BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780272|ref|YP_003064685.1| ATP-dependent Clp protease
proteolytic subunit [Candidatus Liberibacter asiaticus str. psy62]
         (216 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780272|ref|YP_003064685.1| ATP-dependent Clp protease proteolytic subunit [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254039949|gb|ACT56745.1| ATP-dependent Clp protease proteolytic subunit [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 216

 Score =  450 bits (1157), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 216/216 (100%), Positives = 216/216 (100%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC
Sbjct: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS
Sbjct: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV
Sbjct: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           EKTLDRDHIMSASEACDWGVVDKVLMSRIDIEEKSK
Sbjct: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRIDIEEKSK 216


>gi|315122830|ref|YP_004063319.1| ATP-dependent Clp protease proteolytic subunit [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313496232|gb|ADR52831.1| ATP-dependent Clp protease proteolytic subunit [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 216

 Score =  377 bits (969), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 179/216 (82%), Positives = 196/216 (90%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           M FE  A++   D  LGLVPMVVEQTNRGERSYDIYSRLLKERIVF+TGQIEDHMA LIC
Sbjct: 1   MIFEEYAREGFNDTSLGLVPMVVEQTNRGERSYDIYSRLLKERIVFITGQIEDHMAALIC 60

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPP+ST C+GQAASMGSLLL+
Sbjct: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPVSTLCIGQAASMGSLLLA 120

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG+KGMRFALPNARI+LHQPSGGFSGQASDIERHA+DI+KIK RLN IYVK+CG+ YEEV
Sbjct: 121 AGKKGMRFALPNARIMLHQPSGGFSGQASDIERHARDIIKIKHRLNNIYVKHCGRVYEEV 180

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           E+TLDRD  MSA +A  WG++DKVLMSR+DIEE  K
Sbjct: 181 EQTLDRDCFMSAEDAHAWGLIDKVLMSRVDIEEGGK 216


>gi|222085564|ref|YP_002544094.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Agrobacterium
           radiobacter K84]
 gi|221723012|gb|ACM26168.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Agrobacterium
           radiobacter K84]
          Length = 210

 Score =  357 bits (915), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 188/204 (92%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           ++  D  + LVPMVVEQTNRGERSYDIYSRLLKERI+F+TG +EDHMATL+CAQLLFLEA
Sbjct: 2   RNPVDTAMALVPMVVEQTNRGERSYDIYSRLLKERIIFLTGPVEDHMATLVCAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEI+LYINSPGGVVTAGMAIYDTMQFIKP IST C+GQAASMGSLLL+AG+K MRF
Sbjct: 62  ENPKKEIALYINSPGGVVTAGMAIYDTMQFIKPAISTLCIGQAASMGSLLLAAGDKDMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           A PN+RI++HQPSGGF GQASDIERHA+DI+K+KRRLNEIYVK+CG+TYEEVE+TLDRDH
Sbjct: 122 ATPNSRIMVHQPSGGFQGQASDIERHARDIIKMKRRLNEIYVKHCGRTYEEVEQTLDRDH 181

Query: 189 IMSASEACDWGVVDKVLMSRIDIE 212
            MS+ EA DWG++DKVL SR ++E
Sbjct: 182 FMSSDEAKDWGLIDKVLTSRTEME 205


>gi|241204073|ref|YP_002975169.1| ATP-dependent Clp protease proteolytic subunit [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240857963|gb|ACS55630.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 209

 Score =  353 bits (906), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 185/204 (90%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           ++  D  + LVPMVVEQTNRGERSYDIYSRLLKERI+F+TG +EDHMATL+CAQLLFLEA
Sbjct: 2   RNPVDTAMALVPMVVEQTNRGERSYDIYSRLLKERIIFLTGTVEDHMATLVCAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEI+LYINSPGGVVTAGMAIYDTMQFIKP +ST C+GQAASMGSLLL+AG K MRF
Sbjct: 62  ENPKKEIALYINSPGGVVTAGMAIYDTMQFIKPAVSTLCIGQAASMGSLLLAAGHKDMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           A PN+RI++HQPSGGF GQASDIERHA+DI+K+KRRLNE+YVK+ G+TYEEVEKTLDRDH
Sbjct: 122 ATPNSRIMVHQPSGGFQGQASDIERHARDILKMKRRLNEVYVKHTGRTYEEVEKTLDRDH 181

Query: 189 IMSASEACDWGVVDKVLMSRIDIE 212
            M A EA  WGV+DKVL SR+++E
Sbjct: 182 FMDADEAQSWGVIDKVLTSRLEME 205


>gi|161501794|ref|YP_767292.2| ATP-dependent Clp protease proteolytic subunit [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 209

 Score =  353 bits (905), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 185/204 (90%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           ++  D  + LVPMVVEQTNRGERSYDIYSRLLKERI+F+TG +EDHMATL+CAQLLFLEA
Sbjct: 2   RNPVDTAMALVPMVVEQTNRGERSYDIYSRLLKERIIFLTGAVEDHMATLVCAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEI+LYINSPGGVVTAGMAIYDTMQFIKP +ST C+GQAASMGSLLL+AG K MRF
Sbjct: 62  ENPKKEIALYINSPGGVVTAGMAIYDTMQFIKPAVSTLCIGQAASMGSLLLAAGHKDMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           A PN+RI++HQPSGGF GQASDIERHA+DI+K+KRRLNE+YVK+ G+TYEEVEKTLDRDH
Sbjct: 122 ATPNSRIMVHQPSGGFQGQASDIERHARDILKMKRRLNEVYVKHTGRTYEEVEKTLDRDH 181

Query: 189 IMSASEACDWGVVDKVLMSRIDIE 212
            M A EA  WGV+DKVL SR+++E
Sbjct: 182 FMDADEAQSWGVIDKVLTSRLEME 205


>gi|15965008|ref|NP_385361.1| ATP-dependent Clp protease proteolytic subunit [Sinorhizobium
           meliloti 1021]
 gi|307301080|ref|ZP_07580849.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Sinorhizobium
           meliloti BL225C]
 gi|307317814|ref|ZP_07597252.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Sinorhizobium
           meliloti AK83]
 gi|18202306|sp|P58278|CLPP2_RHIME RecName: Full=ATP-dependent Clp protease proteolytic subunit 2;
           AltName: Full=Endopeptidase Clp 2
 gi|15074187|emb|CAC45834.1| Probable ATP-dependent CLP protease proteolytic subunit
           [Sinorhizobium meliloti 1021]
 gi|306896576|gb|EFN27324.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Sinorhizobium
           meliloti AK83]
 gi|306904035|gb|EFN34621.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Sinorhizobium
           meliloti BL225C]
          Length = 208

 Score =  353 bits (905), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 159/204 (77%), Positives = 186/204 (91%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           ++  D  + LVPMVVEQTNRGERSYDIYSRLLKERI+F+TG +EDHMATL+CAQLLFLEA
Sbjct: 2   RNPVDTAMALVPMVVEQTNRGERSYDIYSRLLKERIIFLTGPVEDHMATLVCAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KE++LYINSPGGVVTAGMAIYDTMQFIKP +ST C+GQAASMGSLLL+AG K MRF
Sbjct: 62  ENPKKEVALYINSPGGVVTAGMAIYDTMQFIKPAVSTLCIGQAASMGSLLLAAGHKDMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           A PN+RI++HQPSGGF GQASDIERHA+DI+K+KRRLNE+YVK+CG+TYEEVE+TLDRDH
Sbjct: 122 ATPNSRIMVHQPSGGFQGQASDIERHARDILKMKRRLNEVYVKHCGRTYEEVEQTLDRDH 181

Query: 189 IMSASEACDWGVVDKVLMSRIDIE 212
            MSA EA DWG++DKV+ SR  +E
Sbjct: 182 FMSADEALDWGLIDKVITSRDAVE 205


>gi|227821606|ref|YP_002825576.1| ATP-dependent Clp protease proteolytic subunit [Sinorhizobium
           fredii NGR234]
 gi|227340605|gb|ACP24823.1| ATP-dependent Clp protease proteolytic subunit [Sinorhizobium
           fredii NGR234]
          Length = 210

 Score =  352 bits (904), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 186/204 (91%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           ++  D  + LVPMVVEQTNRGERSYDIYSRLLKERI+F+TG +EDHMATL+CAQLLFLEA
Sbjct: 2   RNPVDTAMALVPMVVEQTNRGERSYDIYSRLLKERIIFLTGPVEDHMATLVCAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEI+LYINSPGGVVTAGMAIYDTMQFIKP +ST C+GQAASMGSLLL+AG K MRF
Sbjct: 62  ENPKKEIALYINSPGGVVTAGMAIYDTMQFIKPAVSTLCIGQAASMGSLLLAAGHKDMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           A PNARI++HQPSGGF GQASDIERHA+DI+K+KRRLNE+YV++CG+TYEEVE+TLDRDH
Sbjct: 122 ATPNARIMVHQPSGGFQGQASDIERHARDILKMKRRLNEVYVRHCGRTYEEVEQTLDRDH 181

Query: 189 IMSASEACDWGVVDKVLMSRIDIE 212
            MS+ EA DWG++DKV+ SR  IE
Sbjct: 182 FMSSDEALDWGLIDKVITSREAIE 205


>gi|150396095|ref|YP_001326562.1| ATP-dependent Clp protease proteolytic subunit [Sinorhizobium
           medicae WSM419]
 gi|150027610|gb|ABR59727.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Sinorhizobium
           medicae WSM419]
          Length = 208

 Score =  352 bits (904), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 159/204 (77%), Positives = 186/204 (91%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           ++  D  + LVPMVVEQTNRGERSYDIYSRLLKERI+F+TG +EDHMATL+CAQLLFLEA
Sbjct: 2   RNPVDTAMALVPMVVEQTNRGERSYDIYSRLLKERIIFLTGPVEDHMATLVCAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEI+LYINSPGGVVTAGMAIYDTMQFIKP +ST C+GQAASMGSLLL+AG K MRF
Sbjct: 62  ENPKKEIALYINSPGGVVTAGMAIYDTMQFIKPAVSTLCIGQAASMGSLLLAAGHKDMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           A PN+RI++HQPSGGF GQASDIERHA+DI+K+KRRLNE+YVK+CG+TYEEVE+TLDRDH
Sbjct: 122 ATPNSRIMVHQPSGGFQGQASDIERHARDILKMKRRLNEVYVKHCGRTYEEVEQTLDRDH 181

Query: 189 IMSASEACDWGVVDKVLMSRIDIE 212
            MS+ EA DWG++DKV+ SR  +E
Sbjct: 182 FMSSDEALDWGLIDKVITSRDAVE 205


>gi|86357224|ref|YP_469116.1| ATP-dependent Clp protease proteolytic subunit [Rhizobium etli CFN
           42]
 gi|190891272|ref|YP_001977814.1| endopeptidase Clp protein, subunit 2 [Rhizobium etli CIAT 652]
 gi|209548850|ref|YP_002280767.1| ATP-dependent Clp protease proteolytic subunit [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|116243117|sp|Q2K9U7|CLPP2_RHIEC RecName: Full=ATP-dependent Clp protease proteolytic subunit 2;
           AltName: Full=Endopeptidase Clp 2
 gi|86281326|gb|ABC90389.1| endopeptidase Clp, subunit 2 protein [Rhizobium etli CFN 42]
 gi|190696551|gb|ACE90636.1| endopeptidase Clp protein, subunit 2 [Rhizobium etli CIAT 652]
 gi|209534606|gb|ACI54541.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|327188463|gb|EGE55677.1| ATP-dependent Clp protease proteolytic subunit [Rhizobium etli
           CNPAF512]
          Length = 209

 Score =  352 bits (903), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 185/204 (90%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           ++  D  + LVPMVVEQTNRGERSYDIYSRLLKERI+F+TG +EDHMATL+CAQLLFLEA
Sbjct: 2   RNPVDTAMALVPMVVEQTNRGERSYDIYSRLLKERIIFLTGAVEDHMATLVCAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEI+LYINSPGGVVTAGMAIYDTMQFIKP +ST C+GQAASMGSLLL+AG K MRF
Sbjct: 62  ENPKKEIALYINSPGGVVTAGMAIYDTMQFIKPAVSTLCIGQAASMGSLLLAAGHKDMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           A PN+RI++HQPSGGF GQASDIERHA+DI+K+KRRLNE+YVK+ G+TYEEVEKTLDRDH
Sbjct: 122 ATPNSRIMVHQPSGGFQGQASDIERHARDILKMKRRLNEVYVKHTGRTYEEVEKTLDRDH 181

Query: 189 IMSASEACDWGVVDKVLMSRIDIE 212
            M A EA  WGV+DKVL SR+++E
Sbjct: 182 FMDADEAQGWGVIDKVLTSRLEME 205


>gi|116243118|sp|Q1MIM7|CLPP2_RHIL3 RecName: Full=ATP-dependent Clp protease proteolytic subunit 2;
           AltName: Full=Endopeptidase Clp 2
 gi|115256102|emb|CAK07183.1| putative ATP-dependent Clp protease proteolytic subunit [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 201

 Score =  351 bits (900), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 159/197 (80%), Positives = 182/197 (92%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQTNRGERSYDIYSRLLKERI+F+TG +EDHMATL+CAQLLFLEAENP+KEI
Sbjct: 1   MALVPMVVEQTNRGERSYDIYSRLLKERIIFLTGAVEDHMATLVCAQLLFLEAENPKKEI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           +LYINSPGGVVTAGMAIYDTMQFIKP +ST C+GQAASMGSLLL+AG K MRFA PN+RI
Sbjct: 61  ALYINSPGGVVTAGMAIYDTMQFIKPAVSTLCIGQAASMGSLLLAAGHKDMRFATPNSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGGF GQASDIERHA+DI+K+KRRLNE+YVK+ G+TYEEVEKTLDRDH M A EA
Sbjct: 121 MVHQPSGGFQGQASDIERHARDILKMKRRLNEVYVKHTGRTYEEVEKTLDRDHFMDADEA 180

Query: 196 CDWGVVDKVLMSRIDIE 212
             WGV+DKVL SR+++E
Sbjct: 181 QSWGVIDKVLTSRLEME 197


>gi|218514228|ref|ZP_03511068.1| ATP-dependent Clp protease proteolytic subunit [Rhizobium etli
           8C-3]
          Length = 201

 Score =  350 bits (898), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 159/197 (80%), Positives = 182/197 (92%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQTNRGERSYDIYSRLLKERI+F+TG +EDHMATL+CAQLLFLEAENP+KEI
Sbjct: 1   MALVPMVVEQTNRGERSYDIYSRLLKERIIFLTGAVEDHMATLVCAQLLFLEAENPKKEI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           +LYINSPGGVVTAGMAIYDTMQFIKP +ST C+GQAASMGSLLL+AG K MRFA PN+RI
Sbjct: 61  ALYINSPGGVVTAGMAIYDTMQFIKPAVSTLCIGQAASMGSLLLAAGHKDMRFATPNSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGGF GQASDIERHA+DI+K+KRRLNE+YVK+ G+TYEEVEKTLDRDH M A EA
Sbjct: 121 MVHQPSGGFQGQASDIERHARDILKMKRRLNEVYVKHTGRTYEEVEKTLDRDHFMDADEA 180

Query: 196 CDWGVVDKVLMSRIDIE 212
             WGV+DKVL SR+++E
Sbjct: 181 QGWGVIDKVLTSRLEME 197


>gi|218672748|ref|ZP_03522417.1| ATP-dependent Clp protease proteolytic subunit [Rhizobium etli
           GR56]
          Length = 203

 Score =  350 bits (898), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 159/197 (80%), Positives = 182/197 (92%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQTNRGERSYDIYSRLLKERI+F+TG +EDHMATL+CAQLLFLEAENP+KEI
Sbjct: 1   MALVPMVVEQTNRGERSYDIYSRLLKERIIFLTGAVEDHMATLVCAQLLFLEAENPKKEI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           +LYINSPGGVVTAGMAIYDTMQFIKP +ST C+GQAASMGSLLL+AG K MRFA PN+RI
Sbjct: 61  ALYINSPGGVVTAGMAIYDTMQFIKPAVSTLCIGQAASMGSLLLAAGHKDMRFATPNSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGGF GQASDIERHA+DI+K+KRRLNE+YVK+ G+TYEEVEKTLDRDH M A EA
Sbjct: 121 MVHQPSGGFQGQASDIERHARDILKMKRRLNEVYVKHTGRTYEEVEKTLDRDHFMDADEA 180

Query: 196 CDWGVVDKVLMSRIDIE 212
             WGV+DKVL SR+++E
Sbjct: 181 QGWGVIDKVLTSRLEME 197


>gi|325292625|ref|YP_004278489.1| ATP-dependent Clp protease, proteolytic subunit [Agrobacterium sp.
           H13-3]
 gi|325060478|gb|ADY64169.1| ATP-dependent Clp protease, proteolytic subunit [Agrobacterium sp.
           H13-3]
          Length = 210

 Score =  350 bits (897), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 159/204 (77%), Positives = 185/204 (90%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           K+  D  + LVPMVVEQTNRGERSYDI+SRLLKERI+F+TG +ED MA+L+CAQLLFLEA
Sbjct: 2   KNPVDTAMALVPMVVEQTNRGERSYDIFSRLLKERIIFLTGPVEDQMASLVCAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEI+LYINSPGGVVTAGMAIYDTMQFI+P +ST C+GQAASMGSLLL+AGEKGMRF
Sbjct: 62  ENPKKEIALYINSPGGVVTAGMAIYDTMQFIRPAVSTLCVGQAASMGSLLLAAGEKGMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           A PNARI++HQPSGGF GQASDIERHA+DI+K+KRRLNE+YVK+ G+T EEVEKTLDRDH
Sbjct: 122 ATPNARIMVHQPSGGFQGQASDIERHARDIIKMKRRLNEVYVKHTGRTLEEVEKTLDRDH 181

Query: 189 IMSASEACDWGVVDKVLMSRIDIE 212
            M A EA DWGV+DK+L SR ++E
Sbjct: 182 FMDADEAKDWGVIDKILTSRQEME 205


>gi|15888588|ref|NP_354269.1| ATP-dependent Clp protease proteolytic subunit [Agrobacterium
           tumefaciens str. C58]
 gi|21759066|sp|Q8UFY6|CLPP2_AGRT5 RecName: Full=ATP-dependent Clp protease proteolytic subunit 2;
           AltName: Full=Endopeptidase Clp 2
 gi|15156306|gb|AAK87054.1| ATP-dependent Clp protease, proteolytic subunit [Agrobacterium
           tumefaciens str. C58]
          Length = 210

 Score =  350 bits (897), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 159/204 (77%), Positives = 185/204 (90%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           K+  D  + LVPMVVEQTNRGERSYDI+SRLLKERI+F+TG +ED MA+L+CAQLLFLEA
Sbjct: 2   KNPVDTAMALVPMVVEQTNRGERSYDIFSRLLKERIIFLTGPVEDQMASLVCAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEI+LYINSPGGVVTAGMAIYDTMQFI+P +ST C+GQAASMGSLLL+AGEKGMRF
Sbjct: 62  ENPKKEIALYINSPGGVVTAGMAIYDTMQFIRPAVSTLCVGQAASMGSLLLAAGEKGMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           A PNARI++HQPSGGF GQASDIERHA+DI+K+KRRLNE+YVK+ G+T EEVEKTLDRDH
Sbjct: 122 ATPNARIMVHQPSGGFQGQASDIERHARDIIKMKRRLNEVYVKHTGRTLEEVEKTLDRDH 181

