 (267)
T 3oc7_A          172 YLTGEKFDARRAEEIGLITMAAED  195 (267)
T ss_dssp             HHHCCCBCHHHHHHHTSSSEECSS
T ss_pred             HHCCCCCCHHHHHHCCCEEEECHH
T ss_conf             985897787999988985887604


No 69 
>1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A*
Probab=97.43  E-value=0.00025  Score=46.37  Aligned_cols=137  Identities=13%  Similarity=0.183  Sum_probs=85.8

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEEEEE-C-------CCCCHH--------------HHHHHHHHHHHCCCCEEEEE
Q ss_conf             3189899999999999741157697699993-6-------876146--------------78999999864487348998
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISLYIN-S-------PGGVVT--------------AGMAIYDTMQFIKPPISTFC  107 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l~IN-S-------pGG~v~--------------~glaIyD~i~~i~~~V~Ti~  107 (216)
                      .++.++-..+..-|..++  +++ -..+.|- +       -|+|+.              ....+++.|..++.||...+
T Consensus        27 al~~~~~~~L~~al~~~~--~~~-~~~vVl~g~~~g~~F~aG~Dl~~~~~~~~~~~~~~~~~~~~~~~i~~~~kPvIaav  103 (261)
T 1ef8_A           27 ALSKVFIDDLMQALSDLN--RPE-IRCIILRAPSGSKVFSAGHDIHELPSGGRDPLSYDDPLRQITRMIQKFPKPIISMV  103 (261)
T ss_dssp             CCCHHHHHHHHHHHHHTC--STT-CCEEEEECCTTCSEEECCSCSTTC-----CTTCTTSHHHHHHHHHHHCSSCEEEEE
T ss_pred             CCCHHHHHHHHHHHHHHH--CCC-CEEEEEEECCCCCEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             999999999999999973--799-87999971489974766877113434674302466999999999997799889997


Q ss_pred             ECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCC
Q ss_conf             31556652000024677714554415664412566665554128999999999999999999987199989999972458
Q gi|254780272|r  108 MGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD  187 (216)
Q Consensus       108 ~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD  187 (216)
                      -|.|.+.|..|.++++  .|++.+++++-.-.+.-|......-.    ..           +.+..|  .....+.+-..
T Consensus       104 ~G~a~GgG~~lala~D--~ria~~~a~f~~pe~~~G~~~~~g~~----~~-----------l~~~~G--~~~a~~~~l~g  164 (261)
T 1ef8_A          104 EGSVWGGAFEMIMSSD--LIIAASTSTFSMTPVNLGVPYNLVGI----HN-----------LTRDAG--FHIVKELIFTA  164 (261)
T ss_dssp             CSEEETHHHHHHHHSS--EEEEETTCEEECCHHHHTCCCCHHHH----HT-----------TSSSSC--HHHHHHHHHHC
T ss_pred             CCEEEEEEEHHHHHHH--HCCCCCCCCCCCCCCCCCCCCCCCCH----HH-----------HHHHHC--CHHHHHHHHCC
T ss_conf             7488640102445344--40000001235840001235564203----24-----------467717--36789999809


Q ss_pred             CCCCHHHHHHCCCCCEEECCC
Q ss_conf             588889999758864460454
Q gi|254780272|r  188 HIMSASEACDWGVVDKVLMSR  208 (216)
Q Consensus       188 ~~lsa~EA~eyGliD~Ii~~~  208 (216)
                      ..++|+||.++||||+|+...
T Consensus       165 ~~~~a~eA~~~Glv~~v~~~~  185 (261)
T 1ef8_A          165 SPITAQRALAVGILNHVVEVE  185 (261)
T ss_dssp             CCEEHHHHHHTTSCSEEECHH
T ss_pred             CEECHHHHHHCCCCCEECCCH
T ss_conf             844599999759922756804


No 70 
>1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A*
Probab=97.43  E-value=6.8e-05  Score=49.97  Aligned_cols=135  Identities=17%  Similarity=0.204  Sum_probs=84.0

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEE-EEEECCCCCHHHH-------------------HHHHHHHHHCCCCEEEEEEC
Q ss_conf             318989999999999974115769769-9993687614678-------------------99999986448734899831
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEIS-LYINSPGGVVTAG-------------------MAIYDTMQFIKPPISTFCMG  109 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~-l~INSpGG~v~~g-------------------laIyD~i~~i~~~V~Ti~~G  109 (216)
                      .++.++...+...|-.++..   .++. +.|.+.|+...+|                   ..+++.|..++.||...+-|
T Consensus        30 als~~~~~~L~~~l~~~~~d---~~v~~vvl~g~g~~F~aG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~~kPvIaai~G  106 (260)
T 1mj3_A           30 ALCNGLIEELNQALETFEED---PAVGAIVLTGGEKAFAAGADIKEMQNRTFQDCYSGKFLSHWDHITRIKKPVIAAVNG  106 (260)
T ss_dssp             CBCHHHHHHHHHHHHHHHHC---TTCCEEEEECCSSEEECCBCHHHHTTCCHHHHHHC--CCGGGGGGGCSSCEEEEECS
T ss_pred             CCCHHHHHHHHHHHHHHHHC---CCEEEEEEECCCCCEECCCCHHHHCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             99999999999999999858---990799997799953278765653235314567889999998852599829999887


Q ss_pred             CCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCC
Q ss_conf             55665200002467771455441566441256666---555412899999999999999999998719998999997245
Q gi|254780272|r  110 QAASMGSLLLSAGEKGMRFALPNARILLHQPSGGF---SGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR  186 (216)
Q Consensus       110 ~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~---~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~r  186 (216)
                      .|.+.|..|.++++  .|++.++++|-+-...-|.   .|-..-+       -+.           .|  .....+.+-.
T Consensus       107 ~a~GgG~~lal~cD--~~ia~~~a~f~~pe~~~Gl~p~~g~~~~l-------~~~-----------iG--~~~a~~l~l~  164 (260)
T 1mj3_A          107 YALGGGCELAMMCD--IIYAGEKAQFGQPEILLGTIPGAGGTQRL-------TRA-----------VG--KSLAMEMVLT  164 (260)
T ss_dssp             EEETHHHHHHHHSS--EEEEETTCEEECGGGGGTCCCCSSTTTHH-------HHH-----------HC--HHHHHHHHHH
T ss_pred             EEEHHHHHHHHHCC--EEEECCCCEEECCCCCCCCCCCCCHHHHH-------HHH-----------HH--HHHHHHHHHC
T ss_conf             56199999999789--99976998898950150658641399999-------998-----------42--8999999653


Q ss_pred             CCCCCHHHHHHCCCCCEEECCCC
Q ss_conf             85888899997588644604542
Q gi|254780272|r  187 DHIMSASEACDWGVVDKVLMSRI  209 (216)
Q Consensus       187 D~~lsa~EA~eyGliD~Ii~~~~  209 (216)
                      -..++|+||.++||||+|+....
T Consensus       165 g~~~~a~eA~~~Glv~~v~~~~~  187 (260)
T 1mj3_A          165 GDRISAQDAKQAGLVSKIFPVET  187 (260)
T ss_dssp             CCCEEHHHHHHHTSCSEEECTTT
T ss_pred             CCCCCHHHHHHCCCCEEEECHHH
T ss_conf             87147788987898178723255


No 71 
>1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A
Probab=97.35  E-value=0.00076  Score=43.36  Aligned_cols=137  Identities=12%  Similarity=0.149  Sum_probs=81.7

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCE-EEEEECC------CCCHHH--------------------------HHHHHHHH
Q ss_conf             31898999999999997411576976-9999368------761467--------------------------89999998
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEI-SLYINSP------GGVVTA--------------------------GMAIYDTM   96 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I-~l~INSp------GG~v~~--------------------------glaIyD~i   96 (216)
                      .++.++-..+..-+..++.   +.+| .+.|.+.      |+|+..                          ...+++.|
T Consensus        32 al~~~~~~~l~~al~~~~~---d~~v~~vvltg~g~~F~aG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i  108 (280)
T 1pjh_A           32 ALEGEDYIYLGELLELADR---NRDVYFTIIQSSGRFFSSGADFKGIAKAQGDDTNKYPSETSKWVSNFVARNVYVTDAF  108 (280)
T ss_dssp             CBCHHHHHHHHHHHHHHHH---CTTCCEEEEECBTTBSBCCBCHHHHHC-------CCSSHHHHHHHHTHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHHH---CCCCEEEEEECCCCCEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9899999999999999974---9997699996699874388726888722345421110134789999999999999999


Q ss_pred             HHCCCCEEEEEECCCCCCCCCCCCCCCCCCEEECCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             644873489983155665200002467771455441-5664412566665554128999999999999999999987199
Q gi|254780272|r   97 QFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPN-ARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGK  175 (216)
Q Consensus        97 ~~i~~~V~Ti~~G~aaS~aslIl~aG~~g~R~~~pn-s~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~  175 (216)
                      ..++.||...+-|.|.+.|..|.++++  .|++.+. +++-.-...-|..   .+.-. ...+-+.           -| 
T Consensus       109 ~~~~kPvIaav~G~a~GgG~~lal~~D--~ria~~d~~~~~~pe~~~Gl~---p~~g~-~~~l~~~-----------vG-  170 (280)
T 1pjh_A          109 IKHSKVLICCLNGPAIGLSAALVALCD--IVYSINDKVYLLYPFANLGLI---TEGGT-TVSLPLK-----------FG-  170 (280)
T ss_dssp             HHCCSEEEEEECSCEEHHHHHHHHHSS--EEEESSTTCEEECCHHHHTCC---CCTTH-HHHHHHH-----------HC-
T ss_pred             HHCCCCEEEEECCEECCCCCCCCCCCC--HHHHHHHHHHHCCCCCCCCCC---CCCCC-CCCHHHH-----------HH-
T ss_conf             968999899977810146642332210--577644423423620167838---87323-2114777-----------35-


Q ss_pred             CHHHHHHHHCCCCCCCHHHHHHCCCCCEEECCC
Q ss_conf             989999972458588889999758864460454
Q gi|254780272|r  176 TYEEVEKTLDRDHIMSASEACDWGVVDKVLMSR  208 (216)
Q Consensus       176 ~~e~i~~~~~rD~~lsa~EA~eyGliD~Ii~~~  208 (216)
                       .....+.+-.-..++|+||+++||||+|+...
T Consensus       171 -~~~a~~llltg~~~~a~eA~~~Glv~~vv~~~  202 (280)
T 1pjh_A          171 -TNTTYECLMFNKPFKYDIMCENGFISKNFNMP  202 (280)
T ss_dssp             -HHHHHHHHHTTCCEEHHHHHHTTCCSEECCCC
T ss_pred             -HHHHHHHHHCCCCCCHHHHHHCCCEEEEECCC
T ss_conf             -99999999839957799999879944874871


No 72 
>3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi}
Probab=97.24  E-value=0.00082  Score=43.15  Aligned_cols=139  Identities=19%  Similarity=0.248  Sum_probs=83.3

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHH---------------------------HHHHHHHHHCCCC
Q ss_conf             3189899999999999741157697699993687614678---------------------------9999998644873
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAG---------------------------MAIYDTMQFIKPP  102 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~g---------------------------laIyD~i~~i~~~  102 (216)
                      .++.++...+...+-.++. |++- =-+.|.+.|+...+|                           ..++..+..++.|
T Consensus        29 al~~~~~~~l~~~l~~~~~-d~~v-~~vVl~g~g~~F~aG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~kp  106 (263)
T 3l3s_A           29 PLSRAMIAALHDALRRAMG-DDHV-HVLVIHGPGRIFCAGHDLKEIGRHRADPDEGRAFVTDLFEACSALMLDLAHCPKP  106 (263)
T ss_dssp             CCCHHHHHHHHHHHHHHHT-CTTC-CEEEEECCSSEEECCSCSCCCCC-----CCSHHHHHHHHHHHHHHHHHHHTCSSC
T ss_pred             CCCHHHHHHHHHHHHHHHH-CCCC-EEEEEECCCCCEEECCCCHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             9999999999999999975-8895-6999978999858675202133444454200246789999999999999867998


Q ss_pred             EEEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHH
Q ss_conf             489983155665200002467771455441566441256666-5554128999999999999999999987199989999
Q gi|254780272|r  103 ISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGF-SGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVE  181 (216)
Q Consensus       103 V~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~-~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~  181 (216)
                      |...+-|.|.+.|..|.++++  .|++.+++++.+-....|. .+-..     ..            +.+.-|  ...-.
T Consensus       107 vIaav~G~a~GgG~~lal~~D--~ria~~~a~~~~p~~~~g~~~~~~~-----~~------------l~r~ig--~~~a~  165 (263)
T 3l3s_A          107 TIALVEGIATAAGLQLMAACD--LAYASPAARFCLPGVQNGGFCTTPA-----VA------------VSRVIG--RRAVT  165 (263)
T ss_dssp             EEEEESSEEETHHHHHHHHSS--EEEECTTCEEECCTTTTTSCCHHHH-----HH------------HHTTSC--HHHHH
T ss_pred             EEEEECCCEECCCHHHHHCCC--CCEECCCCEECCCCCEEECCCCCCC-----CH------------HHHHHH--HHHHH
T ss_conf             899845807614163454223--3222102412164220611510133-----10------------233454--66665