Query: 189 IMSASEACDWGVVDKVLMSRIDIE 212
            M A EA DWGV+DK+L SR ++E
Sbjct: 182 FMDADEAKDWGVIDKILTSRQEME 205


>gi|222148264|ref|YP_002549221.1| ATP-dependent Clp protease proteolytic subunit [Agrobacterium vitis
           S4]
 gi|221735252|gb|ACM36215.1| ATP-dependent Clp protease proteolytic subunit ClpP [Agrobacterium
           vitis S4]
          Length = 210

 Score =  348 bits (894), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 186/204 (91%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           ++  D  + LVPMVVEQTNRGERSYDIYSRLLKERI+F+TG +EDHMA+L+CAQLLFLEA
Sbjct: 2   RNPVDTAMALVPMVVEQTNRGERSYDIYSRLLKERIIFLTGPVEDHMASLVCAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEI++YINSPGGVVTAGMAIYDTMQFI+P +ST C+GQAASMGSLLL+AGEKGMRF
Sbjct: 62  ENPKKEIAIYINSPGGVVTAGMAIYDTMQFIRPAVSTLCVGQAASMGSLLLAAGEKGMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           A PNARI++HQPSGGF GQASDIERHA+DI+K+KRRLNE+YVK+ G+T EEVE TLDRDH
Sbjct: 122 ATPNARIMVHQPSGGFQGQASDIERHARDIIKMKRRLNEVYVKHTGRTLEEVEHTLDRDH 181

Query: 189 IMSASEACDWGVVDKVLMSRIDIE 212
            M ++EA DWG++DK+L +R +IE
Sbjct: 182 FMESTEAKDWGLIDKILTTRSEIE 205


>gi|163759316|ref|ZP_02166402.1| ATP-dependent Clp protease proteolytic subunit [Hoeflea
           phototrophica DFL-43]
 gi|162283720|gb|EDQ34005.1| ATP-dependent Clp protease proteolytic subunit [Hoeflea
           phototrophica DFL-43]
          Length = 210

 Score =  344 bits (882), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 157/200 (78%), Positives = 181/200 (90%)

Query: 13  DVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQ 72
           D  + LVPMVVEQTNRGERSYDI+SRLLKERI+F+TG +EDHMATL+CAQLLFLEAENP+
Sbjct: 6   DTAMALVPMVVEQTNRGERSYDIFSRLLKERIIFITGPVEDHMATLVCAQLLFLEAENPK 65

Query: 73  KEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPN 132
           KEI+LYINSPGGVVTAGMAIYDTMQFIKP IST C+GQAASMGSLLL AGEKGMRFA PN
Sbjct: 66  KEIALYINSPGGVVTAGMAIYDTMQFIKPAISTLCVGQAASMGSLLLCAGEKGMRFATPN 125

Query: 133 ARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSA 192
           AR+++HQPSGGF GQASDIERHAQDI+K+KRRLNE+YVK+ G+ YE VEKTLDRDH M+A
Sbjct: 126 ARVMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEVYVKHTGQDYETVEKTLDRDHFMTA 185

Query: 193 SEACDWGVVDKVLMSRIDIE 212
            EA ++G++D+V   R +IE
Sbjct: 186 EEALEFGLIDRVFDKRENIE 205


>gi|260460897|ref|ZP_05809147.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Mesorhizobium
           opportunistum WSM2075]
 gi|259033474|gb|EEW34735.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Mesorhizobium
           opportunistum WSM2075]
          Length = 209

 Score =  342 bits (878), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 183/200 (91%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           K+  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+F+TG +ED MATL+CAQLLFLEA
Sbjct: 2   KNPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFITGPVEDGMATLVCAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEI+LYINSPGGVVT+GMAIYDTMQFIKP +ST C+GQAASMGSLLL+AG K MRF
Sbjct: 62  ENPKKEINLYINSPGGVVTSGMAIYDTMQFIKPAVSTLCIGQAASMGSLLLTAGHKDMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           A PNARI++HQPSGGF GQASDIERHAQDI+K+KRRLNE+YVK+ GK+YEE+EKTLDRDH
Sbjct: 122 ATPNARIMVHQPSGGFQGQASDIERHAQDIIKLKRRLNEVYVKHTGKSYEEIEKTLDRDH 181

Query: 189 IMSASEACDWGVVDKVLMSR 208
            M+A EA D+G++DKV+ SR
Sbjct: 182 FMTADEARDFGLIDKVISSR 201


>gi|13476994|ref|NP_108564.1| ATP-dependent Clp protease proteolytic subunit [Mesorhizobium loti
           MAFF303099]
 gi|18202642|sp|Q982V6|CLPP2_RHILO RecName: Full=ATP-dependent Clp protease proteolytic subunit 2;
           AltName: Full=Endopeptidase Clp 2
 gi|14027757|dbj|BAB54350.1| ATP-dependent Clp proteinase [Mesorhizobium loti MAFF303099]
          Length = 209

 Score =  340 bits (871), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 153/200 (76%), Positives = 182/200 (91%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           K+  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+F+TG +ED MATL+CAQLLFLEA
Sbjct: 2   KNPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFITGPVEDGMATLVCAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEI+LYINSPGGVVT+GMAIYDTMQFIKP +ST C+GQAASMGSLLL+AG K MRF
Sbjct: 62  ENPKKEINLYINSPGGVVTSGMAIYDTMQFIKPAVSTLCIGQAASMGSLLLTAGHKDMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           A PNARI++HQPSGGF GQASDIERHA DIVK+KRRLNE+YVK+ GK+YEE+E+TLDRDH
Sbjct: 122 ATPNARIMVHQPSGGFQGQASDIERHAMDIVKLKRRLNEVYVKHTGKSYEEIERTLDRDH 181

Query: 189 IMSASEACDWGVVDKVLMSR 208
            M+A EA D+G++DKV+ SR
Sbjct: 182 FMTADEAKDFGLIDKVISSR 201


>gi|319784104|ref|YP_004143580.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317169992|gb|ADV13530.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 209

 Score =  340 bits (871), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 153/200 (76%), Positives = 182/200 (91%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           K+  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+F+TG +ED MATL+CAQLLFLEA
Sbjct: 2   KNPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFITGPVEDGMATLVCAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEI+LYINSPGGVVT+GMAIYDTMQFIKP +ST C+GQAASMGSLLL+AG K MRF
Sbjct: 62  ENPKKEINLYINSPGGVVTSGMAIYDTMQFIKPAVSTLCIGQAASMGSLLLTAGHKDMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           A PNARI++HQPSGGF GQASDIERHA DI+K+KRRLNE+YVK+ GK+YEE+EKTLDRDH
Sbjct: 122 ATPNARIMVHQPSGGFQGQASDIERHALDIIKLKRRLNEVYVKHTGKSYEEIEKTLDRDH 181

Query: 189 IMSASEACDWGVVDKVLMSR 208
            M+A EA D+G++DKV+ SR
Sbjct: 182 FMTADEAKDFGLIDKVISSR 201


>gi|49474139|ref|YP_032181.1| ATP-dependent Clp protease proteolytic subunit [Bartonella quintana
           str. Toulouse]
 gi|67460275|sp|Q6G178|CLPP_BARQU RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|49239643|emb|CAF26003.1| ATP-dependent clp protease proteolytic subunit [Bartonella quintana
           str. Toulouse]
          Length = 210

 Score =  331 bits (849), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 150/201 (74%), Positives = 178/201 (88%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           L LVPMV+EQTNRGER+YDI+SRLLKERI+F+ G +ED MA L+CAQLLFLEAENP+KEI
Sbjct: 9   LSLVPMVIEQTNRGERAYDIFSRLLKERIIFINGPVEDSMAMLVCAQLLFLEAENPKKEI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGGVVT+GMAIYDTMQFI+PP+ST CMGQAASMGSLLL+AG KG RF LPNARI
Sbjct: 69  SLYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGAKGHRFTLPNARI 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGGF GQASDIERHAQDI+K+KRRLNEIYV++ G+ YE +E+TLDRDH M+A EA
Sbjct: 129 MVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVQHTGQDYEVIERTLDRDHFMTAEEA 188

Query: 196 CDWGVVDKVLMSRIDIEEKSK 216
             +G+VD V+  R + E++ K
Sbjct: 189 KQFGLVDDVIQYRAETEKEEK 209


>gi|153009536|ref|YP_001370751.1| ATP-dependent Clp protease proteolytic subunit [Ochrobactrum
           anthropi ATCC 49188]
 gi|151561424|gb|ABS14922.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Ochrobactrum
           anthropi ATCC 49188]
          Length = 230

 Score =  331 bits (849), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 148/200 (74%), Positives = 179/200 (89%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D  +  + LVPMVVEQTNRGER+YDI+SRLLKERI+FV G +ED M+ L+CAQLLFLEA
Sbjct: 23  RDPIETVMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVNGPVEDGMSMLVCAQLLFLEA 82

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEI++YINSPGGVVT+GMAIYDTMQFI+PP+ST CMGQAASMGSLLL+AG  G R+
Sbjct: 83  ENPKKEINMYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGATGQRY 142

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           ALPNARI++HQPSGGF GQASDIERHAQDI+K+KRRLNEIYVK+ G+ YE +E+TLDRDH
Sbjct: 143 ALPNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVKHTGRDYETIERTLDRDH 202

Query: 189 IMSASEACDWGVVDKVLMSR 208
            M+A EA ++G++DKV+ SR
Sbjct: 203 FMTAQEALEFGLIDKVVESR 222


>gi|90419399|ref|ZP_01227309.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90336336|gb|EAS50077.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 210

 Score =  331 bits (849), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 151/197 (76%), Positives = 178/197 (90%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQTNRGER+YDI+SRLLKER++F+TG IED MATL+CAQLLFLEAENP+KEI
Sbjct: 9   MNLVPMVVEQTNRGERAYDIFSRLLKERVIFITGPIEDSMATLVCAQLLFLEAENPKKEI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           +LYINSPGGVVT+GMAIYDTMQFIKP +ST C+GQAASMGSLLL AG K MRFA PNARI
Sbjct: 69  ALYINSPGGVVTSGMAIYDTMQFIKPAVSTLCIGQAASMGSLLLCAGHKDMRFATPNARI 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGGFSGQASDIERHAQDI+K+KRRLNE+YV++ G+ YE VE+TLDRDH M+A EA
Sbjct: 129 MVHQPSGGFSGQASDIERHAQDIIKLKRRLNEVYVEHTGQDYETVERTLDRDHFMTAQEA 188

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G++DKV  SR  +E
Sbjct: 189 REFGLIDKVYSSRDALE 205


>gi|163868071|ref|YP_001609275.1| ATP-dependent Clp protease proteolytic subunit [Bartonella
           tribocorum CIP 105476]
 gi|189082448|sp|A9ISA4|CLPP_BART1 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|161017722|emb|CAK01280.1| ATP-dependent Clp protease, proteolytic subunit [Bartonella
           tribocorum CIP 105476]
          Length = 210

 Score =  331 bits (848), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 180/207 (86%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           D     L LVPMV+EQTNRGER+YDI+SRLLKERI+F+ G +ED MA L+CAQLLFLEAE
Sbjct: 3   DPMKTALSLVPMVIEQTNRGERAYDIFSRLLKERIIFINGPVEDGMAMLVCAQLLFLEAE 62

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP+KEISLYINSPGGVVT+GMAIYDTMQFI+PP+ST CMGQAASMGSLLL+AG KG RFA
Sbjct: 63  NPKKEISLYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGAKGHRFA 122

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPNARI++HQPSGGF GQASDIERHAQDI+K+KRRLNEIYV++ G+ YE +E+TLDRDH 
Sbjct: 123 LPNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVQHTGQGYEVIERTLDRDHF 182

Query: 190 MSASEACDWGVVDKVLMSRIDIEEKSK 216
           M+A EA  +G+VD V+  R + E++ K
Sbjct: 183 MTAEEAKAFGLVDDVIHYRAETEKEEK 209


>gi|239831859|ref|ZP_04680188.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Ochrobactrum
           intermedium LMG 3301]
 gi|239824126|gb|EEQ95694.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Ochrobactrum
           intermedium LMG 3301]
          Length = 230

 Score =  330 bits (847), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 147/200 (73%), Positives = 179/200 (89%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D  +  + LVPMVVEQTNRGER+YDI+SRLLKERI+FV G +ED M+ L+CAQLLFLEA
Sbjct: 23  RDPIETVMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVNGPVEDGMSMLVCAQLLFLEA 82

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEI++YINSPGGVVT+GMAIYDTMQFI+PP+ST CMGQAASMGSLLL+AG  G R+
Sbjct: 83  ENPKKEINMYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGATGQRY 142

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           ALPNARI++HQPSGGF GQASDIERHAQDI+K+KRRLNEIYVK+ G+ YE +E+TLDRDH
Sbjct: 143 ALPNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVKHTGRDYETIERTLDRDH 202

Query: 189 IMSASEACDWGVVDKVLMSR 208
            M+A EA ++G++DKV+ +R
Sbjct: 203 FMTAQEALEFGLIDKVVEAR 222


>gi|114707244|ref|ZP_01440142.1| ATP-dependent Clp protease proteolytic subunit [Fulvimarina pelagi
           HTCC2506]
 gi|114537440|gb|EAU40566.1| ATP-dependent Clp protease proteolytic subunit [Fulvimarina pelagi
           HTCC2506]
          Length = 217

 Score =  330 bits (847), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 178/197 (90%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQTNRGER+YDI+SRLLKER++F+TG IED MATL+CAQLLFLEAENP+KEI
Sbjct: 9   MNLVPMVVEQTNRGERAYDIFSRLLKERVIFITGPIEDSMATLVCAQLLFLEAENPKKEI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           +LYINSPGGVVT+GMAIYDTMQFI+P ++T C+GQAASMGSLLL AGEK MRFA PNARI
Sbjct: 69  ALYINSPGGVVTSGMAIYDTMQFIRPAVTTLCIGQAASMGSLLLCAGEKDMRFATPNARI 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGGF GQASDIERHAQDI+K+KRRLNE YVK+ G+ YE +E+TLDRDH M+A E+
Sbjct: 129 MVHQPSGGFQGQASDIERHAQDIIKLKRRLNETYVKHTGQDYETIERTLDRDHFMTAEES 188

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G++DKV  SR++ E
Sbjct: 189 LEFGLIDKVYSSRVEQE 205


>gi|240850274|ref|YP_002971667.1| ATP-dependent Clp protease proteolytic subunit ClpP [Bartonella
           grahamii as4aup]
 gi|240267397|gb|ACS50985.1| ATP-dependent Clp protease proteolytic subunit ClpP [Bartonella
           grahamii as4aup]
          Length = 210

 Score =  329 bits (844), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 150/201 (74%), Positives = 178/201 (88%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           L LVPMV+EQTNRGER+YDI+SRLLKERI+F+ G +ED MA L+CAQLLFLEAENP+KEI
Sbjct: 9   LSLVPMVIEQTNRGERAYDIFSRLLKERIIFINGPVEDGMAMLVCAQLLFLEAENPKKEI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGGVVT+GMAIYDTMQFI+PP+ST CMGQAASMGSLLL+AG KG RF LPNARI
Sbjct: 69  SLYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGAKGHRFTLPNARI 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGGF GQASDIERHAQDI+K+KRRLNEIYV++ G+ YE +E+TLDRDH M+A EA
Sbjct: 129 MVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVQHTGQDYEIIERTLDRDHFMTAEEA 188

Query: 196 CDWGVVDKVLMSRIDIEEKSK 216
             +G+VD V+  R + E++ K
Sbjct: 189 KAFGLVDDVIQYRAETEKEEK 209


>gi|110633522|ref|YP_673730.1| ATP-dependent Clp protease proteolytic subunit [Mesorhizobium sp.
           BNC1]
 gi|116243101|sp|Q11J60|CLPP1_MESSB RecName: Full=ATP-dependent Clp protease proteolytic subunit 1;
           AltName: Full=Endopeptidase Clp 1
 gi|110284506|gb|ABG62565.1| ATP-dependent Clp protease proteolytic subunit ClpP [Chelativorans
           sp. BNC1]
          Length = 210

 Score =  329 bits (844), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 150/204 (73%), Positives = 180/204 (88%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           K+  +  + LVPMVVEQTNRGER+YDI+SRLLKERI+F+TG +ED MATL+CAQLLFLEA
Sbjct: 2   KNPVETAMNLVPMVVEQTNRGERAYDIFSRLLKERIIFITGPVEDGMATLVCAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEI+LYINSPGGVVT+GMAIYDTMQFI+PP+ST C+GQAASMGSLLL AG K MRF
Sbjct: 62  ENPKKEIALYINSPGGVVTSGMAIYDTMQFIQPPVSTLCIGQAASMGSLLLCAGHKDMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           A PNAR+++HQPSGGF GQASDIERHAQDI+K+KRRLNEIYVK+ G+ Y+ +E+TLDRDH
Sbjct: 122 ATPNARVMVHQPSGGFQGQASDIERHAQDIIKLKRRLNEIYVKHTGQDYDTIERTLDRDH 181