Q ss_pred             HHHCCCCCCCHHHHHHCCCCCEEECCCCCCC
Q ss_conf             9724585888899997588644604542251
Q gi|254780272|r  182 KTLDRDHIMSASEACDWGVVDKVLMSRIDIE  212 (216)
Q Consensus       182 ~~~~rD~~lsa~EA~eyGliD~Ii~~~~e~~  212 (216)
                      +.+-.-.-++|+||+++||||+|+.. .++.
T Consensus       166 ~l~ltg~~i~a~eA~~~Glv~~vv~~-~~l~  195 (263)
T 3l3s_A          166 EMALTGATYDADWALAAGLINRILPE-AALA  195 (263)
T ss_dssp             HHHHHCCEEEHHHHHHHTSSSEECCH-HHHH
T ss_pred             HHCCCCCCCCHHHHHHCCCCCEECCH-HHHH
T ss_conf             42265886689999986996386288-8999


No 73 
>3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.30A {Shewanella oneidensis mr-1}
Probab=97.18  E-value=0.00089  Score=42.93  Aligned_cols=141  Identities=17%  Similarity=0.174  Sum_probs=89.1

Q ss_pred             EEEECCC-----CCHHHHHHHHHHHHHHHHCCCCCCEEEEE-ECC-------CCCHHHH---------------------
Q ss_conf             7998783-----18989999999999974115769769999-368-------7614678---------------------
Q gi|254780272|r   44 IVFVTGQ-----IEDHMATLICAQLLFLEAENPQKEISLYI-NSP-------GGVVTAG---------------------   89 (216)
Q Consensus        44 iifl~g~-----I~~~~a~~iia~Ll~L~~~~~~k~I~l~I-NSp-------GG~v~~g---------------------   89 (216)
                      +|-|+-|     ++.++...+...|..++.   +..|...| .+-       |||+.+-                     
T Consensus        54 ~ItLNRP~~lNAl~~~m~~~l~~~l~~~~~---d~~v~~vVl~g~G~kaFcAG~Dl~~l~~~~~~~~~~~~~~~~~~~~~  130 (407)
T 3ju1_A           54 VVTLNVEKALNALDLDMVRAMTVQLNLWKK---DPLIACVVLDGSGEKAFCAGGDVRALYHASVAAKGQVTEVAKVFFEE  130 (407)
T ss_dssp             EEEECCGGGTSCBCHHHHHHHHHHHHHHHH---CTTEEEEEEEESSSSEEECCBCCHHHHHHHHHHTSSCCHHHHHHHHH
T ss_pred             EEEECCCCCCCCCCHHHHHHHHHHHHHHHH---CCCCEEEEEEECCCCCEECCCCHHHHHHCCCCCCCCCHHHHHHHHHH
T ss_conf             999817886789899999999999999974---98957999980799971078188988513333334301589999998


Q ss_pred             -HHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             -9999998644873489983155665200002467771455441566441256666555412899999999999999999
Q gi|254780272|r   90 -MAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEI  168 (216)
Q Consensus        90 -laIyD~i~~i~~~V~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i  168 (216)
                       ..+...|...+.||...+-|.|.+-|.-|.++++  .|++.++++|-+-...-|+.   .+.-. ...+.         
T Consensus       131 ~~~~~~~i~~~~kPvIa~v~G~a~GgG~~lal~~D--~riate~a~f~~pe~~iGl~---P~~G~-s~~~~---------  195 (407)
T 3ju1_A          131 EYRLDYLLHTYGKPVLVWGDGIVMGGGLGLMAGAS--HKVVTETSRIAMPEVTIGLY---PDVGG-SYFLN---------  195 (407)
T ss_dssp             HHHHHHHHHTCSSCEEEECCSEEETHHHHHHHHCS--EEEECTTCEEECGGGGGTCC---SCTTH-HHHTT---------
T ss_pred             HHHHHHHHHHCCCCEEEEECCEEECCCCCCCCCCC--CCCCCCCCEEECHHHCEEEC---CCCHH-HHHHH---------
T ss_conf             88999999855993899976702045520002456--46558987983234145427---98115-46746---------


Q ss_pred             HHHHCCCCHHHHHHHHCCCCCCCHHHHHHCCCCCEEECC
Q ss_conf             998719998999997245858888999975886446045
Q gi|254780272|r  169 YVKNCGKTYEEVEKTLDRDHIMSASEACDWGVVDKVLMS  207 (216)
Q Consensus       169 ~a~~Tg~~~e~i~~~~~rD~~lsa~EA~eyGliD~Ii~~  207 (216)
                         +.+...-.  ..+-.-..++|+||+++||||+++.+
T Consensus       196 ---~~~~~~~~--~l~ltG~~i~a~eA~~~Glv~~vv~~  229 (407)
T 3ju1_A          196 ---RMPGKMGL--FLGLTAYHMNAADACYVGLADHYLNR  229 (407)
T ss_dssp             ---TSSTTHHH--HHHHHCCCBCHHHHHHHTSCSEECCG
T ss_pred             ---HCCHHHHH--HHHHHCCCCCHHHHHHCCCCEEECCH
T ss_conf             ---23528888--98865897765789874974175386


No 74 
>3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A
Probab=97.11  E-value=0.0027  Score=39.87  Aligned_cols=138  Identities=12%  Similarity=0.036  Sum_probs=79.5

Q ss_pred             CCHHHHHHHHHHHHHHHH---CCCCCCEEEEEECC------CCCHHHHH----------------HHHHHH------HHC
Q ss_conf             189899999999999741---15769769999368------76146789----------------999998------644
Q gi|254780272|r   51 IEDHMATLICAQLLFLEA---ENPQKEISLYINSP------GGVVTAGM----------------AIYDTM------QFI   99 (216)
Q Consensus        51 I~~~~a~~iia~Ll~L~~---~~~~k~I~l~INSp------GG~v~~gl----------------aIyD~i------~~i   99 (216)
                      ++.++...+...+-.+..   .++..--.+.+.+-      |||+..-.                ...+.+      ..+
T Consensus        60 ~~~~m~~el~~~~~~~~~~~~~~~~~~~~vVl~g~g~~FcaG~DL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  139 (305)
T 3m6n_A           60 FSTRLVDDITGYQTNLGQRLNTAGVLAPHVVLASDSDVFNLGGDLALFCQLIREGDRARLLDYAQRCVRGVHAFHVGLGA  139 (305)
T ss_dssp             BCHHHHHHHHHHHHHHHHHHHHHTCSSCEEEEEESSSSSBCCBCHHHHHHHHHHTCHHHHHHHHHHHHHHHHHHHTGGGT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCEECCCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             26999999999999899998505766308999579993767889999975302653789999999999999999997569