Query: 189 IMSASEACDWGVVDKVLMSRIDIE 212
            M+A EA  +G+VD+V+  R  IE
Sbjct: 182 FMTADEAQAFGLVDRVISEREAIE 205


>gi|62290024|ref|YP_221817.1| ATP-dependent Clp protease proteolytic subunit [Brucella abortus
           bv. 1 str. 9-941]
 gi|82699951|ref|YP_414525.1| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           biovar Abortus 2308]
 gi|161619061|ref|YP_001592948.1| ATP-dependent Clp protease proteolytic subunit [Brucella canis ATCC
           23365]
 gi|163843378|ref|YP_001627782.1| ATP-dependent Clp protease proteolytic subunit [Brucella suis ATCC
           23445]
 gi|189024264|ref|YP_001935032.1| Clp protease [Brucella abortus S19]
 gi|254689336|ref|ZP_05152590.1| ATP-dependent Clp protease proteolytic subunit [Brucella abortus
           bv. 6 str. 870]
 gi|254693820|ref|ZP_05155648.1| ATP-dependent Clp protease proteolytic subunit [Brucella abortus
           bv. 3 str. Tulya]
 gi|254697469|ref|ZP_05159297.1| ATP-dependent Clp protease proteolytic subunit [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|254701854|ref|ZP_05163682.1| ATP-dependent Clp protease proteolytic subunit [Brucella suis bv. 5
           str. 513]
 gi|254706705|ref|ZP_05168533.1| ATP-dependent Clp protease proteolytic subunit [Brucella
           pinnipedialis M163/99/10]
 gi|254710187|ref|ZP_05171998.1| ATP-dependent Clp protease proteolytic subunit [Brucella
           pinnipedialis B2/94]
 gi|254714185|ref|ZP_05175996.1| ATP-dependent Clp protease proteolytic subunit [Brucella ceti
           M644/93/1]
 gi|254717620|ref|ZP_05179431.1| ATP-dependent Clp protease proteolytic subunit [Brucella ceti
           M13/05/1]
 gi|254719174|ref|ZP_05180985.1| ATP-dependent Clp protease proteolytic subunit [Brucella sp. 83/13]
 gi|254730366|ref|ZP_05188944.1| ATP-dependent Clp protease proteolytic subunit [Brucella abortus
           bv. 4 str. 292]
 gi|256031681|ref|ZP_05445295.1| ATP-dependent Clp protease proteolytic subunit [Brucella
           pinnipedialis M292/94/1]
 gi|256061193|ref|ZP_05451345.1| ATP-dependent Clp protease proteolytic subunit [Brucella neotomae
           5K33]
 gi|256159837|ref|ZP_05457570.1| ATP-dependent Clp protease proteolytic subunit [Brucella ceti
           M490/95/1]
 gi|256255083|ref|ZP_05460619.1| ATP-dependent Clp protease proteolytic subunit [Brucella ceti
           B1/94]
 gi|256257582|ref|ZP_05463118.1| ATP-dependent Clp protease proteolytic subunit [Brucella abortus
           bv. 9 str. C68]
 gi|260168815|ref|ZP_05755626.1| ATP-dependent Clp protease proteolytic subunit [Brucella sp. F5/99]
 gi|260546576|ref|ZP_05822315.1| clp protease [Brucella abortus NCTC 8038]
 gi|260566355|ref|ZP_05836825.1| clp protease [Brucella suis bv. 4 str. 40]
 gi|260754852|ref|ZP_05867200.1| endopeptidase Clp [Brucella abortus bv. 6 str. 870]
 gi|260758069|ref|ZP_05870417.1| endopeptidase Clp [Brucella abortus bv. 4 str. 292]
 gi|260761893|ref|ZP_05874236.1| endopeptidase Clp [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883864|ref|ZP_05895478.1| ClpP [Brucella abortus bv. 9 str. C68]
 gi|261214103|ref|ZP_05928384.1| endopeptidase Clp [Brucella abortus bv. 3 str. Tulya]
 gi|261219456|ref|ZP_05933737.1| ATP-dependent Clp protease [Brucella ceti M13/05/1]
 gi|261222276|ref|ZP_05936557.1| ClpP [Brucella ceti B1/94]
 gi|261314167|ref|ZP_05953364.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261317744|ref|ZP_05956941.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261321952|ref|ZP_05961149.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261325200|ref|ZP_05964397.1| ClpP [Brucella neotomae 5K33]
 gi|261752415|ref|ZP_05996124.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Brucella suis
           bv. 5 str. 513]
 gi|261758300|ref|ZP_06002009.1| clp protease [Brucella sp. F5/99]
 gi|265984170|ref|ZP_06096905.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|265988775|ref|ZP_06101332.1| ClpP [Brucella pinnipedialis M292/94/1]
 gi|265998240|ref|ZP_06110797.1| ClpP [Brucella ceti M490/95/1]
 gi|294852448|ref|ZP_06793121.1| Clp protease [Brucella sp. NVSL 07-0026]
 gi|306838166|ref|ZP_07471022.1| ATP-dependent Clp protease proteolytic subunit [Brucella sp. NF
           2653]
 gi|306841836|ref|ZP_07474518.1| ATP-dependent Clp protease proteolytic subunit [Brucella sp. BO2]
 gi|306843974|ref|ZP_07476569.1| ATP-dependent Clp protease proteolytic subunit [Brucella sp. BO1]
 gi|18203228|sp|Q9L7X6|CLPP_BRUAB RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|90101403|sp|Q2YPX1|CLPP_BRUA2 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|189082449|sp|A9M5C2|CLPP_BRUC2 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|189082450|sp|B0CGR1|CLPP_BRUSI RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|226706442|sp|B2S5W1|CLPP_BRUA1 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|6942106|gb|AAF32318.1|AF218420_1 ClpP [Brucella abortus]
 gi|62196156|gb|AAX74456.1| ClpP, ATP-dependent Clp protease, proteolytic subunit ClpP
           [Brucella abortus bv. 1 str. 9-941]
 gi|82616052|emb|CAJ11088.1| Clp protease [Brucella melitensis biovar Abortus 2308]
 gi|161335872|gb|ABX62177.1| ATP-dependent Clp protease proteolytic subunit [Brucella canis ATCC
           23365]
 gi|163674101|gb|ABY38212.1| ATP-dependent Clp protease proteolytic subunit [Brucella suis ATCC
           23445]
 gi|189019836|gb|ACD72558.1| Clp protease [Brucella abortus S19]
 gi|260095626|gb|EEW79503.1| clp protease [Brucella abortus NCTC 8038]
 gi|260155873|gb|EEW90953.1| clp protease [Brucella suis bv. 4 str. 40]
 gi|260668387|gb|EEX55327.1| endopeptidase Clp [Brucella abortus bv. 4 str. 292]
 gi|260672325|gb|EEX59146.1| endopeptidase Clp [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674960|gb|EEX61781.1| endopeptidase Clp [Brucella abortus bv. 6 str. 870]
 gi|260873392|gb|EEX80461.1| ClpP [Brucella abortus bv. 9 str. C68]
 gi|260915710|gb|EEX82571.1| endopeptidase Clp [Brucella abortus bv. 3 str. Tulya]
 gi|260920860|gb|EEX87513.1| ClpP [Brucella ceti B1/94]
 gi|260924545|gb|EEX91113.1| ATP-dependent Clp protease [Brucella ceti M13/05/1]
 gi|261294642|gb|EEX98138.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261296967|gb|EEY00464.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261301180|gb|EEY04677.1| ClpP [Brucella neotomae 5K33]
 gi|261303193|gb|EEY06690.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261738284|gb|EEY26280.1| clp protease [Brucella sp. F5/99]
 gi|261742168|gb|EEY30094.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Brucella suis
           bv. 5 str. 513]
 gi|262552708|gb|EEZ08698.1| ClpP [Brucella ceti M490/95/1]
 gi|264660972|gb|EEZ31233.1| ClpP [Brucella pinnipedialis M292/94/1]
 gi|264662762|gb|EEZ33023.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|294821037|gb|EFG38036.1| Clp protease [Brucella sp. NVSL 07-0026]
 gi|306275729|gb|EFM57453.1| ATP-dependent Clp protease proteolytic subunit [Brucella sp. BO1]
 gi|306288063|gb|EFM59460.1| ATP-dependent Clp protease proteolytic subunit [Brucella sp. BO2]
 gi|306406756|gb|EFM62979.1| ATP-dependent Clp protease proteolytic subunit [Brucella sp. NF
           2653]
          Length = 209

 Score =  328 bits (842), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 183/208 (87%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D  +  + LVPMVVEQTNRGER+YDI+SRLLKERI+FV G +ED M+ L+CAQLLFLEA
Sbjct: 2   RDPIETVMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVNGPVEDGMSMLVCAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEI++YINSPGGVVT+GMAIYDTMQFI+PP+ST CMGQAASMGSLLL+AG  G R+
Sbjct: 62  ENPKKEINMYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGATGHRY 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           ALPNARI++HQPSGGF GQASDIERHAQDI+K+KRRLNEIYVK+ G+ Y+ +E+TLDRDH
Sbjct: 122 ALPNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVKHTGRDYDTIERTLDRDH 181

Query: 189 IMSASEACDWGVVDKVLMSRIDIEEKSK 216
            M+A EA ++G++DKV+ +R    ++SK
Sbjct: 182 FMTAQEALEFGLIDKVVEARDVSADESK 209


>gi|319898776|ref|YP_004158869.1| ATP-dependent Clp protease, proteolytic subunit [Bartonella
           clarridgeiae 73]
 gi|319402740|emb|CBI76287.1| ATP-dependent Clp protease, proteolytic subunit [Bartonella
           clarridgeiae 73]
          Length = 210

 Score =  328 bits (842), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 179/201 (89%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           L LVPMVVEQTNRGER+YDI+SRLLKERI+F+ G +ED+MA L+CAQLLFLEAENP+KEI
Sbjct: 9   LSLVPMVVEQTNRGERAYDIFSRLLKERIIFINGPVEDNMAMLVCAQLLFLEAENPKKEI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           +LYINSPGGVVT+GMAIYDTMQFI+P +ST CMGQAASMGSLLL+AG  G RFALPNARI
Sbjct: 69  NLYINSPGGVVTSGMAIYDTMQFIRPSVSTLCMGQAASMGSLLLTAGATGRRFALPNARI 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGGF GQASDIERHAQDIVK+KRRLNEIYV++ G++YE +EKTLDRDH M+A E+
Sbjct: 129 MVHQPSGGFQGQASDIERHAQDIVKMKRRLNEIYVQHTGQSYEVIEKTLDRDHFMTAEES 188

Query: 196 CDWGVVDKVLMSRIDIEEKSK 216
             +G++D V+  R + E++ K
Sbjct: 189 KQFGLIDDVIQYRAETEKEEK 209


>gi|148558952|ref|YP_001259031.1| ATP-dependent Clp protease proteolytic subunit [Brucella ovis ATCC
           25840]
 gi|297248424|ref|ZP_06932142.1| ATP-dependent Clp protease, protease subunit [Brucella abortus bv.
           5 str. B3196]
 gi|148370209|gb|ABQ60188.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Brucella ovis
           ATCC 25840]
 gi|297175593|gb|EFH34940.1| ATP-dependent Clp protease, protease subunit [Brucella abortus bv.
           5 str. B3196]
          Length = 228

 Score =  328 bits (841), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 183/208 (87%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D  +  + LVPMVVEQTNRGER+YDI+SRLLKERI+FV G +ED M+ L+CAQLLFLEA
Sbjct: 21  RDPIETVMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVNGPVEDGMSMLVCAQLLFLEA 80

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEI++YINSPGGVVT+GMAIYDTMQFI+PP+ST CMGQAASMGSLLL+AG  G R+
Sbjct: 81  ENPKKEINMYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGATGHRY 140

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           ALPNARI++HQPSGGF GQASDIERHAQDI+K+KRRLNEIYVK+ G+ Y+ +E+TLDRDH
Sbjct: 141 ALPNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVKHTGRDYDTIERTLDRDH 200

Query: 189 IMSASEACDWGVVDKVLMSRIDIEEKSK 216
            M+A EA ++G++DKV+ +R    ++SK
Sbjct: 201 FMTAQEALEFGLIDKVVEARDVSADESK 228


>gi|49475380|ref|YP_033421.1| ATP-dependent Clp protease proteolytic subunit [Bartonella henselae
           str. Houston-1]
 gi|67460276|sp|Q6G3Z3|CLPP_BARHE RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|49238186|emb|CAF27396.1| ATP-dependent clp protease proteolytic subunit [Bartonella henselae
           str. Houston-1]
          Length = 210

 Score =  328 bits (840), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 148/201 (73%), Positives = 178/201 (88%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           L LVPMV+EQTNRGER+YDI+SRLLKERI+F+ G +ED MA L+CAQLLFLEAENP+KEI
Sbjct: 9   LSLVPMVIEQTNRGERAYDIFSRLLKERIIFINGPVEDGMAMLVCAQLLFLEAENPKKEI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGGVVT+GMAIYDTMQFI+PP+ST CMGQAASMGSLLL+AG KG RF LPNARI
Sbjct: 69  SLYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGAKGHRFTLPNARI 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGGF GQASDIERHAQDI+K+K+RLNEIYV++ G+ Y+ +E+TLDRDH M+A EA
Sbjct: 129 MVHQPSGGFQGQASDIERHAQDIIKMKQRLNEIYVQHTGQNYDVIERTLDRDHFMTAEEA 188

Query: 196 CDWGVVDKVLMSRIDIEEKSK 216
             +G+VD V+  R + E++ K
Sbjct: 189 KQFGLVDDVIQYRAETEKEEK 209


>gi|319405542|emb|CBI79161.1| ATP-dependent Clp protease, proteolytic subunit [Bartonella sp. AR
           15-3]
          Length = 210

 Score =  328 bits (840), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 180/208 (86%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D     L LVPMV+EQTNRGER+YDI+SRLLKERI+F+ G +ED+MA L+CAQLLFLEA
Sbjct: 2   RDPTKKVLSLVPMVIEQTNRGERAYDIFSRLLKERIIFINGPVEDNMAMLVCAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEI+LYINSPGG+VT+GMAIYDTMQFI+P +ST CMGQAASMGSLLL+AG  G RF
Sbjct: 62  ENPKKEINLYINSPGGMVTSGMAIYDTMQFIRPSVSTLCMGQAASMGSLLLTAGAAGRRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           ALPNARI++HQPSGGF GQASDIERHAQDI+K+KRRLNEIYV++ G+ YE +EKTLDRDH
Sbjct: 122 ALPNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVQHTGQNYEVIEKTLDRDH 181

Query: 189 IMSASEACDWGVVDKVLMSRIDIEEKSK 216
            M+A EA  +G++D V+  R + E++ K
Sbjct: 182 FMTAEEAKQFGLIDDVIQYRAETEKEEK 209


>gi|225627583|ref|ZP_03785620.1| ATP-dependent Clp protease proteolytic subunit [Brucella ceti str.
           Cudo]
 gi|237815533|ref|ZP_04594530.1| ATP-dependent Clp protease proteolytic subunit [Brucella abortus
           str. 2308 A]
 gi|225617588|gb|EEH14633.1| ATP-dependent Clp protease proteolytic subunit [Brucella ceti str.
           Cudo]
 gi|237788831|gb|EEP63042.1| ATP-dependent Clp protease proteolytic subunit [Brucella abortus
           str. 2308 A]
          Length = 247

 Score =  327 bits (839), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 183/208 (87%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D  +  + LVPMVVEQTNRGER+YDI+SRLLKERI+FV G +ED M+ L+CAQLLFLEA
Sbjct: 40  RDPIETVMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVNGPVEDGMSMLVCAQLLFLEA 99

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEI++YINSPGGVVT+GMAIYDTMQFI+PP+ST CMGQAASMGSLLL+AG  G R+
Sbjct: 100 ENPKKEINMYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGATGHRY 159

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           ALPNARI++HQPSGGF GQASDIERHAQDI+K+KRRLNEIYVK+ G+ Y+ +E+TLDRDH
Sbjct: 160 ALPNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVKHTGRDYDTIERTLDRDH 219

Query: 189 IMSASEACDWGVVDKVLMSRIDIEEKSK 216
            M+A EA ++G++DKV+ +R    ++SK
Sbjct: 220 FMTAQEALEFGLIDKVVEARDVSADESK 247


>gi|23501987|ref|NP_698114.1| ATP-dependent Clp protease proteolytic subunit [Brucella suis 1330]
 gi|38257636|sp|Q8G0I4|CLPP_BRUSU RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|23347937|gb|AAN30029.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Brucella suis
           1330]
          Length = 209

 Score =  327 bits (838), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 182/208 (87%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D  +  + LVPMVVEQTNRGER+YDI+SRLLKERI+FV G +ED M+ L+CAQLLFLEA
Sbjct: 2   RDPIETVMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVNGPVEDGMSMLVCAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEI++YINSPGGVVT+GMAIYDTMQFI+PP+ST CMGQAASMGSLLL+AG  G R+
Sbjct: 62  ENPKKEINMYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGATGHRY 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           ALPNARI++HQPSGGF GQASDIERHAQDI+K+KRRLNEIYVK+ G+ Y+ +E+TLDRDH
Sbjct: 122 ALPNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVKHTGRDYDTIERTLDRDH 181

Query: 189 IMSASEACDWGVVDKVLMSRIDIEEKSK 216
            M+A EA ++G++DKV+  R    ++SK
Sbjct: 182 FMTAQEALEFGLIDKVVEVRDVSADESK 209


>gi|319404099|emb|CBI77689.1| ATP-dependent Clp protease, proteolytic subunit [Bartonella
           rochalimae ATCC BAA-1498]
 gi|319407112|emb|CBI80749.1| ATP-dependent Clp protease, proteolytic subunit [Bartonella sp.
           1-1C]
          Length = 210

 Score =  326 bits (836), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 147/201 (73%), Positives = 178/201 (88%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           L LVPMVVEQTNRGER+YDI+SRLLKERI+F+ G +ED+MA L+CAQLLFLEAENP+KEI
Sbjct: 9   LSLVPMVVEQTNRGERAYDIFSRLLKERIIFINGPVEDNMAMLVCAQLLFLEAENPKKEI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           +LYINSPGGVVT+GMAIYDTMQFI+P +ST CMGQAASMGSLLL+AG  G RFALPNARI
Sbjct: 69  NLYINSPGGVVTSGMAIYDTMQFIRPSVSTLCMGQAASMGSLLLTAGATGRRFALPNARI 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGGF GQASDIERHAQDI+K+KRRLNEIYV++ G++YE +E TLDRDH M+A E+
Sbjct: 129 MVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVQHTGQSYEVIENTLDRDHFMTAEES 188

Query: 196 CDWGVVDKVLMSRIDIEEKSK 216
             +G++D V+  R + E++ K
Sbjct: 189 KQFGLIDDVIQYRAETEKEEK 209


>gi|256369536|ref|YP_003107046.1| ATP-dependent Clp protease proteolytic subunit [Brucella microti
           CCM 4915]
 gi|255999698|gb|ACU48097.1| ATP-dependent Clp protease proteolytic subunit [Brucella microti
           CCM 4915]
          Length = 209

 Score =  325 bits (833), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 182/208 (87%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D  +  + LVPMVVEQTNRGER+YDI+SRLLKERI+FV G +ED M+ L+CAQLLFLEA
Sbjct: 2   RDPIETVMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVNGPVEDGMSMLVCAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEI++YINSPGGVVT+GMAIYDTMQFI+PP+ST CMGQAASMGSLLL+AG  G R+
Sbjct: 62  ENPKKEINMYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGATGHRY 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           ALPNARI++HQPSGGF GQASDIERHAQDI+K+KRRLNEIYVK+ G+ Y+ +E TLDRDH
Sbjct: 122 ALPNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVKHTGRDYDTIECTLDRDH 181

Query: 189 IMSASEACDWGVVDKVLMSRIDIEEKSK 216
            M+A EA ++G++DKV+ +R    ++SK
Sbjct: 182 FMTAQEALEFGLIDKVVEARDVSADESK 209


>gi|239977100|sp|P0CAU1|CLPP_CAUCR RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|239977114|sp|B8GX16|CLPP_CAUCN RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
          Length = 209

 Score =  325 bits (833), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 149/199 (74%), Positives = 175/199 (87%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           D     + LVPMVVEQT+RGER++DI+SRLLKERI+F+TG +ED MA+LICAQLLFLE+E
Sbjct: 3   DPVSTAMNLVPMVVEQTSRGERAFDIFSRLLKERIIFLTGPVEDGMASLICAQLLFLESE 62

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP+KEI++YINSPGGVVTAG+AIYDTMQ+IK P+ST CMG AASMGSLLL+AG  G R +
Sbjct: 63  NPKKEIAMYINSPGGVVTAGLAIYDTMQYIKSPVSTVCMGMAASMGSLLLAAGAAGQRIS 122

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPNARI++HQPSGGF GQASDIERHA+DI+K KRRLNEIYVK+CG+TYEEVE+TLDRDH 
Sbjct: 123 LPNARIMVHQPSGGFRGQASDIERHAEDIIKTKRRLNEIYVKHCGRTYEEVERTLDRDHF 182

Query: 190 MSASEACDWGVVDKVLMSR 208
           MSA EA  WG+VD V  SR
Sbjct: 183 MSADEAKAWGLVDHVYDSR 201


>gi|121602655|ref|YP_988860.1| ATP-dependent Clp protease proteolytic subunit [Bartonella
           bacilliformis KC583]
 gi|166201800|sp|A1USA7|CLPP_BARBK RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|120614832|gb|ABM45433.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bartonella
           bacilliformis KC583]
          Length = 210

 Score =  325 bits (833), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 148/201 (73%), Positives = 177/201 (88%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           L LVPMVVEQTNRGER+YDI+SRLLKERI+F+ G +ED MA L+CAQLLFLEAENP+KEI
Sbjct: 9   LSLVPMVVEQTNRGERAYDIFSRLLKERIIFINGPVEDSMAMLVCAQLLFLEAENPKKEI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGGVVT+GMAIYDTMQFI+PPIST CMGQAASMGSLLL+AG KG RF+LPNARI
Sbjct: 69  SLYINSPGGVVTSGMAIYDTMQFIRPPISTLCMGQAASMGSLLLTAGAKGHRFSLPNARI 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGGF GQASDIERHAQDI+++KR LNEIYV++ G+ YE +E TLDRDH M+A EA
Sbjct: 129 MVHQPSGGFQGQASDIERHAQDIIRMKRHLNEIYVQHTGQDYEIIENTLDRDHFMTAEEA 188

Query: 196 CDWGVVDKVLMSRIDIEEKSK 216
             +G++D V+  R + +++ K
Sbjct: 189 KMFGLIDDVIQYRAETKKEEK 209


>gi|295689638|ref|YP_003593331.1| endopeptidase Clp [Caulobacter segnis ATCC 21756]
 gi|295431541|gb|ADG10713.1| Endopeptidase Clp [Caulobacter segnis ATCC 21756]
          Length = 210

 Score =  325 bits (832), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 149/199 (74%), Positives = 175/199 (87%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           D     + LVPMVVEQT+RGER++DI+SRLLKERI+F+TG +ED MA+LICAQLLFLE+E
Sbjct: 4   DPVSTAMNLVPMVVEQTSRGERAFDIFSRLLKERIIFLTGPVEDGMASLICAQLLFLESE 63

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP+KEI++YINSPGGVVTAG+AIYDTMQ+IK P+ST CMG AASMGSLLL+AG  G R +
Sbjct: 64  NPKKEIAMYINSPGGVVTAGLAIYDTMQYIKSPVSTVCMGMAASMGSLLLAAGAAGQRIS 123

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPNARI++HQPSGGF GQASDIERHA+DI+K KRRLNEIYVK+CG+TYEEVE+TLDRDH 
Sbjct: 124 LPNARIMVHQPSGGFRGQASDIERHAEDIIKTKRRLNEIYVKHCGRTYEEVERTLDRDHF 183

Query: 190 MSASEACDWGVVDKVLMSR 208
           MSA EA  WG+VD V  SR
Sbjct: 184 MSADEAKAWGLVDHVYDSR 202


>gi|16126206|ref|NP_420770.1| ATP-dependent Clp protease, proteolytic subunit [Caulobacter
           crescentus CB15]
 gi|3688205|emb|CAA09090.1| endopeptidase clp [Caulobacter crescentus CB15]
 gi|13423424|gb|AAK23938.1| ATP-dependent Clp protease, proteolytic subunit [Caulobacter
           crescentus CB15]
          Length = 210

 Score =  325 bits (832), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 149/199 (74%), Positives = 175/199 (87%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           D     + LVPMVVEQT+RGER++DI+SRLLKERI+F+TG +ED MA+LICAQLLFLE+E
Sbjct: 4   DPVSTAMNLVPMVVEQTSRGERAFDIFSRLLKERIIFLTGPVEDGMASLICAQLLFLESE 63

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP+KEI++YINSPGGVVTAG+AIYDTMQ+IK P+ST CMG AASMGSLLL+AG  G R +
Sbjct: 64  NPKKEIAMYINSPGGVVTAGLAIYDTMQYIKSPVSTVCMGMAASMGSLLLAAGAAGQRIS 123

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPNARI++HQPSGGF GQASDIERHA+DI+K KRRLNEIYVK+CG+TYEEVE+TLDRDH 
Sbjct: 124 LPNARIMVHQPSGGFRGQASDIERHAEDIIKTKRRLNEIYVKHCGRTYEEVERTLDRDHF 183

Query: 190 MSASEACDWGVVDKVLMSR 208
           MSA EA  WG+VD V  SR
Sbjct: 184 MSADEAKAWGLVDHVYDSR 202


>gi|221234978|ref|YP_002517414.1| ATP-dependent Clp protease proteolytic subunit [Caulobacter
           crescentus NA1000]
 gi|220964150|gb|ACL95506.1| ATP-dependent endopeptidase clp, proteolytic subunit ClpP
           [Caulobacter crescentus NA1000]
          Length = 213

 Score =  324 bits (831), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 149/199 (74%), Positives = 175/199 (87%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           D     + LVPMVVEQT+RGER++DI+SRLLKERI+F+TG +ED MA+LICAQLLFLE+E
Sbjct: 7   DPVSTAMNLVPMVVEQTSRGERAFDIFSRLLKERIIFLTGPVEDGMASLICAQLLFLESE 66

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP+KEI++YINSPGGVVTAG+AIYDTMQ+IK P+ST CMG AASMGSLLL+AG  G R +
Sbjct: 67  NPKKEIAMYINSPGGVVTAGLAIYDTMQYIKSPVSTVCMGMAASMGSLLLAAGAAGQRIS 126

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPNARI++HQPSGGF GQASDIERHA+DI+K KRRLNEIYVK+CG+TYEEVE+TLDRDH 
Sbjct: 127 LPNARIMVHQPSGGFRGQASDIERHAEDIIKTKRRLNEIYVKHCGRTYEEVERTLDRDHF 186

Query: 190 MSASEACDWGVVDKVLMSR 208
           MSA EA  WG+VD V  SR
Sbjct: 187 MSADEAKAWGLVDHVYDSR 205


>gi|319408364|emb|CBI82017.1| ATP-dependent Clp protease, proteolytic subunit [Bartonella
           schoenbuchensis R1]
          Length = 210

 Score =  324 bits (831), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 147/199 (73%), Positives = 177/199 (88%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           L LVPMVVEQTNRGER+YDI+SRLLKERI+F+ G +ED MA L+CAQLLFLEAENP+KEI
Sbjct: 9   LNLVPMVVEQTNRGERAYDIFSRLLKERIIFINGPVEDGMAMLVCAQLLFLEAENPKKEI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGGVVT+GMAIYDTMQFI+PP+ST CMGQAASMGSLLL+AG KG RF+LPNARI
Sbjct: 69  SLYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGAKGHRFSLPNARI 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGGF GQ SDIERHAQDI+K+K+RLNEIYV++ G+ YE +EKTLDRDH M+A E+
Sbjct: 129 MVHQPSGGFQGQVSDIERHAQDIIKMKQRLNEIYVQHTGQDYEIIEKTLDRDHFMTAEES 188

Query: 196 CDWGVVDKVLMSRIDIEEK 214
            ++G++D V+  R   E++
Sbjct: 189 KNFGLIDDVIQYRTVTEKE 207


>gi|161511142|ref|NP_539791.2| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           bv. 1 str. 16M]
 gi|225852610|ref|YP_002732843.1| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           ATCC 23457]
 gi|256044767|ref|ZP_05447671.1| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|256113666|ref|ZP_05454477.1| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           bv. 3 str. Ether]
 gi|256263897|ref|ZP_05466429.1| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           bv. 2 str. 63/9]
 gi|260565631|ref|ZP_05836115.1| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           bv. 1 str. 16M]
 gi|265991190|ref|ZP_06103747.1| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|265995026|ref|ZP_06107583.1| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           bv. 3 str. Ether]
 gi|21759068|sp|Q8YHC8|CLPP_BRUME RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|254763784|sp|C0RJ81|CLPP_BRUMB RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|225640975|gb|ACO00889.1| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           ATCC 23457]
 gi|260151699|gb|EEW86793.1| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           bv. 1 str. 16M]
 gi|262766139|gb|EEZ11928.1| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           bv. 3 str. Ether]
 gi|263001974|gb|EEZ14549.1| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|263094029|gb|EEZ17963.1| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           bv. 2 str. 63/9]
 gi|326409129|gb|ADZ66194.1| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           M28]
 gi|326538837|gb|ADZ87052.1| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           M5-90]
          Length = 209

 Score =  324 bits (831), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 147/208 (70%), Positives = 182/208 (87%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D  +  + LVPMVVEQTNRGER+YDI+SRLLKERI+FV G +ED M+ L+CAQLLFLEA
Sbjct: 2   RDPIETVMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVNGPVEDGMSMLVCAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEI++YINSPGGVVT+GMAIYDTMQFI+PP+ST CMGQAASMGSLLL+AG  G R+
Sbjct: 62  ENPKKEINMYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGATGHRY 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           AL NARI++HQPSGGF GQASDIERHAQDI+K+KRRLNEIYVK+ G+ Y+ +E+TLDRDH
Sbjct: 122 ALLNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVKHTGRDYDTIERTLDRDH 181

Query: 189 IMSASEACDWGVVDKVLMSRIDIEEKSK 216
            M+A EA ++G++DKV+ +R    ++SK
Sbjct: 182 FMTAQEALEFGLIDKVVEARDVSADESK 209


>gi|167646810|ref|YP_001684473.1| ATP-dependent Clp protease proteolytic subunit [Caulobacter sp.
           K31]
 gi|189082451|sp|B0SZQ2|CLPP_CAUSK RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|167349240|gb|ABZ71975.1| Endopeptidase Clp [Caulobacter sp. K31]
          Length = 208

 Score =  324 bits (831), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 149/200 (74%), Positives = 177/200 (88%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGER++DI+SRLLKERI+F+TG +ED MA+LICAQLLFLE+ENP+KEI
Sbjct: 9   MNLVPMVVEQTSRGERAFDIFSRLLKERIIFLTGPVEDGMASLICAQLLFLESENPKKEI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           ++YINSPGGVVTAG+AIYDTMQ+IK P+ST CMG AASMGSLLL AG  G R ALPNARI
Sbjct: 69  AMYINSPGGVVTAGLAIYDTMQYIKSPVSTVCMGMAASMGSLLLQAGAPGHRIALPNARI 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGGF GQASDIERHA+DI+K KRRLNEIYVK+ G+TYEEVEKTLDRDH MSA EA
Sbjct: 129 MVHQPSGGFRGQASDIERHAEDIIKTKRRLNEIYVKHTGRTYEEVEKTLDRDHFMSAEEA 188

Query: 196 CDWGVVDKVLMSRIDIEEKS 215
             WG++D +  SR + +EK+
Sbjct: 189 KAWGLIDHINESRDEADEKA 208


>gi|17982823|gb|AAL52055.1| ATP-dependent clp protease proteolytic subunit [Brucella melitensis
           bv. 1 str. 16M]
          Length = 247

 Score =  323 bits (828), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 147/208 (70%), Positives = 182/208 (87%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D  +  + LVPMVVEQTNRGER+YDI+SRLLKERI+FV G +ED M+ L+CAQLLFLEA
Sbjct: 40  RDPIETVMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVNGPVEDGMSMLVCAQLLFLEA 99

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEI++YINSPGGVVT+GMAIYDTMQFI+PP+ST CMGQAASMGSLLL+AG  G R+
Sbjct: 100 ENPKKEINMYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGATGHRY 159

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           AL NARI++HQPSGGF GQASDIERHAQDI+K+KRRLNEIYVK+ G+ Y+ +E+TLDRDH
Sbjct: 160 ALLNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVKHTGRDYDTIERTLDRDH 219

Query: 189 IMSASEACDWGVVDKVLMSRIDIEEKSK 216
            M+A EA ++G++DKV+ +R    ++SK
Sbjct: 220 FMTAQEALEFGLIDKVVEARDVSADESK 247


>gi|218678052|ref|ZP_03525949.1| ATP-dependent Clp protease proteolytic subunit [Rhizobium etli CIAT
           894]
          Length = 176

 Score =  322 bits (825), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 165/175 (94%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQTNRGERSYDIYSRLLKERI+F+TG +EDHMATL+CAQLLFLEAENP+KEI
Sbjct: 1   MALVPMVVEQTNRGERSYDIYSRLLKERIIFLTGAVEDHMATLVCAQLLFLEAENPKKEI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           +LYINSPGGVVTAGMAIYDTMQFIKP +ST C+GQAASMGSLLL+AG K MRFA PN+RI
Sbjct: 61  ALYINSPGGVVTAGMAIYDTMQFIKPAVSTLCIGQAASMGSLLLAAGHKDMRFATPNSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIM 190
           ++HQPSGGF GQASDIERHA+DI+K+KRRLNE+YVK+ G+TYEEVEKTLDRDH M
Sbjct: 121 MVHQPSGGFQGQASDIERHARDILKMKRRLNEVYVKHTGRTYEEVEKTLDRDHFM 175


>gi|300023469|ref|YP_003756080.1| endopeptidase Clp [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525290|gb|ADJ23759.1| Endopeptidase Clp [Hyphomicrobium denitrificans ATCC 51888]
          Length = 217

 Score =  321 bits (823), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 146/193 (75%), Positives = 174/193 (90%)

Query: 20  PMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYI 79
           PMVVEQT RGER YD+ SRLLKERI+FVTG +EDHMA  IC QLLFLE+ENP+KEIS+YI
Sbjct: 14  PMVVEQTTRGERGYDLPSRLLKERIIFVTGPVEDHMAASICMQLLFLESENPKKEISMYI 73

Query: 80  NSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQ 139
           NSPGGVVTAGMAIYDTMQF+KPP++T C+GQAASMGSLLL AG K MRFALPNARI++HQ
Sbjct: 74  NSPGGVVTAGMAIYDTMQFVKPPVATLCIGQAASMGSLLLCAGAKDMRFALPNARIMVHQ 133

Query: 140 PSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWG 199
           PSGGFSGQASDIERHA+DI+K+KRRLNE YVK+ G++YE +EKTLDRD+ M+A +A D+G
Sbjct: 134 PSGGFSGQASDIERHAEDIIKMKRRLNETYVKHTGQSYEMIEKTLDRDYFMTADQARDFG 193

Query: 200 VVDKVLMSRIDIE 212
           ++DKVL SR +++
Sbjct: 194 IIDKVLESRDEVD 206


>gi|114569888|ref|YP_756568.1| ATP-dependent Clp protease proteolytic subunit ClpP [Maricaulis
           maris MCS10]
 gi|122316141|sp|Q0AQ07|CLPP_MARMM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|114340350|gb|ABI65630.1| ATP-dependent Clp protease proteolytic subunit ClpP [Maricaulis
           maris MCS10]
          Length = 211

 Score =  320 bits (821), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 147/205 (71%), Positives = 179/205 (87%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           D +DV + LVP+VVEQT+RGERS+DIYSRLLKERI+F+TG IEDHMA+LI AQLLFLE+E
Sbjct: 3   DPQDVMMNLVPIVVEQTSRGERSFDIYSRLLKERIIFITGPIEDHMASLIIAQLLFLESE 62

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP+KEIS+YINSPGGVV+AG+ IYDTMQ+I+ P+ST C+G AASMGSLLL+AGEK MRFA
Sbjct: 63  NPKKEISMYINSPGGVVSAGLGIYDTMQYIRSPVSTMCLGMAASMGSLLLTAGEKDMRFA 122

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
            PNARI++HQPSGGF GQASDIERHA DI KIKRRLNEIYV + G+TY+E+E  LDRD+ 
Sbjct: 123 APNARIMVHQPSGGFRGQASDIERHAADIQKIKRRLNEIYVHHTGRTYDEIESALDRDNF 182

Query: 190 MSASEACDWGVVDKVLMSRIDIEEK 214
           MSA E  ++G+VDKV+  R + E++
Sbjct: 183 MSAQEGLEFGLVDKVIERRAEDEKE 207


>gi|304391391|ref|ZP_07373333.1| Clp protease [Ahrensia sp. R2A130]
 gi|303295620|gb|EFL89978.1| Clp protease [Ahrensia sp. R2A130]
          Length = 212

 Score =  318 bits (815), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 146/204 (71%), Positives = 176/204 (86%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D     + LVPMVVEQTNRGER+YDI+SRLLKERI+F+TG IED M+ L+CAQLLFLEA
Sbjct: 2   QDPIQTAMNLVPMVVEQTNRGERAYDIFSRLLKERIIFITGPIEDGMSVLVCAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEISLYINSPGGVVTAGMAIYDTMQFIKPP++T CMGQA SMGSLLL+AGEK MRF
Sbjct: 62  ENPKKEISLYINSPGGVVTAGMAIYDTMQFIKPPVATLCMGQACSMGSLLLTAGEKDMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
            LP AR++LHQPSGG  G+ SDIER+  DI+K+K+RLN+IYVK+ G+  E +E+TLDRDH
Sbjct: 122 ILPQARVMLHQPSGGMQGKVSDIERNYTDIIKVKQRLNDIYVKHTGQDLETIERTLDRDH 181

Query: 189 IMSASEACDWGVVDKVLMSRIDIE 212
            M+A E+ ++GVVDKV+ SR +IE
Sbjct: 182 FMNAEESVEFGVVDKVIASRDEIE 205


>gi|312113123|ref|YP_004010719.1| endopeptidase Clp [Rhodomicrobium vannielii ATCC 17100]
 gi|311218252|gb|ADP69620.1| Endopeptidase Clp [Rhodomicrobium vannielii ATCC 17100]
          Length = 214

 Score =  315 bits (806), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 141/196 (71%), Positives = 175/196 (89%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQTNRGER++DIYSRLLKERI+F+TG +ED+MA+L+ AQLLFLE+ENP+KEI++
Sbjct: 12  LVPMVVEQTNRGERAFDIYSRLLKERIIFLTGVVEDNMASLVIAQLLFLESENPKKEINI 71

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VT+G+A+YDTMQFI+PP+ST C+GQAASMGSLLL+AGE GMR+ALPNAR+++
Sbjct: 72  YINSPGGHVTSGLAMYDTMQFIRPPVSTLCVGQAASMGSLLLAAGEPGMRWALPNARVMV 131

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPS GF GQASDIERHA+DI+K KRRLNEIYVK+ G+ YE +E+TLDRDH MS  +A  
Sbjct: 132 HQPSAGFQGQASDIERHAEDILKTKRRLNEIYVKHTGQPYEVIERTLDRDHFMSPEQAKA 191