Q ss_pred             CCCEEEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHH
Q ss_conf             87348998315566520000246777145544156644125666655541289999999999999999999871999899
Q gi|254780272|r  100 KPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEE  179 (216)
Q Consensus       100 ~~~V~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~  179 (216)
                      +.|+...+-|.|.+.|.-|.++++  .|++.++++|-+-....|..   .+.-.    .        ..+.+..|.  ..
T Consensus       140 ~kP~IAav~G~a~GgG~~lalacD--~~ia~~~a~f~~pe~~~Gl~---p~~g~----~--------~~l~r~vG~--~~  200 (305)
T 3m6n_A          140 RAHSIALVQGNALGGGFEAALSCH--TIIAEEGVMMGLPEVLFDLF---PGMGA----Y--------SFMCQRISA--HL  200 (305)
T ss_dssp             TCEEEEEECSCEETHHHHHHHHSS--EEEEETTCEEECGGGGGTCC---CCSSH----H--------HHHTTTSCH--HH
T ss_pred             CCCEEEEECCCEEHHHHHHHHHHH--HHHCCCCCCCCCHHHCCCCC---CCCCH----H--------HHHHHHCCH--HH
T ss_conf             998999988705089999999854--77053443135704305889---88535----8--------999986069--99


Q ss_pred             HHHHHCCCCCCCHHHHHHCCCCCEEECC
Q ss_conf             9997245858888999975886446045
Q gi|254780272|r  180 VEKTLDRDHIMSASEACDWGVVDKVLMS  207 (216)
Q Consensus       180 i~~~~~rD~~lsa~EA~eyGliD~Ii~~  207 (216)
                      -.+.+-.-..++|+||+++||||+|+..
T Consensus       201 a~~l~ltg~~~~a~eA~~~Glv~~vv~~  228 (305)
T 3m6n_A          201 AQKIMLEGNLYSAEQLLGMGLVDRVVPR  228 (305)
T ss_dssp             HHHHHHHCCEEEHHHHHHHTSCSEEECT
T ss_pred             HHHHHHCCCCCCHHHHHHCCCCEEEECH
T ss_conf             9999965899989999877993087185


No 75 
>2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A*
Probab=96.97  E-value=0.00076  Score=43.38  Aligned_cols=139  Identities=14%  Similarity=0.080  Sum_probs=82.8

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCEEEEE-E---------------CCCCCHHHH---------------H-HHHHHH-
Q ss_conf             318989999999999974115769769999-3---------------687614678---------------9-999998-
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEISLYI-N---------------SPGGVVTAG---------------M-AIYDTM-   96 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I~l~I-N---------------SpGG~v~~g---------------l-aIyD~i-   96 (216)
                      .++.++...+...+-.++..+   .|...| -               |.|+|+...               + .+.+.+ 
T Consensus       190 Als~~m~~eL~~al~~~~~D~---~VrvVVLtGa~~~~~~~~gGr~FcAG~DL~el~~~~~~~~~~~~~~~~~~~~~~~~  266 (440)
T 2np9_A          190 AEDGQQVDDMETAVDLALLDP---GVRVGLLRGGVMSHPRYRGKRVFSAGINLKYLSQGGISLVDFLMRRELGYIHKLVR  266 (440)
T ss_dssp             CBCHHHHHHHHHHHHHHHHCT---TCSEEEEEECBCCSTTTTTCBCCBCCBCHHHHHTTCCCTTTTHHHHHHTHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHHHCC---CCEEEEEECCCCCCCCCCCCCEEECCCCHHHHHHCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             999999999999999996299---96499996888666657888877548199988616776421566654567889998


Q ss_pred             --------------HHCCCCEEEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             --------------644873489983155665200002467771455441566441256666555412899999999999
Q gi|254780272|r   97 --------------QFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIK  162 (216)
Q Consensus        97 --------------~~i~~~V~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~  162 (216)
                                    ..++.||...+-|.|.+.|+.|.++++  .|++.++++|-+....-|..   .+.. ..    .+.
T Consensus       267 ~~~~~~~~~~~~~~~~~~KPvIAaVnG~A~GGG~eLalacD--~rIAae~A~F~lPe~~lGi~---Pg~g-s~----~L~  336 (440)
T 2np9_A          267 GVLTNDDRPGWWHSPRIEKPWVAAVDGFAIGGGAQLLLVFD--RVLASSDAYFSLPAAKEGII---PGAA-NL----RLG  336 (440)
T ss_dssp             CEECCSCSTTTTTCCEECCCEEEEECSEEETHHHHHGGGCS--EEEEETTCEEECCCTTTCCC---CTTH-HH----HHH
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEECCEEECCCCEEECCCC--CCCCCCCCCCCCCCCCEECC---CCCH-HH----HHH
T ss_conf             87655467999999848998899966845617650123755--02003013025865445128---8702-87----999


Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHHHHHCCCCCEEECCCCCCC
Q ss_conf             99999999871999899999724585888899997588644604542251
Q gi|254780272|r  163 RRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGVVDKVLMSRIDIE  212 (216)
Q Consensus       163 ~~l~~i~a~~Tg~~~e~i~~~~~rD~~lsa~EA~eyGliD~Ii~~~~e~~  212 (216)
                      +.+-.-          ...+.+-.-..++|+||+++||||+|+.. .++.
T Consensus       337 r~vG~~----------~A~ellLtG~~isA~EA~~~GLV~eVVp~-deL~  375 (440)
T 2np9_A          337 RFAGPR----------VSRQVILEGRRIWAKEPEARLLVDEVVEP-DELD  375 (440)
T ss_dssp             HHHHHH----------HHHHHHHHCCCEETTSGGGGGTCSEEECH-HHHH
T ss_pred             HHHCHH----------HHHHHHHCCCCCCHHHHHHCCCCEEECCH-HHHH
T ss_conf             985999----------99999974991779999976985077685-8999