Query: 198 WGVVDKVLMSRIDIEE 213
           +G++D+VL  R   EE
Sbjct: 192 FGIIDEVLTKRAAAEE 207


>gi|209885039|ref|YP_002288896.1| Clp protease [Oligotropha carboxidovorans OM5]
 gi|226706464|sp|B6JGU7|CLPP_OLICO RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|209873235|gb|ACI93031.1| Clp protease [Oligotropha carboxidovorans OM5]
          Length = 210

 Score =  312 bits (799), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 139/200 (69%), Positives = 177/200 (88%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+FVTG +ED M+TLI AQLLFLEA
Sbjct: 2   RDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVTGPVEDGMSTLIVAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEIS+YINSPGGVVT+G+AIYDTMQFI+PP+ST C GQAASMGSLLL+AGEK MRF
Sbjct: 62  ENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVSTLCTGQAASMGSLLLAAGEKDMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           +LPN+RI++HQPSGGF GQA+DI  HAQ+I+ +K+RLNEIYVK+ G++Y+ +E  L+RD+
Sbjct: 122 SLPNSRIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVKHTGQSYQAIEDALERDN 181

Query: 189 IMSASEACDWGVVDKVLMSR 208
            ++A +A D+G+VDKV+  R
Sbjct: 182 FLTAEKARDFGIVDKVIDKR 201


>gi|296446284|ref|ZP_06888230.1| Endopeptidase Clp [Methylosinus trichosporium OB3b]
 gi|296256185|gb|EFH03266.1| Endopeptidase Clp [Methylosinus trichosporium OB3b]
          Length = 211

 Score =  311 bits (796), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 176/199 (88%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           L+P V+E T+RGER +DIYSRLL+ERI+F+TGQ+EDHMA++I AQLLFLEAENP++EI L
Sbjct: 12  LIPQVIENTSRGERGFDIYSRLLRERIIFLTGQVEDHMASVIIAQLLFLEAENPKREIFL 71

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G+AIYDTMQ+I+P ++T C+GQAASMGSLLL AGE G RFALPNARI++
Sbjct: 72  YINSPGGVVTSGLAIYDTMQYIRPKVATLCIGQAASMGSLLLCAGEAGQRFALPNARIMV 131

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGGF GQASDI RHA+DI+KIK+RLNEIYV++ G+ YE +EKTLDRDH MSA EA D
Sbjct: 132 HQPSGGFQGQASDILRHAEDIMKIKKRLNEIYVRHTGRDYETIEKTLDRDHFMSAEEAKD 191

Query: 198 WGVVDKVLMSRIDIEEKSK 216
           +G+VD V ++R + + ++K
Sbjct: 192 FGIVDHVQVNRPEEQSETK 210


>gi|307942062|ref|ZP_07657413.1| Clp protease [Roseibium sp. TrichSKD4]
 gi|307774348|gb|EFO33558.1| Clp protease [Roseibium sp. TrichSKD4]
          Length = 211

 Score =  311 bits (796), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 140/209 (66%), Positives = 181/209 (86%), Gaps = 1/209 (0%)

Query: 9   KDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           KD  D+++  LVPMVVEQTNRGERS+DIYSRLLKERI+F+TG IEDH+ATL+CAQLLFLE
Sbjct: 2   KDPADIYMNTLVPMVVEQTNRGERSFDIYSRLLKERIIFLTGPIEDHVATLVCAQLLFLE 61

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           A+NP KEI++YINSPGG+VT+G+AIYDTMQFI+P +ST C+GQAASMGSLLL+ GEK MR
Sbjct: 62  ADNPSKEIAIYINSPGGLVTSGLAIYDTMQFIRPAVSTLCIGQAASMGSLLLAGGEKDMR 121

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPNAR+++HQPSGGF GQA+DI  HAQ+I+ +KRRLNEIYVK+ G++ +EVE+ L+RD
Sbjct: 122 FSLPNARVMVHQPSGGFRGQAADIMLHAQEILAMKRRLNEIYVKHTGQSLDEVEEALERD 181

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           + M+A +A ++G+VD V+  R  +   S+
Sbjct: 182 NFMTAEKAKEFGIVDSVITDRASLHSDSE 210


>gi|27380055|ref|NP_771584.1| ATP-dependent Clp protease proteolytic subunit [Bradyrhizobium
           japonicum USDA 110]
 gi|67460543|sp|Q89KG1|CLPP2_BRAJA RecName: Full=ATP-dependent Clp protease proteolytic subunit 2;
           AltName: Full=Endopeptidase Clp 2
 gi|27353209|dbj|BAC50209.1| ATP-dependent Clp protease proteolytic subunit [Bradyrhizobium
           japonicum USDA 110]
          Length = 211

 Score =  310 bits (794), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 137/200 (68%), Positives = 177/200 (88%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+F+TG +ED M+TL+ AQLLFLEA
Sbjct: 2   RDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFLTGPVEDGMSTLVVAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEIS+YINSPGGVVT+G+AIYDTMQFI+PP+ST C GQAASMGSLLL+AGEK MRF
Sbjct: 62  ENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVSTLCTGQAASMGSLLLAAGEKDMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           +LPNARI++HQPSGGF GQA+DI  HAQ+I+ +K+RLNEIYVK+ G+TY+ +E  L+RD 
Sbjct: 122 SLPNARIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVKHTGQTYKTIEDALERDK 181

Query: 189 IMSASEACDWGVVDKVLMSR 208
            ++A++A ++G+VD+V+  R
Sbjct: 182 FLTANDAKEFGLVDRVIDKR 201


>gi|323139086|ref|ZP_08074144.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Methylocystis
           sp. ATCC 49242]
 gi|322395650|gb|EFX98193.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Methylocystis
           sp. ATCC 49242]
          Length = 210

 Score =  310 bits (793), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 139/199 (69%), Positives = 174/199 (87%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           L+P V+E T+RGER +DIYSRLL+ERI+FVTG IEDHMA++I AQLLFLE+ENP+KEISL
Sbjct: 12  LIPQVIENTSRGERGFDIYSRLLRERIIFVTGPIEDHMASVIIAQLLFLESENPKKEISL 71

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G+AIYDTMQFIKP +ST C+GQAASMGSLLL AG  G+R+ALPNAR++L
Sbjct: 72  YINSPGGVVTSGLAIYDTMQFIKPKVSTLCVGQAASMGSLLLCAGADGLRYALPNARVML 131

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGGF GQASDI+RHA+DI+K+K+RLN+IYV++ GK Y+ +E+TLDRDH MSA EA  
Sbjct: 132 HQPSGGFQGQASDIQRHAEDILKVKKRLNDIYVRHTGKDYDTIERTLDRDHFMSAEEAKS 191

Query: 198 WGVVDKVLMSRIDIEEKSK 216
           +G++D V   R + E ++K
Sbjct: 192 FGIIDSVQEKRAEDETEAK 210


>gi|217979044|ref|YP_002363191.1| Endopeptidase Clp [Methylocella silvestris BL2]
 gi|217504420|gb|ACK51829.1| Endopeptidase Clp [Methylocella silvestris BL2]
          Length = 215

 Score =  309 bits (792), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 171/193 (88%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           L+P V+E T+RGER +DIYSRLL+ERI+F+TG +EDHMA++I AQLLFLEAENP+KEIS+
Sbjct: 14  LIPQVIENTSRGERGFDIYSRLLRERIIFLTGPVEDHMASVIIAQLLFLEAENPKKEISM 73

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVTAG+AIYDTMQFI+P +ST C+GQAASMGSLLL AGE G RFALPNARI++
Sbjct: 74  YINSPGGVVTAGLAIYDTMQFIRPKVSTLCVGQAASMGSLLLCAGEAGQRFALPNARIMV 133

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGGF GQASDI RHA+DI+K+KRRLN+IYVK+ G+ Y+ +EKTLDRDH MS+ +A +
Sbjct: 134 HQPSGGFQGQASDILRHAEDIMKVKRRLNDIYVKHTGRDYDTIEKTLDRDHFMSSDDARE 193

Query: 198 WGVVDKVLMSRID 210
           +G+VD V+  R D
Sbjct: 194 FGIVDSVISQRPD 206


>gi|118590047|ref|ZP_01547451.1| ATP-dependent Clp protease proteolytic subunit [Stappia aggregata
           IAM 12614]
 gi|118437544|gb|EAV44181.1| ATP-dependent Clp protease proteolytic subunit [Stappia aggregata
           IAM 12614]
          Length = 211

 Score =  309 bits (792), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 138/201 (68%), Positives = 179/201 (89%), Gaps = 1/201 (0%)

Query: 9   KDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           KD  D+++  LVPMVVEQTNRGER++DIYSRLLKERI+F+TG +EDHMATL+ AQLL+LE
Sbjct: 2   KDPVDIYMNTLVPMVVEQTNRGERAFDIYSRLLKERIIFLTGPVEDHMATLVSAQLLYLE 61

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP KEI++YINSPGG+VT+G+AIYDTMQFI+P +ST C+GQAASMGSLLL+AGEKGMR
Sbjct: 62  AENPSKEIAIYINSPGGLVTSGLAIYDTMQFIRPAVSTLCIGQAASMGSLLLAAGEKGMR 121

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           + LPNAR+++HQPSGGF GQA+DI  HAQ+I+ +KRRLN+IYVK+ G+T ++VE+ L+RD
Sbjct: 122 YILPNARVMVHQPSGGFRGQAADIMLHAQEILAMKRRLNDIYVKHTGRTLDQVEEALERD 181

Query: 188 HIMSASEACDWGVVDKVLMSR 208
           + M+A +A ++G+VDKV+  R
Sbjct: 182 NFMTAEKAKEFGIVDKVITDR 202


>gi|299135043|ref|ZP_07028234.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Afipia sp.
           1NLS2]
 gi|298590020|gb|EFI50224.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Afipia sp.
           1NLS2]
          Length = 210

 Score =  309 bits (791), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 137/200 (68%), Positives = 176/200 (88%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+F+TG +ED M+TL+ AQLLFLEA
Sbjct: 2   RDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFLTGPVEDGMSTLVVAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEIS+YINSPGGVVT+G+AIYDTMQFI+PP+ST C GQAASMGSLLL+AGEK MRF
Sbjct: 62  ENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVSTLCTGQAASMGSLLLAAGEKDMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           +LPN+RI++HQPSGGF GQA+DI  HAQ+I+ +K+RLNEIYVK+ G+ Y+ +E  L+RD+
Sbjct: 122 SLPNSRIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVKHTGQDYKTIEDALERDN 181

Query: 189 IMSASEACDWGVVDKVLMSR 208
            ++A +A D+G+VDKV+  R
Sbjct: 182 FLTADKAKDFGIVDKVIDKR 201


>gi|182679147|ref|YP_001833293.1| endopeptidase Clp [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182635030|gb|ACB95804.1| Endopeptidase Clp [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 217

 Score =  308 bits (790), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 138/193 (71%), Positives = 171/193 (88%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           L+P V+E T+RGER +DIYSRLL+ERI+F+TGQ+ED+MA++I AQLLFLEAENP+KEIS+
Sbjct: 16  LIPQVIENTSRGERGFDIYSRLLRERIIFLTGQVEDNMASVIIAQLLFLEAENPKKEISM 75

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVTAG+AIYDTMQFI+P +ST C+GQAASMGSLLL AGE GMR+A PN+RI++
Sbjct: 76  YINSPGGVVTAGLAIYDTMQFIRPKVSTLCVGQAASMGSLLLCAGEAGMRYATPNSRIMV 135

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGGFSGQASDI RHA+DI+K+KRRLNEIYVK+ G+ Y+ +E TLDRDH MSA E  +
Sbjct: 136 HQPSGGFSGQASDILRHAEDIMKVKRRLNEIYVKHTGRDYDTIETTLDRDHFMSAQETKE 195

Query: 198 WGVVDKVLMSRID 210
           +G++D V+  R D
Sbjct: 196 FGIIDNVIDKRPD 208


>gi|75676090|ref|YP_318511.1| peptidase S14, ClpP [Nitrobacter winogradskyi Nb-255]
 gi|90101410|sp|Q3SRD2|CLPP_NITWN RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|74420960|gb|ABA05159.1| ATP-dependent Clp protease proteolytic subunit ClpP [Nitrobacter
           winogradskyi Nb-255]
          Length = 212

 Score =  308 bits (789), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 174/200 (87%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+FVTG +ED+M+ L+ AQLLFLEA
Sbjct: 2   RDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVTGGVEDNMSMLVVAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEIS+YINSPGGVVT+G+AIYDTMQFI+PP++T C GQAASMGSLLL+AGEK MR 
Sbjct: 62  ENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVATLCTGQAASMGSLLLAAGEKDMRH 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           ALPNARI++HQPSGGF GQA+DI  HAQ+I+ +K+RLNEIYVK+ G+TY+ +E  L+RD 
Sbjct: 122 ALPNARIMVHQPSGGFQGQATDIMLHAQEILSLKKRLNEIYVKHTGQTYQAIEDALERDK 181

Query: 189 IMSASEACDWGVVDKVLMSR 208
            ++A  A D+G+VDKV+  R
Sbjct: 182 FLTADMARDFGIVDKVIDKR 201


>gi|85716433|ref|ZP_01047405.1| peptidase S14, ClpP [Nitrobacter sp. Nb-311A]
 gi|85696790|gb|EAQ34676.1| peptidase S14, ClpP [Nitrobacter sp. Nb-311A]
          Length = 212

 Score =  308 bits (789), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 173/200 (86%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+FVTG +ED M+ L+ AQLLFLEA
Sbjct: 2   RDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVTGPVEDTMSMLVVAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEIS+YINSPGGVVT+G+AIYDTMQFI+PP++T C GQAASMGSLLL+AGEK MR 
Sbjct: 62  ENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVATLCTGQAASMGSLLLAAGEKDMRH 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           ALPNARI++HQPSGGF GQA+DI  HAQ+I+ +K+RLNEIYVK+ G+TY+ +E  L+RD 
Sbjct: 122 ALPNARIMVHQPSGGFQGQATDIMLHAQEILSLKKRLNEIYVKHTGQTYQAIEDALERDK 181

Query: 189 IMSASEACDWGVVDKVLMSR 208
            ++A  A D+G+VDKV+  R
Sbjct: 182 FLTADMARDFGIVDKVIDKR 201


>gi|39936026|ref|NP_948302.1| endopeptidase Clp [Rhodopseudomonas palustris CGA009]
 gi|192291681|ref|YP_001992286.1| Endopeptidase Clp [Rhodopseudomonas palustris TIE-1]
 gi|67460293|sp|Q6N5L3|CLPP_RHOPA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|226706467|sp|B3Q7P5|CLPP_RHOPT RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|39649880|emb|CAE28402.1| ATP-dependent Clp protease proteolytic subunit [Rhodopseudomonas
           palustris CGA009]
 gi|192285430|gb|ACF01811.1| Endopeptidase Clp [Rhodopseudomonas palustris TIE-1]
          Length = 212

 Score =  307 bits (786), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 173/200 (86%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+FVTG +ED M+TLI AQLLFLEA
Sbjct: 2   RDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVTGPVEDGMSTLIVAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEIS+YINSPGGVVT+G+AIYDTMQFI+PP+ST C GQAASMGSLLL+AG K MRF
Sbjct: 62  ENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVSTLCTGQAASMGSLLLAAGHKDMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           +LPNARI++HQPSGGF GQA+DI  HAQ+I+ +K+RLNEIYV + G+TY+ +E  L+RD 
Sbjct: 122 SLPNARIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVHHTGQTYKAIEDALERDK 181

Query: 189 IMSASEACDWGVVDKVLMSR 208
            ++A  A ++G+VDKV+  R
Sbjct: 182 FLTAEMAREFGIVDKVIEKR 201


>gi|254469734|ref|ZP_05083139.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Pseudovibrio
           sp. JE062]
 gi|211961569|gb|EEA96764.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Pseudovibrio
           sp. JE062]
          Length = 211

 Score =  306 bits (785), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 172/191 (90%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQTNRGER+YDI+SRLLKERI+F+TG +ED MATL+C+QLL+LEAENP KEI+L
Sbjct: 12  LVPMVVEQTNRGERAYDIFSRLLKERIIFLTGPVEDTMATLVCSQLLYLEAENPNKEIAL 71

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G+AIYDTMQFI+P IST C+GQAASMGSLLL+AGEKGMRF+LPN+R+++
Sbjct: 72  YINSPGGVVTSGLAIYDTMQFIRPKISTLCIGQAASMGSLLLAAGEKGMRFSLPNSRVMV 131

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGGF GQA+DI  HAQ+I+K+KRRLNEIYV + G+T E VE+ L+RD+ MSA  A +
Sbjct: 132 HQPSGGFRGQAADIMLHAQEILKLKRRLNEIYVSHTGQTLEAVEEALERDNFMSADAAKE 191

Query: 198 WGVVDKVLMSR 208
           +G++D V+ +R
Sbjct: 192 FGLIDNVIENR 202


>gi|92117752|ref|YP_577481.1| endopeptidase Clp [Nitrobacter hamburgensis X14]
 gi|116243151|sp|Q1QL76|CLPP_NITHX RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|91800646|gb|ABE63021.1| ATP-dependent Clp protease proteolytic subunit ClpP [Nitrobacter
           hamburgensis X14]
          Length = 211

 Score =  306 bits (784), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 137/200 (68%), Positives = 174/200 (87%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+FVTG +ED+M+ L+ AQLLFLEA
Sbjct: 2   RDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVTGPVEDNMSMLVVAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           +NP+KEIS+YINSPGGVVT+G+AIYDTMQFI+PP++T C GQAASMGSLLL+AGEK MR 
Sbjct: 62  DNPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVATLCTGQAASMGSLLLAAGEKDMRH 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           ALPNARI++HQPSGGF GQA+DI  HAQ+I+ +K+RLNEIYVK+ G+TY+ +E  L+RD 
Sbjct: 122 ALPNARIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVKHTGQTYKAIEDALERDK 181

Query: 189 IMSASEACDWGVVDKVLMSR 208
            ++A  A D+G+VDKV+  R
Sbjct: 182 FLTADMARDFGLVDKVIDKR 201


>gi|86749681|ref|YP_486177.1| endopeptidase Clp [Rhodopseudomonas palustris HaA2]
 gi|116243157|sp|Q2IWZ4|CLPP_RHOP2 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|86572709|gb|ABD07266.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Rhodopseudomonas palustris HaA2]
          Length = 212

 Score =  306 bits (784), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 137/200 (68%), Positives = 173/200 (86%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+F+TG +ED M+TL+ AQLLFLEA
Sbjct: 2   RDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFLTGPVEDGMSTLVVAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEIS+YINSPGGVVT+G+AIYDTMQFI+PP+ST C GQAASMGSLLL+AG K MRF
Sbjct: 62  ENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVSTLCTGQAASMGSLLLAAGHKDMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           +LPNARI++HQPSGGF GQA+DI  HAQ+I+ +K+RLNEIYV + G+TY+ +E  L+RD 
Sbjct: 122 SLPNARIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVHHTGQTYKAIEDALERDK 181

Query: 189 IMSASEACDWGVVDKVLMSR 208
            ++A  A D+G+VDKV+  R
Sbjct: 182 FLTADMARDFGIVDKVIDKR 201


>gi|316933821|ref|YP_004108803.1| endopeptidase Clp [Rhodopseudomonas palustris DX-1]
 gi|315601535|gb|ADU44070.1| Endopeptidase Clp [Rhodopseudomonas palustris DX-1]
          Length = 212

 Score =  306 bits (784), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 173/200 (86%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+FVTG +ED M+TLI AQLLFLEA
Sbjct: 2   RDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVTGPVEDGMSTLIVAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEIS+YINSPGGVVT+G+AIYDTMQFI+PP+ST C GQAASMGSLLL+AG K MRF
Sbjct: 62  ENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVSTLCTGQAASMGSLLLAAGHKDMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           +LPNARI++HQPSGGF GQA+DI  HAQ+I+ +K+RLNEIYV + G+TY+ +E  L+RD 
Sbjct: 122 SLPNARIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVHHTGQTYKAIEDALERDK 181

Query: 189 IMSASEACDWGVVDKVLMSR 208
            ++A  A ++G+VDKV+  R
Sbjct: 182 FLTAEMAREFGIVDKVIDKR 201


>gi|255002920|ref|ZP_05277884.1| ATP-dependent Clp protease proteolytic subunit [Anaplasma marginale
           str. Puerto Rico]
 gi|255004048|ref|ZP_05278849.1| ATP-dependent Clp protease proteolytic subunit [Anaplasma marginale
           str. Virginia]
          Length = 198

 Score =  306 bits (783), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 137/193 (70%), Positives = 175/193 (90%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGER+YDIYSRLLKERI+F+TG +ED+MA+LI AQL+FLEAENP+K+I
Sbjct: 1   MNLVPMVVEQTSRGERAYDIYSRLLKERIIFITGTVEDNMASLIVAQLVFLEAENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGGVVTAG++IYDTMQ+IKP +ST C+GQAASMG+LLL+ GE GMR+ALPN+RI
Sbjct: 61  SLYINSPGGVVTAGLSIYDTMQYIKPKVSTLCLGQAASMGALLLAGGEPGMRYALPNSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGGF GQA+DIE HA++I++IKRRLNEIYVK+ GK+ EE+E +++RD+ M A +A
Sbjct: 121 MVHQPSGGFRGQATDIEIHAREILEIKRRLNEIYVKHTGKSLEEIESSMERDNFMVAEKA 180

Query: 196 CDWGVVDKVLMSR 208
            D+G+VDKV+  R
Sbjct: 181 KDFGIVDKVIDKR 193


>gi|115524517|ref|YP_781428.1| endopeptidase Clp [Rhodopseudomonas palustris BisA53]
 gi|122296222|sp|Q07NN6|CLPP_RHOP5 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|115518464|gb|ABJ06448.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Rhodopseudomonas palustris BisA53]
          Length = 211

 Score =  306 bits (783), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 173/200 (86%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+F+TG +ED M+TL+ AQLLFLEA
Sbjct: 2   RDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFLTGPVEDGMSTLVVAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEIS+YINSPGGVVT+G+AIYDTMQFI+PP+ST C GQAASMGSLLL AG K MRF
Sbjct: 62  ENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVSTLCTGQAASMGSLLLCAGAKDMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           +LPNARI++HQPSGGF GQA+DI  HAQ+I+ +K+RLNEIYVK+ G+TY+ +E  L+RD 
Sbjct: 122 SLPNARIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVKHTGQTYKAIEDALERDK 181

Query: 189 IMSASEACDWGVVDKVLMSR 208
            ++A  A D+G+VDKV+  R
Sbjct: 182 FLTADMARDFGLVDKVIDKR 201


>gi|90423893|ref|YP_532263.1| endopeptidase Clp [Rhodopseudomonas palustris BisB18]
 gi|116243159|sp|Q215J2|CLPP_RHOPB RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|90105907|gb|ABD87944.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Rhodopseudomonas palustris BisB18]
          Length = 210

 Score =  305 bits (781), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 137/200 (68%), Positives = 172/200 (86%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+FVTG +ED M+TL  AQLLFLEA
Sbjct: 2   RDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVTGPVEDGMSTLTVAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEIS+YINSPGGVVT+G+AIYDTMQFI+PP+ST C GQAASMGSLLL+AG   MRF
Sbjct: 62  ENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVSTLCTGQAASMGSLLLAAGHPDMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           +LPN+RI++HQPSGGF GQA+DI  HAQ+I+ +K+RLNEIYVK+ G+TY+ +E  L+RD 
Sbjct: 122 SLPNSRIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVKHTGQTYKAIEDALERDK 181

Query: 189 IMSASEACDWGVVDKVLMSR 208
            ++A  A D+G+VDKV+  R
Sbjct: 182 FLTADMARDFGIVDKVIDKR 201


>gi|298292194|ref|YP_003694133.1| ATP-dependent Clp protease proteolytic subunit ClpP [Starkeya
           novella DSM 506]
 gi|296928705|gb|ADH89514.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Starkeya
           novella DSM 506]
          Length = 210

 Score =  305 bits (781), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 174/203 (85%), Gaps = 1/203 (0%)

Query: 9   KDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           +D  D ++  LVPMVVEQTNRGERSYDIYSRLLKERI+F+TG +ED+MATL+ AQLLFLE
Sbjct: 2   RDPIDTYMNYLVPMVVEQTNRGERSYDIYSRLLKERIIFLTGPVEDNMATLMVAQLLFLE 61

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEIS+YINSPGGVVT+G+AIYDTMQFIKP +ST C+GQAASMGSLLL+AGEKGMR
Sbjct: 62  AENPKKEISMYINSPGGVVTSGLAIYDTMQFIKPAVSTLCIGQAASMGSLLLTAGEKGMR 121

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FALPNARI++HQPSGGF GQ +DI  HAQ+I+ +K+RLNEIYVK+ G+  + VE  L+RD
Sbjct: 122 FALPNARIMVHQPSGGFQGQVTDIMLHAQEILSLKKRLNEIYVKHTGQDLKAVEDALERD 181

Query: 188 HIMSASEACDWGVVDKVLMSRID 210
           + M++  A  +G++D V+  R D
Sbjct: 182 NFMTSDNAKSFGLIDNVIDKRPD 204


>gi|254994793|ref|ZP_05276983.1| ATP-dependent Clp protease proteolytic subunit [Anaplasma marginale
           str. Mississippi]
          Length = 207

 Score =  305 bits (781), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 137/194 (70%), Positives = 175/194 (90%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
            + LVPMVVEQT+RGER+YDIYSRLLKERI+F+TG +ED+MA+LI AQL+FLEAENP+K+
Sbjct: 9   IMNLVPMVVEQTSRGERAYDIYSRLLKERIIFITGTVEDNMASLIVAQLVFLEAENPEKD 68

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           ISLYINSPGGVVTAG++IYDTMQ+IKP +ST C+GQAASMG+LLL+ GE GMR+ALPN+R
Sbjct: 69  ISLYINSPGGVVTAGLSIYDTMQYIKPKVSTLCLGQAASMGALLLAGGEPGMRYALPNSR 128

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           I++HQPSGGF GQA+DIE HA++I++IKRRLNEIYVK+ GK+ EE+E +++RD+ M A +
Sbjct: 129 IMVHQPSGGFRGQATDIEIHAREILEIKRRLNEIYVKHTGKSLEEIESSMERDNFMVAEK 188

Query: 195 ACDWGVVDKVLMSR 208
           A D+G+VDKV+  R
Sbjct: 189 AKDFGIVDKVIDKR 202


>gi|91977364|ref|YP_570023.1| endopeptidase Clp [Rhodopseudomonas palustris BisB5]
 gi|123721781|sp|Q135W7|CLPP_RHOPS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|91683820|gb|ABE40122.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Rhodopseudomonas palustris BisB5]
          Length = 214

 Score =  305 bits (781), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 173/200 (86%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+F+TG +ED M+TL+ AQLLFLEA
Sbjct: 2   RDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFLTGPVEDGMSTLVVAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEIS+YINSPGGVVT+G+AIYDTMQFI+PP+ST C GQAASMGSLLL+AG K MRF
Sbjct: 62  ENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVSTLCTGQAASMGSLLLAAGHKDMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           +LPNARI++HQPSGGF GQA+DI  HAQ+I+ +K+RLNEIYV + G+TY+ +E  L+RD 
Sbjct: 122 SLPNARIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVHHTGQTYKAIEDALERDK 181

Query: 189 IMSASEACDWGVVDKVLMSR 208
            ++A  A ++G+VDKV+  R
Sbjct: 182 FLTAEMAREFGIVDKVIDKR 201


>gi|254504144|ref|ZP_05116295.1| Clp protease [Labrenzia alexandrii DFL-11]
 gi|222440215|gb|EEE46894.1| Clp protease [Labrenzia alexandrii DFL-11]
          Length = 213

 Score =  305 bits (781), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 139/211 (65%), Positives = 182/211 (86%), Gaps = 3/211 (1%)

Query: 9   KDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           KD  D+++  LVPMVVEQTNRGER++DIYSRLLKERI+F+TG +EDHMATL+ AQLL+LE
Sbjct: 2   KDPVDIYMNTLVPMVVEQTNRGERAFDIYSRLLKERIIFLTGPVEDHMATLVSAQLLYLE 61

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           A+NP KEI++YINSPGG+VT+G+AIYDTMQFI+P +ST C+GQAASMGSLLL+AGEK MR
Sbjct: 62  ADNPSKEIAIYINSPGGLVTSGLAIYDTMQFIRPSVSTLCIGQAASMGSLLLAAGEKDMR 121

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F LPNAR+++HQPSGGF GQA+DI  HAQ+I+ +KRRLNEIYVK+ G++ ++VE+ L+RD
Sbjct: 122 FILPNARVMVHQPSGGFRGQAADIMLHAQEILAMKRRLNEIYVKHTGRSLDQVEEALERD 181

Query: 188 HIMSASEACDWGVVDKVLMSRIDI--EEKSK 216
           + M+A +A ++G+VD V+  R  +  E +SK
Sbjct: 182 NFMTAEKAKEFGIVDSVITDRTSLGGENESK 212


>gi|56416580|ref|YP_153654.1| ATP-dependent Clp protease proteolytic subunit [Anaplasma marginale
           str. St. Maries]
 gi|222474947|ref|YP_002563362.1| ATP-dependent clp protease proteolytic subunit (clpP) [Anaplasma
           marginale str. Florida]
 gi|67460191|sp|Q5PBD0|CLPP_ANAMM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|254763783|sp|B9KHZ4|CLPP_ANAMF RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|56387812|gb|AAV86399.1| ATP-dependent clp protease proteolytic subunit [Anaplasma marginale
           str. St. Maries]
 gi|222419083|gb|ACM49106.1| ATP-dependent clp protease proteolytic subunit (clpP) [Anaplasma
           marginale str. Florida]
          Length = 215

 Score =  305 bits (780), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 176/197 (89%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E   + LVPMVVEQT+RGER+YDIYSRLLKERI+F+TG +ED+MA+LI AQL+FLEAENP
Sbjct: 14  EREIMNLVPMVVEQTSRGERAYDIYSRLLKERIIFITGTVEDNMASLIVAQLVFLEAENP 73

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
           +K+ISLYINSPGGVVTAG++IYDTMQ+IKP +ST C+GQAASMG+LLL+ GE GMR+ALP
Sbjct: 74  EKDISLYINSPGGVVTAGLSIYDTMQYIKPKVSTLCLGQAASMGALLLAGGEPGMRYALP 133

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+RI++HQPSGGF GQA+DIE HA++I++IKRRLNEIYVK+ GK+ EE+E +++RD+ M 
Sbjct: 134 NSRIMVHQPSGGFRGQATDIEIHAREILEIKRRLNEIYVKHTGKSLEEIESSMERDNFMV 193

Query: 192 ASEACDWGVVDKVLMSR 208
           A +A D+G+VDKV+  R
Sbjct: 194 AEKAKDFGIVDKVIDKR 210


>gi|269959005|ref|YP_003328794.1| ATP-dependent Clp protease proteolytic subunit [Anaplasma centrale
           str. Israel]
 gi|269848836|gb|ACZ49480.1| ATP-dependent Clp protease proteolytic subunit [Anaplasma centrale
           str. Israel]
          Length = 215

 Score =  305 bits (780), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 137/194 (70%), Positives = 175/194 (90%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
            + LVPMVVEQT+RGER+YDIYSRLLKERI+F+TG +ED+MA+LI AQL+FLEAENP+K+
Sbjct: 17  IMNLVPMVVEQTSRGERAYDIYSRLLKERIIFITGTVEDNMASLIVAQLVFLEAENPEKD 76

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           ISLYINSPGGVVTAG++IYDTMQ+IKP +ST C+GQAASMG+LLL+ GE GMR+ALPN+R
Sbjct: 77  ISLYINSPGGVVTAGLSIYDTMQYIKPKVSTLCLGQAASMGALLLAGGEPGMRYALPNSR 136

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           I++HQPSGGF GQA+DIE HA++I++IKRRLNEIYVK+ GK+ EE+E +++RD+ M A +
Sbjct: 137 IMVHQPSGGFRGQATDIEIHAREILEIKRRLNEIYVKHTGKSLEEIESSMERDNFMVAEK 196

Query: 195 ACDWGVVDKVLMSR 208
           A D+G+VDKV+  R
Sbjct: 197 AKDFGIVDKVIDKR 210


>gi|114771109|ref|ZP_01448549.1| Protease subunit of ATP-dependent Clp protease [alpha
           proteobacterium HTCC2255]
 gi|114548391|gb|EAU51277.1| Protease subunit of ATP-dependent Clp protease [alpha
           proteobacterium HTCC2255]
          Length = 204

 Score =  305 bits (780), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 138/193 (71%), Positives = 171/193 (88%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQT+RGERS+DI+SRLLKERI+FV+G + D M+TLI AQLLFLEAENP+K+IS+
Sbjct: 12  LVPMVVEQTSRGERSFDIFSRLLKERIIFVSGPVHDGMSTLIVAQLLFLEAENPKKDISM 71

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVTAGMAIYDTMQ+I+P +ST C+GQAASMGSLLL+AGEKGMRFALPNAR+++
Sbjct: 72  YINSPGGVVTAGMAIYDTMQYIRPKVSTLCVGQAASMGSLLLAAGEKGMRFALPNARVMV 131

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGGFSGQASDI  HA++I+++K RLN+IYVK+C +    VE  LDRD+ M+A EA D
Sbjct: 132 HQPSGGFSGQASDIALHAKEILELKDRLNKIYVKHCSQKLSTVEDALDRDNFMTAEEAKD 191

Query: 198 WGVVDKVLMSRID 210
           WG++D+++  R D
Sbjct: 192 WGLIDEIVQKRED 204


>gi|328543681|ref|YP_004303790.1| ATP-dependent Clp protease proteolytic subunit [Polymorphum gilvum
           SL003B-26A1]
 gi|326413425|gb|ADZ70488.1| ATP-dependent Clp protease proteolytic subunit [Polymorphum gilvum
           SL003B-26A1]
          Length = 211

 Score =  304 bits (778), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 138/201 (68%), Positives = 176/201 (87%), Gaps = 1/201 (0%)

Query: 9   KDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           KD  ++F   LVPMVVEQTNRGER++DIYSRLLKERI+F+TG IED +ATL+CAQLL+LE
Sbjct: 2   KDPVELFTNTLVPMVVEQTNRGERAFDIYSRLLKERIIFLTGPIEDQLATLVCAQLLYLE 61

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP KEI+LYINSPGG+VT+G+AIYDTMQFI+P +ST C+GQAASMGSLLL+AG+KGMR
Sbjct: 62  AENPNKEIALYINSPGGLVTSGLAIYDTMQFIRPEVSTLCIGQAASMGSLLLAAGQKGMR 121

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPNAR+++HQPSGGF GQA+DI  HAQ+I+K+KRRLN+IYVK+ G++ + VE+ L+RD
Sbjct: 122 FSLPNARVMVHQPSGGFRGQAADIMLHAQEILKLKRRLNDIYVKHTGQSLDSVEEALERD 181

Query: 188 HIMSASEACDWGVVDKVLMSR 208
           + M+A  A  +G+VD V+  R
Sbjct: 182 NFMTADMAKGFGIVDSVISDR 202


>gi|83858431|ref|ZP_00951953.1| ATP-dependent Clp protease, proteolytic subunit [Oceanicaulis
           alexandrii HTCC2633]
 gi|83853254|gb|EAP91106.1| ATP-dependent Clp protease, proteolytic subunit [Oceanicaulis
           alexandrii HTCC2633]
          Length = 207

 Score =  303 bits (776), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 171/200 (85%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           ++ +DV + LVPMVVEQ+ RGER+YDIYSRLLKERIVFVTG IEDHMA+L+ AQLLFLE+
Sbjct: 2   REPQDVMMNLVPMVVEQSARGERAYDIYSRLLKERIVFVTGPIEDHMASLMVAQLLFLES 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP KEI++YINSPGG V+AG+AIYDTMQ+I  P++T C+G AASMGSLLL+AG+KGMRF
Sbjct: 62  ENPNKEIAMYINSPGGSVSAGLAIYDTMQYISCPVATACVGMAASMGSLLLTAGDKGMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           A PNARI+LHQPSGGF G  +DIERH +DI+KIKRR+NEIYVK+ G+  E+VEKTLDRD 
Sbjct: 122 ATPNARIMLHQPSGGFRGTTADIERHGEDILKIKRRMNEIYVKHTGQPLEKVEKTLDRDF 181

Query: 189 IMSASEACDWGVVDKVLMSR 208
            M A EA ++G++D V   R
Sbjct: 182 YMDAMEAKEFGLIDHVYEKR 201


>gi|73666834|ref|YP_302850.1| ATP-dependent Clp protease proteolytic subunit ClpP [Ehrlichia
           canis str. Jake]
 gi|108935919|sp|Q3YSQ3|CLPP_EHRCJ RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|72393975|gb|AAZ68252.1| ATP-dependent Clp protease proteolytic subunit ClpP [Ehrlichia
           canis str. Jake]
          Length = 200

 Score =  302 bits (774), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 137/200 (68%), Positives = 174/200 (87%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGER+YDIYSRLLKERI+F+TG IED MA+L+ AQL+FLEAENP+KEI
Sbjct: 1   MTLVPMVVEQTSRGERAYDIYSRLLKERIIFITGPIEDQMASLVVAQLVFLEAENPEKEI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGGVVTAG++IYDTMQ+IKP +ST C+GQAASMGSLLL+AGE GMR+ALPN+RI
Sbjct: 61  CMYINSPGGVVTAGLSIYDTMQYIKPKVSTLCLGQAASMGSLLLAAGEPGMRYALPNSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGGF GQA+DIE HA++I+ IK RLN+IYVK+ G+   EV   ++RD+ M A +A
Sbjct: 121 MIHQPSGGFQGQATDIEIHAKEILDIKSRLNDIYVKHTGRDLPEVVANMERDNFMRAEKA 180