No 76 
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana}
Probab=96.95  E-value=0.00037  Score=45.33  Aligned_cols=135  Identities=17%  Similarity=0.193  Sum_probs=83.5

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCE-EEEEECCCCCHHHHH------------------------HHHHHHHHCCCCEE
Q ss_conf             31898999999999997411576976-999936876146789------------------------99999864487348
Q gi|254780272|r   50 QIEDHMATLICAQLLFLEAENPQKEI-SLYINSPGGVVTAGM------------------------AIYDTMQFIKPPIS  104 (216)
Q Consensus        50 ~I~~~~a~~iia~Ll~L~~~~~~k~I-~l~INSpGG~v~~gl------------------------aIyD~i~~i~~~V~  104 (216)
                      .++.++-..+...+-.++.   +.+| -+.|.+.|+..-+|.                        .+++.|..++.||.
T Consensus        30 al~~~~~~~L~~al~~~~~---d~~vr~vVltg~g~~F~aG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~kPvI  106 (725)
T 2wtb_A           30 SLSFDVLYNLKSNYEEALS---RNDVKAIVITGAKGRFSGGFDISGFGEMQKGNVKEPKAGYISIDIITDLLEAARKPSV  106 (725)
T ss_dssp             CCCHHHHHHHHHHHHHHTT---CTTCCEEEEEESSSCCBCSSCC------------CCSSSHHHHHCCCCCCCTSSSCEE
T ss_pred             CCCHHHHHHHHHHHHHHHH---CCCCEEEEEECCCCCCEECCCHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEE
T ss_conf             7999999999999999965---8997699998889980307374747523467766788888899999999981999899


Q ss_pred             EEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHH
Q ss_conf             9983155665200002467771455441566441256666---5554128999999999999999999987199989999
Q gi|254780272|r  105 TFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGF---SGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVE  181 (216)
Q Consensus       105 Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~---~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~  181 (216)
                      ..+-|.|.+.|.-|.++++  .|++.++++|-+-...-|.   .|-..       .+           .+..|.  ..-.
T Consensus       107 Aav~G~a~GGG~elalacD--~ria~~~a~fg~PEv~lGl~P~~gg~~-------~L-----------~r~iG~--~~A~  164 (725)
T 2wtb_A          107 AAIDGLALGGGLELAMACH--ARISAPAAQLGLPELQLGVIPGFGGTQ-------RL-----------PRLVGL--TKAL  164 (725)
T ss_dssp             EEECSEEETHHHHHHHHSS--EEEECTTCEEECCGGGGTCCCCSSHHH-------HH-----------HHHHCH--HHHH
T ss_pred             EEECCEEEHHHHHHHHHCC--EEEEECCCEEECCHHHCCCCCCCCHHH-------HH-----------HHHHHH--HHHH
T ss_conf             9988735089999999689--899719979988035308478711457-------88-----------887457--8899


Q ss_pred             HHHCCCCCCCHHHHHHCCCCCEEECCCC
Q ss_conf             9724585888899997588644604542
Q gi|254780272|r  182 KTLDRDHIMSASEACDWGVVDKVLMSRI  209 (216)
Q Consensus       182 ~~~~rD~~lsa~EA~eyGliD~Ii~~~~  209 (216)
                      +.+-....++|+||.++|+||+|+.+..
T Consensus       165 ~l~ltg~~~~a~eA~~~Glv~~vv~~~~  192 (725)
T 2wtb_A          165 EMILTSKPVKAEEGHSLGLIDAVVPPAE  192 (725)
T ss_dssp             HHHHHCCCEEHHHHHHHTSCSEECCTTT
T ss_pred             HHHHHCCCCCHHHHHHCCCCEEECCCHH
T ss_conf             9987267754566530554024325315


No 77 
>3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, AC tepraloxydim, ATP-binding, biotin, cytoplasm, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 3h0s_A* 3h0j_A* 3h0q_A* 1od2_A* 1od4_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A
Probab=96.37  E-value=0.057  Score=31.52  Aligned_cols=160  Identities=15%  Similarity=0.073  Sum_probs=85.5

Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCC----------CCHHHHHHHHHHHHHCCCCEEEEEEC--CCCCCCC
Q ss_conf             83189899999999999741157697699993687----------61467899999986448734899831--5566520
Q gi|254780272|r   49 GQIEDHMATLICAQLLFLEAENPQKEISLYINSPG----------GVVTAGMAIYDTMQFIKPPISTFCMG--QAASMGS  116 (216)
Q Consensus        49 g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpG----------G~v~~glaIyD~i~~i~~~V~Ti~~G--~aaS~as  116 (216)
                      |.+..+.+.....-+.-| ...-.-|+-.+.|.||          |-+..|-.+.+++...+.|+.|+..|  .+.+.+.
T Consensus       447 gv~~p~sa~K~ArfI~~l-cd~~~LPLv~LvDtpGF~~G~~aE~~Giik~GA~iv~Ala~a~vP~itvI~~~g~~~GGay  525 (758)
T 3k8x_A          447 QVWHPNSAFKTAQAINDF-NNGEQLPMMILANWRGFSGGQRDMFNEVLKYGSFIVDALVDYKQPIIIYIPPTGELRGGSW  525 (758)
T ss_dssp             TEECHHHHHHHHHHHHHH-HHTSCCCEEECCCCCEECCSHHHHHTTHHHHHHHHHHHHHTCCSCEEEEECTTCEEETHHH
T ss_pred             CCCCCHHHHHHHHHHHHH-HHHCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCEECCHHH
T ss_conf             856706899999999999-8612886699971888776789998339999999999997589987999947744512125


Q ss_pred             CCCCCCCCC---CEEECCCHHHHHHHHHHHHHHHH--HHHHHHHHHH----HHHHHHHHHHH-------------HHHCC
Q ss_conf             000246777---14554415664412566665554--1289999999----99999999999-------------98719
Q gi|254780272|r  117 LLLSAGEKG---MRFALPNARILLHQPSGGFSGQA--SDIERHAQDI----VKIKRRLNEIY-------------VKNCG  174 (216)
Q Consensus       117 lIl~aG~~g---~R~~~pns~iMiHqps~~~~G~~--~di~~~a~el----~~~~~~l~~i~-------------a~~Tg  174 (216)
                      +.+.....+   .-|+.|+|++=.-.|.+.+.=-.  .+....++.+    ..+++++.+-+             .++..
T Consensus       526 vv~~~~~~~~~~~vyAwp~A~~gVm~pEgav~I~fR~e~~~~~~~r~d~~~~el~~~l~~~~~aae~~~~~~~~~~~re~  605 (758)
T 3k8x_A          526 VVVDPTINADQMEMYADVNARAGVLEPQGMVGIKFRREKLLDTMNRLDDKYRELRSQLSNKSLAPEVHQQISKQLADRER  605 (758)
T ss_dssp             HTTCGGGSTTTEEEEEETTCEEESSCHHHHHHHHSCHHHHHHHHHHHCSCCCCC--------------------------
T ss_pred             HHCCCCCCCCCCEEEECCCCEEEECCHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             42376547765537786720388178999989781641100352216999999999863943265668889999999999


Q ss_pred             CCHHHHHHHH--CCCCCCCHHHHHHCCCCCEEECCCC
Q ss_conf             9989999972--4585888899997588644604542
Q gi|254780272|r  175 KTYEEVEKTL--DRDHIMSASEACDWGVVDKVLMSRI  209 (216)
Q Consensus       175 ~~~e~i~~~~--~rD~~lsa~EA~eyGliD~Ii~~~~  209 (216)
                      +-.....+..  -.|.+-++..+++-|.||+||+.+.
T Consensus       606 ~l~~~y~~va~~fa~lhd~~~rm~a~G~I~~vi~~~~  642 (758)
T 3k8x_A          606 ELLPIYGQISLQFADLHDRSSRMVAKGVISKELEWTE  642 (758)
T ss_dssp             --HHHHHHHHHHHHHTTSBHHHHHHHTCSSEEECGGG
T ss_pred             HHHHHHHHHHHHHHHHCCCHHHHHHCCCCCCCCCHHH
T ss_conf             8778899999999983085877875283773328788


No 78 
>2f9i_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus}
Probab=93.00  E-value=0.49  Score=25.64  Aligned_cols=128  Identities=18%  Similarity=0.266  Sum_probs=76.3

Q ss_pred             EECCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHHHHH----------HHHCCCCEEEEEE-CCCCCC
Q ss_conf             98783189899999999999741157697699993687614678999999----------8644873489983-155665
Q gi|254780272|r   46 FVTGQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDT----------MQFIKPPISTFCM-GQAASM  114 (216)
Q Consensus        46 fl~g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~glaIyD~----------i~~i~~~V~Ti~~-G~aaS~  114 (216)
                      |++|.+.......++...-+  +....-|+-+++.|.|+-+.+|..-...          ++....|..++.. +.+++.
T Consensus       132 f~GGS~g~~~geki~ra~e~--A~~~~lP~I~~~~SGGaRmqeg~~sl~~~~~~~~a~~~~~~~gip~I~v~~~p~~GG~  209 (285)
T 2f9i_B          132 FRMGSMGSVIGEKICRIIDY--CTENRLPFILFSASGGARMQEGIISLMQMGKTSVSLKRHSDAGLLYISYLTHPTTGGV  209 (285)
T ss_dssp             TGGGCCCHHHHHHHHHHHHH--HHHTTCCEEEEEEECSCCGGGHHHHHHHHHHHHHHHHHHHHTTCCEEEEEEEEEEHHH
T ss_pred             CCCCCCCHHHHHHHHHHHHH--HHHCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHH
T ss_conf             15781788898999999999--9851897699815878184763310455529999999998689976999838845003


Q ss_pred             CCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHH
Q ss_conf             20000246777145544156644125666655541289999999999999999999871999899999724585888899
Q gi|254780272|r  115 GSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE  194 (216)
Q Consensus       115 aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e~i~~~~~rD~~lsa~E  194 (216)
                      ++.....++  -..+-|+|++.+-       |+.        -+           ..-+|..       +. +-+-+|+-
T Consensus       210 ~as~a~~~d--iii~e~~a~i~fa-------GPr--------Vi-----------~~~~ge~-------~p-e~f~~a~~  253 (285)
T 2f9i_B          210 SASFASVGD--INLSEPKALIGFA-------GRR--------VI-----------EQTINEK-------LP-DDFQTAEF  253 (285)
T ss_dssp             HTTGGGCCS--EEEECTTCBEESS-------CHH--------HH-----------HHHHTSC-------CC-TTTTBHHH
T ss_pred             HHHHHHCCC--EEEEECCEEEEEE-------CHH--------HH-----------HHHHCCC-------CC-CCCCCHHH
T ss_conf             212231774--8998577189987-------875--------78-----------7861898-------98-23234588


Q ss_pred             HHHCCCCCEEECCCCCCC
Q ss_conf             997588644604542251
Q gi|254780272|r  195 ACDWGVVDKVLMSRIDIE  212 (216)
Q Consensus       195 A~eyGliD~Ii~~~~e~~  212 (216)
                      ..+.|.||.|+.. .|+.
T Consensus       254 ~~~~G~iD~vv~r-~e~r  270 (285)
T 2f9i_B          254 LLEHGQLDKVVHR-NDMR  270 (285)
T ss_dssp             HHHTTCCSEECCG-GGHH
T ss_pred             HHHCCCCCEEECH-HHHH
T ss_conf             9966786768767-9999


No 79 
>2f9y_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4
Probab=76.19  E-value=4  Score=19.87  Aligned_cols=89  Identities=13%  Similarity=0.132  Sum_probs=53.0

Q ss_pred             ECCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHH----------HHHHHHCCCCEEEEEECCCCC-CC
Q ss_conf             8783189899999999999741157697699993687614678999----------999864487348998315566-52
Q gi|254780272|r   47 VTGQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAGMAI----------YDTMQFIKPPISTFCMGQAAS-MG  115 (216)
Q Consensus        47 l~g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~glaI----------yD~i~~i~~~V~Ti~~G~aaS-~a  115 (216)
                      ++|.+....+..+..-. -+ +....-|+-.+..|.|+.+..|..-          ...++....|+.+++.|-+++ .+
T Consensus       130 ~GGS~g~~~geKi~ra~-e~-A~~~~lPlI~l~~SgGaRm~eg~~sl~~~~~~~~~~~~~~~~~iP~I~v~~gp~~GG~~  207 (304)
T 2f9y_B          130 MGGSMGSVVGARFVRAV-EQ-ALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS  207 (304)
T ss_dssp             TTTCBCTHHHHHHHHHH-HH-HHHHTCCEEEEEEESSBCGGGTHHHHHHHHHHHHHHHHHHHTTCCEEEEEEEEEEHHHH
T ss_pred             HCCCCCHHHHHHHHHHH-HH-HHHCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHH
T ss_conf             22433244445633599-99-99729976998458880355555200024679999999981899779996689661341