Query: 196 CDWGVVDKVLMSRIDIEEKS 215
            D+G++DKV+  R+DIEE +
Sbjct: 181 KDFGIIDKVIEKRLDIEESN 200


>gi|154247518|ref|YP_001418476.1| endopeptidase Clp [Xanthobacter autotrophicus Py2]
 gi|226706559|sp|A7ILC6|CLPP_XANP2 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|154161603|gb|ABS68819.1| Endopeptidase Clp [Xanthobacter autotrophicus Py2]
          Length = 211

 Score =  302 bits (773), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 173/201 (86%), Gaps = 1/201 (0%)

Query: 9   KDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           +D  D ++  L+PMVVEQTNRGERSYDI+SRLLKERI+F+TG +ED M+TL  AQLLFLE
Sbjct: 2   RDPVDTYMNYLIPMVVEQTNRGERSYDIFSRLLKERIIFLTGPVEDGMSTLAVAQLLFLE 61

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           A+NP+KEIS+YINSPGGVVT+G+AIYDTMQFIKP +ST C+GQAASMGSLLL+AGEK MR
Sbjct: 62  ADNPKKEISMYINSPGGVVTSGLAIYDTMQFIKPAVSTLCIGQAASMGSLLLTAGEKDMR 121

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FALPNARI++HQPSGGF GQ +DI  HAQ+I+ +KRRLNEIYVK+ G++ +++E  L+RD
Sbjct: 122 FALPNARIMVHQPSGGFQGQVTDIMLHAQEILNLKRRLNEIYVKHTGRSMDKIEDALERD 181

Query: 188 HIMSASEACDWGVVDKVLMSR 208
           + M+A  A D+G++D V+  R
Sbjct: 182 NFMTAKAALDFGLIDAVIDQR 202


>gi|329890026|ref|ZP_08268369.1| clp protease family protein [Brevundimonas diminuta ATCC 11568]
 gi|328845327|gb|EGF94891.1| clp protease family protein [Brevundimonas diminuta ATCC 11568]
          Length = 213

 Score =  302 bits (773), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 137/196 (69%), Positives = 167/196 (85%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQ++RGERS+DI+SRLL+ERI+F+TG  ED MA+LICAQLLFLE+ENP+KEIS+
Sbjct: 12  LVPMVVEQSSRGERSFDIFSRLLRERIIFLTGPFEDGMASLICAQLLFLESENPKKEISM 71

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VT+ +AIYDTMQ+IK P+ST  MG AAS GSL+L+AGE G R ALPNAR+++
Sbjct: 72  YINSPGGQVTSALAIYDTMQYIKSPVSTVVMGMAASAGSLILTAGEAGQRIALPNARVMV 131

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGGF G ASDIERHA+DI+  KRRLNEIYV++ G+TYEEVE+TLDRDH M+A EA  
Sbjct: 132 HQPSGGFRGTASDIERHAEDIIATKRRLNEIYVQHTGRTYEEVERTLDRDHFMTAEEAKA 191

Query: 198 WGVVDKVLMSRIDIEE 213
           WG+VD V   R   ++
Sbjct: 192 WGIVDHVYDKRTQADD 207


>gi|197105280|ref|YP_002130657.1| ATP-dependent Clp protease, proteolytic subunit [Phenylobacterium
           zucineum HLK1]
 gi|196478700|gb|ACG78228.1| ATP-dependent Clp protease, proteolytic subunit [Phenylobacterium
           zucineum HLK1]
          Length = 205

 Score =  301 bits (772), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 139/200 (69%), Positives = 168/200 (84%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D     LGLVPMVVEQT+RGER+YDI+SRLLK+RIVF+ G +ED MA+LICAQLL LEA
Sbjct: 2   RDPVTTALGLVPMVVEQTSRGERAYDIFSRLLKDRIVFLAGPVEDGMASLICAQLLHLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEI +YINSPGGVVT+G+AIYDTMQ+IK P+ T C+G AASMGS LL AGEKG R 
Sbjct: 62  ENPKKEIQMYINSPGGVVTSGLAIYDTMQYIKSPVITLCLGMAASMGSFLLMAGEKGQRI 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           ALPN+RI++HQPSGG+SG+A+DI+RHA+DI+K KRRLNEIY K+ G+  E VE+TLDRD 
Sbjct: 122 ALPNSRIMVHQPSGGYSGKATDIQRHAEDIIKTKRRLNEIYAKHTGQPIEAVEETLDRDF 181

Query: 189 IMSASEACDWGVVDKVLMSR 208
            M+A EA DWG+VD V   R
Sbjct: 182 FMTAQEAKDWGLVDHVWEKR 201


>gi|148255923|ref|YP_001240508.1| ATP-dependent Clp protease proteolytic subunit ClpP [Bradyrhizobium
           sp. BTAi1]
 gi|166201801|sp|A5EKA8|CLPP_BRASB RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|146408096|gb|ABQ36602.1| ATP-dependent Clp protease proteolytic subunit ClpP [Bradyrhizobium
           sp. BTAi1]
          Length = 210

 Score =  301 bits (771), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 135/200 (67%), Positives = 172/200 (86%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+FVTG +ED MATLI AQLLFLEA
Sbjct: 2   RDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVTGPVEDGMATLIVAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEI++YINSPGGVVT+G+AIYDTMQFI+P +ST C GQAASMGSLLL AG K MRF
Sbjct: 62  ENPKKEIAMYINSPGGVVTSGLAIYDTMQFIRPAVSTLCTGQAASMGSLLLCAGHKDMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           +LPN+RI++HQPSGGF GQA+DI  HAQ+I+ +K+RLNEIYVK+ G++Y+ +E  L+RD 
Sbjct: 122 SLPNSRIMVHQPSGGFQGQATDIMLHAQEILSLKKRLNEIYVKHTGQSYKAIEDALERDK 181

Query: 189 IMSASEACDWGVVDKVLMSR 208
            ++A  A ++G++DKV+  R
Sbjct: 182 FLTAEAAAEFGLIDKVIDKR 201


>gi|57238933|ref|YP_180069.1| ATP-dependent Clp protease proteolytic subunit [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58578866|ref|YP_197078.1| ATP-dependent Clp protease proteolytic subunit [Ehrlichia
           ruminantium str. Welgevonden]
 gi|67460160|sp|Q5HBX5|CLPP_EHRRW RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|57161012|emb|CAH57918.1| ATP-dependent Clp protease proteolytic subunit [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58417492|emb|CAI26696.1| ATP-dependent CLP protease proteolytic subunit [Ehrlichia
           ruminantium str. Welgevonden]
          Length = 198

 Score =  300 bits (769), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 173/197 (87%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGER+YDIYSRLLKERI+F+TG IED MA+L+ AQL+FLEAENP+K+I
Sbjct: 1   MTLVPMVVEQTSRGERAYDIYSRLLKERIIFITGPIEDQMASLVVAQLIFLEAENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S+YINSPGGVVTAG++IYDTMQ++KP I+T C+GQAASMGSLLL+AGEKGMR ALPN+RI
Sbjct: 61  SMYINSPGGVVTAGLSIYDTMQYVKPRIATLCLGQAASMGSLLLAAGEKGMRCALPNSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGGF GQA+DIE HA++I+ IK RLN IYVK+ G+   EV  +++RD+ MSA  A
Sbjct: 121 MIHQPSGGFQGQATDIEIHAKEILNIKSRLNYIYVKHTGRELSEVVASMERDNFMSADSA 180

Query: 196 CDWGVVDKVLMSRIDIE 212
            D+G++DKV+  R+DI+
Sbjct: 181 QDFGIIDKVIEKRLDID 197


>gi|158423232|ref|YP_001524524.1| ATP-dependent Clp protease proteolytic subunit [Azorhizobium
           caulinodans ORS 571]
 gi|172047856|sp|A8HYF2|CLPP_AZOC5 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|158330121|dbj|BAF87606.1| ATP-dependent Clp protease proteolytic subunit [Azorhizobium
           caulinodans ORS 571]
          Length = 210

 Score =  300 bits (769), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 174/201 (86%), Gaps = 1/201 (0%)

Query: 9   KDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           +D  D ++  LVPMVVEQTNRGER+YDIYSRLLKERI+F+TG +ED M+TL  AQLLFLE
Sbjct: 2   RDPVDTYMNYLVPMVVEQTNRGERAYDIYSRLLKERIIFLTGPVEDGMSTLAVAQLLFLE 61

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEIS+YINSPGGVVT+G+AIYDTMQFI+P +ST C+GQAASMGSLLL+AGEKG+R
Sbjct: 62  AENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPAVSTLCIGQAASMGSLLLTAGEKGLR 121

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FALPNARI++HQPSGGF GQ +DI  HAQ+I+ +K+RLNEIYVK+ G+  E++E  L+RD
Sbjct: 122 FALPNARIMVHQPSGGFQGQVTDIMLHAQEILSLKKRLNEIYVKHTGQPIEKIEDALERD 181

Query: 188 HIMSASEACDWGVVDKVLMSR 208
           + M+A+ A ++G++D V+  R
Sbjct: 182 NFMTANAAQEFGLIDTVIDKR 202


>gi|146341127|ref|YP_001206175.1| ATP-dependent Clp protease proteolytic subunit [Bradyrhizobium sp.
           ORS278]
 gi|146193933|emb|CAL77950.1| ATP-dependent Clp protease proteolytic subunit (Endopeptidase Clp)
           [Bradyrhizobium sp. ORS278]
          Length = 210

 Score =  300 bits (768), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 171/200 (85%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+FVTG +ED MATLI AQLLFLEA
Sbjct: 2   RDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVTGPVEDGMATLIVAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEI++YINSPGGVVT+G+AIYDTMQFI+P +ST C GQAASMGSLLL AG K MRF
Sbjct: 62  ENPKKEIAMYINSPGGVVTSGLAIYDTMQFIRPAVSTLCTGQAASMGSLLLCAGHKDMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           +LPN+RI++HQPSGGF GQA+DI  HAQ+I+ +K+RLNEIYVK+ G+ Y+ +E  L+RD 
Sbjct: 122 SLPNSRIMVHQPSGGFQGQATDIMLHAQEILSLKKRLNEIYVKHTGQPYKAIEDALERDK 181

Query: 189 IMSASEACDWGVVDKVLMSR 208
            ++A  A ++G++DKVL  R
Sbjct: 182 FLTAEAAQEFGLIDKVLDKR 201


>gi|304319808|ref|YP_003853451.1| Protease subunit of ATP-dependent Clp protease [Parvularcula
           bermudensis HTCC2503]
 gi|303298711|gb|ADM08310.1| Protease subunit of ATP-dependent Clp protease [Parvularcula
           bermudensis HTCC2503]
          Length = 210

 Score =  299 bits (766), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 132/201 (65%), Positives = 176/201 (87%), Gaps = 1/201 (0%)

Query: 9   KDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           +D  D+++  LVPMV+EQT+RGERS+DIYSRLLKERI+F++GQ+ D ++TLI AQLLFLE
Sbjct: 2   RDPHDIYMNTLVPMVIEQTSRGERSFDIYSRLLKERIIFLSGQVHDQVSTLIVAQLLFLE 61

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           A+NP+K+I+ YINSPGG VTAG+A+YDTM++I+P IST C+G AASMGSLLL+AG+KGMR
Sbjct: 62  ADNPKKDIAFYINSPGGSVTAGLAMYDTMRYIRPQISTMCVGLAASMGSLLLTAGDKGMR 121

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPN+RI++HQPS GF GQASDIERHA+DI++ K+RLNEIYV++ G+ YE +E+TLDRD
Sbjct: 122 FSLPNSRIMVHQPSAGFQGQASDIERHARDIIQTKKRLNEIYVEHTGQDYETIERTLDRD 181

Query: 188 HIMSASEACDWGVVDKVLMSR 208
             M+  +A D+G++D+VL  R
Sbjct: 182 TFMTPEDALDFGLIDQVLEKR 202


>gi|58616924|ref|YP_196123.1| ATP-dependent Clp protease proteolytic subunit [Ehrlichia
           ruminantium str. Gardel]
 gi|67460150|sp|Q5FFG7|CLPP_EHRRG RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|58416536|emb|CAI27649.1| ATP-dependent CLP protease proteolytic subunit [Ehrlichia
           ruminantium str. Gardel]
          Length = 198

 Score =  298 bits (763), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 135/197 (68%), Positives = 172/197 (87%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVE T+RGER+YDIY+RLLKERI+F+TG IED MA+L+ AQL+FLEAENP+K+I
Sbjct: 1   MTLVPMVVEPTSRGERAYDIYTRLLKERIIFITGPIEDQMASLVVAQLIFLEAENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S+YINSPGGVVTAG++IYDTMQ++KP I+T C+GQAASMGSLLL+AGEKGMR ALPN+RI
Sbjct: 61  SMYINSPGGVVTAGLSIYDTMQYVKPRIATLCLGQAASMGSLLLAAGEKGMRCALPNSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGGF GQA+DIE HA++I+ IK RLN IYVK+ G+   EV  +++RD+ MSA  A
Sbjct: 121 MIHQPSGGFQGQATDIEIHAKEILNIKSRLNYIYVKHTGRELSEVVASMERDNFMSADSA 180

Query: 196 CDWGVVDKVLMSRIDIE 212
            D+G++DKV+  R+DIE
Sbjct: 181 QDFGIIDKVIEKRLDIE 197


>gi|88658316|ref|YP_507695.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Ehrlichia
           chaffeensis str. Arkansas]
 gi|115311357|sp|Q2GFT8|CLPP_EHRCR RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|88599773|gb|ABD45242.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Ehrlichia
           chaffeensis str. Arkansas]
          Length = 199

 Score =  297 bits (761), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 135/196 (68%), Positives = 171/196 (87%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGER+YDIYSRLLKERI+F+TG IED MA+LI AQL+FLE+ENP+KEI
Sbjct: 1   MTLVPMVVEQTSRGERAYDIYSRLLKERIIFITGPIEDQMASLIVAQLIFLESENPEKEI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGGVVTAG++IYDTMQ+IKP +ST C+GQAASMGSLLL+AGE GMR+ALPN+RI
Sbjct: 61  CMYINSPGGVVTAGLSIYDTMQYIKPKVSTLCLGQAASMGSLLLAAGEPGMRYALPNSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGGF GQA+DIE HA++I+ IK RLN+IYVK+ G+   EV   ++RD+ M A +A
Sbjct: 121 MIHQPSGGFQGQATDIEIHAKEILDIKGRLNDIYVKHTGRDLSEVVANMERDNFMRAEKA 180

Query: 196 CDWGVVDKVLMSRIDI 211
            D+G++DKV+  R+DI
Sbjct: 181 KDFGIIDKVIEKRLDI 196


>gi|154253670|ref|YP_001414494.1| endopeptidase Clp [Parvibaculum lavamentivorans DS-1]
 gi|154157620|gb|ABS64837.1| Endopeptidase Clp [Parvibaculum lavamentivorans DS-1]
          Length = 213

 Score =  297 bits (761), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 168/200 (84%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           KD  + ++ LVPMVVEQTNRGER+YDI+SRLLKE I+FV G +ED MA L+ AQLLFLEA
Sbjct: 2   KDPIETYMNLVPMVVEQTNRGERAYDIFSRLLKEHIIFVAGPVEDGMAMLVTAQLLFLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEIS+YINSPGGVVT+G+AIYDTMQ I+PP+ST CMGQAASMGSLLL+AGEKGMRF
Sbjct: 62  ENPKKEISMYINSPGGVVTSGLAIYDTMQHIRPPVSTVCMGQAASMGSLLLAAGEKGMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           ALPNARI++HQPSGGF GQASDIE HA++ + I+ RLN IY K+ G++ + VE  L+RD+
Sbjct: 122 ALPNARIMVHQPSGGFQGQASDIEIHARETIAIRERLNNIYCKHTGQSLKAVEDALERDN 181

Query: 189 IMSASEACDWGVVDKVLMSR 208
            MS   A ++G++D V + R
Sbjct: 182 FMSPERALEFGIIDHVGVDR 201


>gi|307129927|ref|YP_003881943.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Dickeya dadantii 3937]
 gi|306527456|gb|ADM97386.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Dickeya dadantii 3937]
          Length = 207

 Score =  297 bits (760), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 135/208 (64%), Positives = 172/208 (82%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  +K +    + LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYSGEQEKQAPH--MALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GGF GQA+DIE HA++I+K+K R+NE+  K+ G+  E +
Sbjct: 119 AGTKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKARMNELMAKHTGQPLEAI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SA+EA D+G+VD VL  R
Sbjct: 179 ERDTERDRFLSAAEAVDYGLVDSVLTHR 206


>gi|88607298|ref|YP_505537.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Anaplasma
           phagocytophilum HZ]
 gi|115311354|sp|Q2GJB4|CLPP_ANAPZ RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|88598361|gb|ABD43831.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Anaplasma
           phagocytophilum HZ]
          Length = 197

 Score =  296 bits (757), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 134/195 (68%), Positives = 173/195 (88%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT RGER+YDIYSRLLKERI+FVTG IED MA+LI AQL+FLEAE+P+K+I
Sbjct: 1   MNLVPMVVEQTGRGERAYDIYSRLLKERIIFVTGPIEDEMASLIVAQLVFLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S+YINSPGGVVTAG++IYDTMQ+IKP ++T C+GQAASMGSLLL AG  GMR ALPN+R+
Sbjct: 61  SMYINSPGGVVTAGLSIYDTMQYIKPNVATLCLGQAASMGSLLLCAGAPGMRCALPNSRV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGGF GQA+DIE HA++I++IKRRLNEI+V++ GK+ EE+E +++RD+ M A +A
Sbjct: 121 MIHQPSGGFRGQATDIEIHAREILEIKRRLNEIFVRHTGKSLEEIESSMERDNFMIAEKA 180

Query: 196 CDWGVVDKVLMSRID 210
            D+G++DKV+  RI+
Sbjct: 181 RDFGIIDKVIEKRIE 195


>gi|300715591|ref|YP_003740394.1| ATP-dependent Clp protease proteolytic subunit [Erwinia billingiae
           Eb661]
 gi|299061427|emb|CAX58539.1| ATP-dependent Clp protease proteolytic subunit [Erwinia billingiae
           Eb661]
          Length = 215

 Score =  296 bits (757), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 133/208 (63%), Positives = 174/208 (83%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  +++     + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 9   MSYSG--EREQTAPHMALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLIV 66

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTM+FIKP +ST CMGQA SMG+ LL+
Sbjct: 67  AQMLFLEAENPEKDIHLYINSPGGVITAGMSIYDTMKFIKPDVSTICMGQACSMGAFLLT 126

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG R+ALPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+  ++ GKT EE+
Sbjct: 127 AGTKGKRYALPNSRVMIHQPLGGYQGQATDIEIHAREILKVKARMNELMAEHTGKTLEEI 186

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SASEA ++G+VD VL  R
Sbjct: 187 ERDTERDRFLSASEAVEYGLVDSVLTHR 214


>gi|114800297|ref|YP_760784.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Hyphomonas
           neptunium ATCC 15444]
 gi|114740471|gb|ABI78596.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Hyphomonas
           neptunium ATCC 15444]
          Length = 207