Q ss_pred             CCCCCCCCCCCEEECCCHHHHHHH
Q ss_conf             000024677714554415664412
Q gi|254780272|r  116 SLLLSAGEKGMRFALPNARILLHQ  139 (216)
Q Consensus       116 slIl~aG~~g~R~~~pns~iMiHq  139 (216)
                      +...+.++  -..+-|+|.+.+--
T Consensus       208 as~a~~~d--~ii~~~~a~i~~aG  229 (304)
T 2f9y_B          208 ASFAMLGD--LNIAEPKALIGFAG  229 (304)
T ss_dssp             TTGGGCCS--EEEECTTCBEESSC
T ss_pred             HHHHHCCC--EEEEECCCCCCCCC
T ss_conf             26364774--89995540003658


No 80 
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae}
Probab=33.89  E-value=11  Score=17.20  Aligned_cols=102  Identities=17%  Similarity=0.155  Sum_probs=51.2

Q ss_pred             CHHHHHHCCCEEEECC-CCC-HHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEEECCC
Q ss_conf             2003451467799878-318-98999999999997411576976999936876146789999998644873489983155
Q gi|254780272|r   34 DIYSRLLKERIVFVTG-QIE-DHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQA  111 (216)
Q Consensus        34 Di~s~L~~~Riifl~g-~I~-~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~glaIyD~i~~i~~~V~Ti~~G~a  111 (216)
                      ++-+-|++-|.|-+-| .-+ ...++.+...|+-..    - +++.+--.+.+.-..|+..|..+..++.++..+.+-..
T Consensus         5 ~i~~~L~~pksIAVVGaS~~~~k~g~~v~~~L~~~g----~-~~~~v~p~~~~~~i~G~~~y~sl~~ip~~vDlvvi~~p   79 (145)
T 2duw_A            5 DIAGILTSTRTIALVGASDKPDRPSYRVMKYLLDQG----Y-HVIPVSPKVAGKTLLGQQGYATLADVPEKVDMVDVFRN   79 (145)
T ss_dssp             SHHHHHHHCCCEEEESCCSCTTSHHHHHHHHHHHHT----C-CEEEECSSSTTSEETTEECCSSTTTCSSCCSEEECCSC
T ss_pred             HHHHHHHCCCEEEEECCCCCCCCCHHHHHHHHHHCC----C-CEEEECCCCCCCCCCCEEEECCHHHCCCCCEEEEEECC
T ss_conf             999998678959998205999983999999999679----9-44887887544321881575246458998649999637


Q ss_pred             CC-------------CCCCCCCCC-----------CCCCEEECCCHHHHHHHH
Q ss_conf             66-------------520000246-----------777145544156644125
Q gi|254780272|r  112 AS-------------MGSLLLSAG-----------EKGMRFALPNARILLHQP  140 (216)
Q Consensus       112 aS-------------~aslIl~aG-----------~~g~R~~~pns~iMiHqp  140 (216)
                      +.             ...+.+++|           +.|.|++.|||..+.|+-
T Consensus        80 ~~~v~~~~~~~~~~g~k~v~~q~g~~~~~~~~~a~~~Gi~vigpnClgv~~p~  132 (145)
T 2duw_A           80 SEAAWGVAQEAIAIGAKTLWLQLGVINEQAAVLAREAGLSVVMDRCPAIELPR  132 (145)
T ss_dssp             STHHHHHHHHHHHHTCCEEECCTTCCCHHHHHHHHTTTCEEECSCCHHHHSTT
T ss_pred             HHHHHHHHHHHHHCCCCEEEECCCHHHHHHHHHHHHCCCEEECCCCCEEECCC
T ss_conf             32589999999974998787325166499999999959989959973647511


No 81 
>1fxw_F Alpha2, platelet-activating factor acetylhydrolase IB beta subunit; alpha beta hydrolase fold; 2.10A {Bos taurus} SCOP: c.23.10.3 PDB: 1vyh_A
Probab=28.82  E-value=27  Score=14.66  Aligned_cols=84  Identities=19%  Similarity=0.304  Sum_probs=43.9

Q ss_pred             CCEEEEECCCCCCCCCHHHHHH------CCCEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEE-CCCCCHHHHHH
Q ss_conf             7579766599840122003451------4677998783189899999999999741157697699993-68761467899
Q gi|254780272|r   19 VPMVVEQTNRGERSYDIYSRLL------KERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYIN-SPGGVVTAGMA   91 (216)
Q Consensus        19 ~p~~~e~~~~~~~~~Di~s~L~------~~Riifl~g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~IN-SpGG~v~~gla   91 (216)
                      .|.-.++.....+|.++.++.+      ..+++|+|+.|.+.....-    .|.+.- +...   ++| .-||+...++.
T Consensus        11 ~p~~~~~~~g~~~w~~~~~~~~~~~~~~~~~vv~iGDSit~~~~~~~----~~~~~~-~~~~---v~N~Gi~G~tt~~~l   82 (229)
T 1fxw_F           11 IPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYE----IWRELF-SPLH---ALNFGIGGDTTRHVL   82 (229)
T ss_dssp             SCCCCCCSSSSCHHHHHHHHHHHHHHHCCCSEEEEESHHHHGGGGSH----HHHHHT-GGGT---EEEEECTTCCHHHHH
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEEECHHHHCCCCCC----HHHHHC-CCCC---EEEEEECCCCHHHHH
T ss_conf             89886655764259999999999721289989999787881877645----199865-8889---798346700588899


Q ss_pred             H-HH--HHHHCCCCEEEEEECC
Q ss_conf             9-99--9864487348998315
Q gi|254780272|r   92 I-YD--TMQFIKPPISTFCMGQ  110 (216)
Q Consensus        92 I-yD--~i~~i~~~V~Ti~~G~  110 (216)
                      - ++  .+...++++.++.+|.
T Consensus        83 ~rl~~~~l~~~~pd~vii~~G~  104 (229)
T 1fxw_F           83 WRLKNGELENIKPKVIVVWVGT  104 (229)
T ss_dssp             HHHHTTTTSSCCCSEEEEECCT
T ss_pred             HHHHHHHHHCCCCCEEEEEEEE
T ss_conf             9976321102698989999778


No 82 
>1uxy_A MURB, uridine diphospho-N-acetylenolpyruvylglucosamine reductase; peptidoglycan synthesis, cell WALL, cell division, oxidoreductase, NADP; HET: FAD EPU; 1.80A {Escherichia coli} SCOP: d.145.1.2 d.146.1.1 PDB: 1mbb_A* 1mbt_A* 2q85_A* 2mbr_A*
Probab=28.20  E-value=18  Score=15.75  Aligned_cols=57  Identities=19%  Similarity=0.281  Sum_probs=36.9

Q ss_pred             CCCCCCCCCCCCCCCCE-----EECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHH
Q ss_conf             56652000024677714-----554415664412566665554128999999999999999999987199989
Q gi|254780272|r  111 AASMGSLLLSAGEKGMR-----FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYE  178 (216)
Q Consensus       111 aaS~aslIl~aG~~g~R-----~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a~~Tg~~~e  178 (216)
                      -.|+|-+|=.+|-||.|     ..-.||-|++..      |+++     ++++..+-+.+.+-..+++|..+|
T Consensus       260 k~~Ag~LIe~~GlKG~~iGga~vS~kHanfivN~------g~At-----a~Dv~~Li~~i~~~V~~~fGI~Le  321 (340)
T 1uxy_A          260 KLAAGWLIDQCQLKGMQIGGAAVHRQQALVLINE------DNAK-----SEDVVQLAHHVRQKVGEKFNVWLE  321 (340)
T ss_dssp             EECHHHHHHHTTCTTCEETTEEECSSCTTEEEEC------SSCC-----HHHHHHHHHHHHHHHHHHHSCCCC
T ss_pred             CHHHHHHHHHHCCCCCCCCCEEECCCCCCEEEEC------CCCC-----HHHHHHHHHHHHHHHHHHHCCCCE
T ss_conf             5259999998474897126969806788789989------9999-----999999999999999998898023


No 83 
>3lwz_A 3-dehydroquinate dehydratase; AROQ, IDP90771, amino- acid biosynthesis, aromatic amino acid biosynthesis, lyase, structural genomics; 1.65A {Yersinia pestis}
Probab=27.16  E-value=29  Score=14.43  Aligned_cols=37  Identities=11%  Similarity=0.244  Sum_probs=30.3

Q ss_pred             EEECCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCC
Q ss_conf             9936876146789999998644873489983155665
Q gi|254780272|r   78 YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASM  114 (216)
Q Consensus        78 ~INSpGG~v~~glaIyD~i~~i~~~V~Ti~~G~aaS~  114 (216)
                      .|=.|||......+|.|++..++.|+.-|-+...++=
T Consensus        77 iIiNPga~ThtS~al~DAl~~~~~p~iEVHlSNi~~R  113 (153)
T 3lwz_A           77 ILINPAAFTHTSVALRDALLGVQIPFIEIHLSNVHAR  113 (153)
T ss_dssp             EEEECGGGGGTCHHHHHHHHHHTCCEEEEESSCGGGS
T ss_pred             EEECCCCCEEEHHHHHHHHHHCCCCEEEEEECCCCCC
T ss_conf             9974764032037799999845999899995484124


No 84 
>3i99_A UDP-N-acetylenolpyruvoylglucosamine reductase; oxidoreductase, structural genomics, center for structural genomics of infectious diseases, csgid; HET: FAD; 2.20A {Vibrio cholerae}
Probab=25.55  E-value=21  Score=15.29  Aligned_cols=78  Identities=23%  Similarity=0.335  Sum_probs=44.2

Q ss_pred             HHHHHHHHHCCCCE--EEEEECCCCCCCCCCCCCCCCCCE-----EECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999986448734--899831556652000024677714-----55441566441256666555412899999999999
Q gi|254780272|r   90 MAIYDTMQFIKPPI--STFCMGQAASMGSLLLSAGEKGMR-----FALPNARILLHQPSGGFSGQASDIERHAQDIVKIK  162 (216)
Q Consensus        90 laIyD~i~~i~~~V--~Ti~~G~aaS~aslIl~aG~~g~R-----~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~  162 (216)
                      -.-++.++..-+++  .-.+.+.-.|+|-+|=.+|-||.|     ..-.|+-|++..      |+++     ++++..+-
T Consensus       251 ~~~~~~l~~~~p~~~~~~~~~~~k~~Ag~LIe~aGlKG~~iGga~vS~kHanfivN~------g~At-----a~Di~~Li  319 (357)
T 3i99_A          251 QQAFARLQIEHPDVVAYPAEQGVKVAAGWLIDQAGLKGHQIGGAKVHPKQALVIVNT------GDAS-----AQDVLMLA  319 (357)
T ss_dssp             HHHHHHHHHHCTTCCEECCSSSEEECHHHHHHHTTCTTCEETTEEECTTSTTEEEEC------SSCC-----HHHHHHHH
T ss_pred             HHHHHHHHHHCCCCCCEECCCCCCCHHHHHHHHHCCCCCCCCCEEECCCCCCEEEEC------CCCC-----HHHHHHHH
T ss_conf             788987665388774010257653169999998375887117979856688589989------9999-----99999999


Q ss_pred             HHHHHHHHHHCCCCHH
Q ss_conf             9999999987199989
Q gi|254780272|r  163 RRLNEIYVKNCGKTYE  178 (216)
Q Consensus       163 ~~l~~i~a~~Tg~~~e  178 (216)
                      +.+.+-..+++|..+|
T Consensus       320 ~~i~~~V~~~fgI~Le  335 (357)
T 3i99_A          320 ADIQQRVFNCYGIELE  335 (357)
T ss_dssp             HHHHHHHHHHHSCCCC
T ss_pred             HHHHHHHHHHHCCCCE
T ss_conf             9999999998798115


No 85 
>3kip_A 3-dehydroquinase, type II; lyase; 2.95A {Candida albicans}
Probab=21.52  E-value=37  Score=13.75  Aligned_cols=36  Identities=11%  Similarity=0.152  Sum_probs=29.7

Q ss_pred             EEECCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCC
Q ss_conf             993687614678999999864487348998315566
Q gi|254780272|r   78 YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAAS  113 (216)
Q Consensus        78 ~INSpGG~v~~glaIyD~i~~i~~~V~Ti~~G~aaS  113 (216)
                      .|.-|||......+|.|++..++.|+.-|=+.....
T Consensus        87 IIiNpga~THtSiai~DAL~~~~~P~iEVHlSNi~~  122 (167)
T 3kip_A           87 VVINAGAYTHTSVGIRDALLGTAIPFIEVHITNVHQ  122 (167)
T ss_dssp             EEEECGGGGGTCHHHHHHHHHTTCCEEEEESSCGGG
T ss_pred             EEECCCHHEEEHHHHHHHHHHCCCCEEEEEECCCCC
T ss_conf             983541011201116989985499889998178522


Done!