 Score =  295 bits (756), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 133/199 (66%), Positives = 176/199 (88%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           L LVPMVVEQT+RGER++DI+SRLLKERI+FVTG I+D +A+LI AQLLFLE+ENP++EI
Sbjct: 9   LNLVPMVVEQTSRGERAFDIFSRLLKERIIFVTGGIDDGIASLITAQLLFLESENPKREI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           ++YINSPGG V++G+AIYDTMQ+++ PIST C+GQAASMGSLLL+AGEKG+R ALPNAR+
Sbjct: 69  AMYINSPGGYVSSGLAIYDTMQYVRCPISTVCIGQAASMGSLLLAAGEKGLRIALPNARV 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           +LHQPSGG+SG A+DIERHA++I+++KRRLN+IYV++ G+ Y+ VE+ LDRD  ++A EA
Sbjct: 129 MLHQPSGGYSGVATDIERHAEEIIELKRRLNDIYVRHTGQEYDVVERKLDRDTFLTAEEA 188

Query: 196 CDWGVVDKVLMSRIDIEEK 214
            ++G+VDKV   R   +EK
Sbjct: 189 MEFGIVDKVYERRTAEDEK 207


>gi|254421111|ref|ZP_05034835.1| Clp protease [Brevundimonas sp. BAL3]
 gi|196187288|gb|EDX82264.1| Clp protease [Brevundimonas sp. BAL3]
          Length = 215

 Score =  295 bits (756), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 137/193 (70%), Positives = 162/193 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQ++RGERS+DI+SRLL+ERI+F+TG  ED MA+LICAQLLFLE+ENP+KEI
Sbjct: 10  MNLVPMVVEQSSRGERSFDIFSRLLRERIIFLTGPFEDTMASLICAQLLFLESENPKKEI 69

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S+YINSPGG V++ +AIYDTMQ+IK P+ST  MG AAS GSL+L+AG  G R ALPNARI
Sbjct: 70  SMYINSPGGQVSSALAIYDTMQYIKSPVSTVVMGMAASAGSLILTAGAAGQRIALPNARI 129

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGGF GQASDIE HA DI   K+RLNEIYV + G+TYEEVEKTLDRDH MSA EA
Sbjct: 130 MVHQPSGGFRGQASDIELHAADIRYTKKRLNEIYVHHTGRTYEEVEKTLDRDHFMSAEEA 189

Query: 196 CDWGVVDKVLMSR 208
             WG+VD V   R
Sbjct: 190 KAWGIVDHVYDKR 202


>gi|254294162|ref|YP_003060185.1| endopeptidase Clp [Hirschia baltica ATCC 49814]
 gi|254042693|gb|ACT59488.1| Endopeptidase Clp [Hirschia baltica ATCC 49814]
          Length = 206

 Score =  295 bits (756), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 133/199 (66%), Positives = 171/199 (85%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           D  +  + LVPMVVEQ++RGER+YDI+SRLLKERI+FVTG IED MATLI AQLLFLE+E
Sbjct: 3   DPIETAMNLVPMVVEQSSRGERAYDIFSRLLKERIIFVTGPIEDGMATLITAQLLFLESE 62

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP+KEIS+YINSPGGVV++G+AIYDTMQ+I  P+ST C+G AASMGSLLL+AGEK MRFA
Sbjct: 63  NPKKEISMYINSPGGVVSSGLAIYDTMQYISAPVSTACIGMAASMGSLLLAAGEKDMRFA 122

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
            PNARI++HQPSGG+ G ASDIERHA++I++IKR LN IYV + G++YE +E+ LDRD  
Sbjct: 123 TPNARIMVHQPSGGYRGVASDIERHAEEILEIKRNLNNIYVNHTGQSYEAIEQKLDRDSF 182

Query: 190 MSASEACDWGVVDKVLMSR 208
           M++++A ++G++D+V   R
Sbjct: 183 MTSAQAVEFGIIDRVFEKR 201


>gi|85058649|ref|YP_454351.1| ATP-dependent Clp protease proteolytic subunit [Sodalis
           glossinidius str. 'morsitans']
 gi|84779169|dbj|BAE73946.1| ATP-dependent Clp protease proteolytic subunit [Sodalis
           glossinidius str. 'morsitans']
          Length = 207

 Score =  295 bits (755), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 135/208 (64%), Positives = 173/208 (83%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--EQDNFAPHMALVPMVVEQTSRGERSYDIFSRLLKERIIFMTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ++FLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +STFCMGQAASMG+ LL+
Sbjct: 59  AQMMFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTFCMGQAASMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GGF GQA+DIE HA++I+K+K R+NE+  K+ G+  E +
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAREILKVKARMNELMAKHTGQPLEVI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SA EA D+G+VD VL  R
Sbjct: 179 ERDTERDRFLSAPEAVDYGLVDSVLSQR 206


>gi|251790648|ref|YP_003005369.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Dickeya zeae
           Ech1591]
 gi|247539269|gb|ACT07890.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Dickeya zeae
           Ech1591]
          Length = 207

 Score =  295 bits (755), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 135/208 (64%), Positives = 172/208 (82%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  +K +    + LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYSGEQEKLAPH--MALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GGF GQA+DIE HA++I+K+K R+NE+  K+ G+  E +
Sbjct: 119 AGTKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKARMNELMAKHTGQPLEMI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SA+EA D+G+VD VL  R
Sbjct: 179 ERDTERDRFLSAAEAVDYGLVDSVLTHR 206


>gi|89070383|ref|ZP_01157690.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Oceanicola
           granulosus HTCC2516]
 gi|89044030|gb|EAR50205.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Oceanicola
           granulosus HTCC2516]
          Length = 209

 Score =  294 bits (753), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 171/199 (85%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           D  + ++ LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D MA+LI AQL+ LEAE
Sbjct: 3   DPIETYMNLVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMASLIVAQLIHLEAE 62

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP+KEIS+YINSPGGVVT+G++IYDTMQ+IKPP+ST  +GQAASMGSLLL+ GEKGMR +
Sbjct: 63  NPKKEISMYINSPGGVVTSGLSIYDTMQYIKPPVSTLVIGQAASMGSLLLAGGEKGMRLS 122

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPN+RI++HQPSGG+ GQA+DI  HA++ +K+KRRLNEIYVK+ G+T ++VE  L+RD+ 
Sbjct: 123 LPNSRIMVHQPSGGYQGQATDIMIHAEETLKLKRRLNEIYVKHTGQTLKKVEAALERDNF 182

Query: 190 MSASEACDWGVVDKVLMSR 208
           MS  EA DWG++D++  +R
Sbjct: 183 MSPEEAKDWGLIDEIFENR 201


>gi|253990891|ref|YP_003042247.1| ATP-dependent Clp protease proteolytic subunit [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253782341|emb|CAQ85505.1| ATP-dependent proteolytic subunit of clpA-ClpP serine protease,
           heat shock protein F21.5 [Photorhabdus asymbiotica]
          Length = 207

 Score =  294 bits (752), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 167/201 (83%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           K+D     + LVPMV+EQT RGERS+DIYSRLLKERI+F+TGQ+EDHMA LI AQ+LFLE
Sbjct: 6   KRDQYVPHMALVPMVIEQTARGERSFDIYSRLLKERIIFLTGQVEDHMANLIVAQMLFLE 65

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+AG +G R
Sbjct: 66  AENPEKDIFLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGAEGKR 125

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F LPN+R+++HQP GGF GQASDIE HAQ+I+K+K R+N +  K+ GK+ EE+EK  +RD
Sbjct: 126 FCLPNSRVMIHQPLGGFQGQASDIEIHAQEILKVKGRMNSLMAKHTGKSLEEIEKDTERD 185

Query: 188 HIMSASEACDWGVVDKVLMSR 208
             +SASEA ++G+VDK+   R
Sbjct: 186 RFLSASEAVEYGLVDKIFTHR 206


>gi|77463765|ref|YP_353269.1| ATP-dependent Clp protease proteolytic subunit [Rhodobacter
           sphaeroides 2.4.1]
 gi|126462595|ref|YP_001043709.1| ATP-dependent Clp protease proteolytic subunit [Rhodobacter
           sphaeroides ATCC 17029]
 gi|221639635|ref|YP_002525897.1| ATP-dependent Clp protease proteolytic subunit [Rhodobacter
           sphaeroides KD131]
 gi|124013827|sp|Q3J1G6|CLPP_RHOS4 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166214702|sp|A3PKS1|CLPP_RHOS1 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|254763798|sp|B9KJU9|CLPP_RHOSK RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|77388183|gb|ABA79368.1| ATP-dependent Clp protease proteolytic subunit ClpP [Rhodobacter
           sphaeroides 2.4.1]
 gi|126104259|gb|ABN76937.1| ATP-dependent Clp protease proteolytic subunit ClpP [Rhodobacter
           sphaeroides ATCC 17029]
 gi|221160416|gb|ACM01396.1| ATP-dependent Clp protease proteolytic subunit [Rhodobacter
           sphaeroides KD131]
          Length = 210

 Score =  294 bits (752), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 133/209 (63%), Positives = 178/209 (85%), Gaps = 1/209 (0%)

Query: 9   KDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           KD  D+++  LVPMVVEQT+RGER+YDIYSR+LKERI+F++G + D M++LICAQLLFLE
Sbjct: 2   KDPIDLYMNTLVPMVVEQTSRGERAYDIYSRMLKERIIFLSGPVHDGMSSLICAQLLFLE 61

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP KEI++YINSPGGVVT+G++IYDTMQ+I+P +ST  +GQAASMGSLLL+AGEKGMR
Sbjct: 62  AENPSKEIAMYINSPGGVVTSGLSIYDTMQYIRPKVSTLVIGQAASMGSLLLTAGEKGMR 121

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPN+R+++HQPSGG+ GQA+DI  HA++  K+KRRLNEIYV++ G+  E VE  L+RD
Sbjct: 122 FSLPNSRVMVHQPSGGYQGQATDIMIHARETEKLKRRLNEIYVRHTGQDLETVEAALERD 181

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           + MSA +A  WG++D++L SR   ++ +K
Sbjct: 182 NFMSAEDAKAWGLIDEILESRNRPDDTAK 210


>gi|302382854|ref|YP_003818677.1| endopeptidase Clp [Brevundimonas subvibrioides ATCC 15264]
 gi|302193482|gb|ADL01054.1| Endopeptidase Clp [Brevundimonas subvibrioides ATCC 15264]
          Length = 213

 Score =  293 bits (751), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 160/191 (83%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQ++RGER++DI+SRLL+ERI+F+TG  ED MA+LICAQLLFLE+ENP+KEIS+
Sbjct: 12  LVPMVVEQSSRGERAFDIFSRLLRERIIFLTGPFEDGMASLICAQLLFLESENPKKEISM 71

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VT+ +AIYDTMQ+IK P+ST  MG AAS GSL+L+AG  G R ALPNARI++
Sbjct: 72  YINSPGGQVTSALAIYDTMQYIKSPVSTVVMGMAASAGSLILTAGAAGQRIALPNARIMV 131

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGGF GQASDIE HA DI   KRRLNEIYV + G+TYEEVEKTLDRDH M A  A +
Sbjct: 132 HQPSGGFRGQASDIELHAADIRYTKRRLNEIYVHHTGRTYEEVEKTLDRDHFMDAEAAKE 191

Query: 198 WGVVDKVLMSR 208
           WG+VD V   R
Sbjct: 192 WGIVDHVYDKR 202


>gi|110816466|sp|Q2NV79|CLPP_SODGM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
          Length = 194

 Score =  293 bits (750), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 131/193 (67%), Positives = 165/193 (85%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI AQ++FLEAENP+K+I
Sbjct: 1   MALVPMVVEQTSRGERSYDIFSRLLKERIIFMTGQVEDHMANLIVAQMMFLEAENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFIKP +STFCMGQAASMG+ LL+AG KG RF LPN+R+
Sbjct: 61  YLYINSPGGVITAGMSIYDTMQFIKPDVSTFCMGQAASMGAFLLAAGAKGKRFCLPNSRV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DIE HA++I+K+K R+NE+  K+ G+  E +E+  +RD  +SA EA
Sbjct: 121 MIHQPLGGFQGQATDIEIHAREILKVKARMNELMAKHTGQPLEVIERDTERDRFLSAPEA 180

Query: 196 CDWGVVDKVLMSR 208
            D+G+VD VL  R
Sbjct: 181 VDYGLVDSVLSQR 193


>gi|296101559|ref|YP_003611705.1| ATP-dependent Clp protease, protease subunit [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
 gi|295056018|gb|ADF60756.1| ATP-dependent Clp protease, protease subunit [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
          Length = 207

 Score =  293 bits (750), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 130/208 (62%), Positives = 175/208 (84%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+  ++ G++ E++
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKARMNELMAQHTGQSLEQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SASEA ++G+VD +L  R
Sbjct: 179 ERDTERDRFLSASEAVEYGLVDSILTHR 206


>gi|260427575|ref|ZP_05781554.1| Clp protease [Citreicella sp. SE45]
 gi|260422067|gb|EEX15318.1| Clp protease [Citreicella sp. SE45]
          Length = 210

 Score =  293 bits (750), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 173/201 (86%), Gaps = 1/201 (0%)

Query: 9   KDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           KD  D ++  LVPMVVEQT+RGER+YDI+SRLLKERI+FV+G + D M++LI AQLL LE
Sbjct: 2   KDPFDTYMNTLVPMVVEQTSRGERAYDIFSRLLKERIIFVSGPVHDGMSSLIVAQLLHLE 61

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP KEIS+YINSPGGVVT+G++IYDTMQ+IKP IST  +GQAASMGSLLL+AGE GMR
Sbjct: 62  AENPAKEISMYINSPGGVVTSGLSIYDTMQYIKPKISTLVIGQAASMGSLLLTAGEAGMR 121

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPN+RI++HQPSGG+ GQA+DI  HA++ +K+KRRLNEIYV++ G+T E+VE  L+RD
Sbjct: 122 FSLPNSRIMVHQPSGGYQGQATDIMIHAEETLKLKRRLNEIYVRHTGQTLEKVEAALERD 181

Query: 188 HIMSASEACDWGVVDKVLMSR 208
           + MS  +A +WG++D+++ SR
Sbjct: 182 NFMSPEDAKEWGLIDEIVESR 202


>gi|304395499|ref|ZP_07377382.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Pantoea sp.
           aB]
 gi|304356793|gb|EFM21157.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Pantoea sp.
           aB]
          Length = 207

 Score =  293 bits (750), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 130/192 (67%), Positives = 166/192 (86%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA LI AQ+LFLEAENP+K+I 
Sbjct: 15  ALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIY 74

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGV+TAGM+IYDTM+FIKP +ST CMGQA SMG+ LL+AG KG RF LPN+R++
Sbjct: 75  LYINSPGGVITAGMSIYDTMKFIKPDVSTICMGQACSMGAFLLTAGTKGKRFCLPNSRVM 134

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG+ GQASDIE HA++I+K+K+R+NE+  ++ GKT EE+E+  +RD  +SASEA 
Sbjct: 135 IHQPLGGYQGQASDIEIHAREILKVKQRMNELMAEHTGKTLEEIERDTERDRFLSASEAV 194

Query: 197 DWGVVDKVLMSR 208
           ++G+VD +L  R
Sbjct: 195 EYGLVDSILTHR 206


>gi|146277488|ref|YP_001167647.1| ATP-dependent Clp protease proteolytic subunit [Rhodobacter
           sphaeroides ATCC 17025]
 gi|166214703|sp|A4WSH8|CLPP_RHOS5 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|145555729|gb|ABP70342.1| Endopeptidase Clp [Rhodobacter sphaeroides ATCC 17025]
          Length = 210

 Score =  293 bits (750), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 178/209 (85%), Gaps = 1/209 (0%)

Query: 9   KDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           KD  D+++  LVPMVVEQT+RGER+YDI+SR+LKERI+F++G + D M++LICAQLLFLE
Sbjct: 2   KDPIDLYMNTLVPMVVEQTSRGERAYDIFSRMLKERIIFLSGPVHDGMSSLICAQLLFLE 61

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP KEI++YINSPGGVVT+G++IYDTMQ+I+P +ST  +GQAASMGSLLL+AGEKGMR
Sbjct: 62  AENPSKEIAMYINSPGGVVTSGLSIYDTMQYIRPKVSTLVIGQAASMGSLLLTAGEKGMR 121

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPN+R+++HQPSGG+ GQA+DI  HA++  K+KRRLNEIYVK+ G+  + VE  L+RD
Sbjct: 122 FSLPNSRVMVHQPSGGYQGQATDIMIHARETEKLKRRLNEIYVKHTGQDLDTVEAALERD 181

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           + MSA +A  WG++D++L SR   ++ +K
Sbjct: 182 NFMSAEDAKAWGLIDEILESRGKTDDTAK 210


>gi|123443342|ref|YP_001007316.1| ATP-dependent Clp protease proteolytic subunit [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|2493738|sp|Q60107|CLPP_YEREN RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166214722|sp|A1JNN2|CLPP_YERE8 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|1377852|gb|AAC45782.1| ClpP [Yersinia enterocolitica]
 gi|122090303|emb|CAL13169.1| ATP-dependent Clp protease proteolytic subunit ClpP [Yersinia
           enterocolitica subsp. enterocolitica 8081]
          Length = 207

 Score =  292 bits (748), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 171/208 (82%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D     + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDQFAPNMALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLIT 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIFLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GGF GQA+DIE HA++I+K+K R+NE+  K+ GK+ EE+
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKSRMNELMAKHTGKSLEEI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SA EA ++G+VD V   R
Sbjct: 179 ERDTERDRFLSADEAVEYGLVDSVFTRR 206


>gi|157146946|ref|YP_001454265.1| hypothetical protein CKO_02723 [Citrobacter koseri ATCC BAA-895]
 gi|157084151|gb|ABV13829.1| hypothetical protein CKO_02723 [Citrobacter koseri ATCC BAA-895]
          Length = 243

 Score =  292 bits (747), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 130/208 (62%), Positives = 174/208 (83%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 37  MSYSG--ERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 94

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 95  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 154

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 155 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 214

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SASEA ++G+VD +L  R
Sbjct: 215 ERDTERDRFLSASEAVEYGLVDSILTHR 242


>gi|237730414|ref|ZP_04560895.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226905953|gb|EEH91871.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 243

 Score =  292 bits (747), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 130/208 (62%), Positives = 174/208 (83%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 37  MSYSG--ERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 94

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 95  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 154

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 155 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 214

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SASEA ++G+VD +L  R
Sbjct: 215 ERDTERDRFLSASEAVEYGLVDSILTHR 242


>gi|332160749|ref|YP_004297326.1| ATP-dependent Clp protease proteolytic subunit [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|318604628|emb|CBY26126.1| ATP-dependent Clp protease proteolytic subunit [Yersinia
           enterocolitica subsp. palearctica Y11]
 gi|325664979|gb|ADZ41623.1| ATP-dependent Clp protease proteolytic subunit [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330859950|emb|CBX70279.1| ATP-dependent Clp protease proteolytic subunit [Yersinia
           enterocolitica W22703]
          Length = 207

 Score =  292 bits (747), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 170/208 (81%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D     + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDQFAPNMALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLIT 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIFLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GGF GQA+DIE HA++I+K+K R+NE+  K+ GK+ EE+
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKSRMNELMAKHTGKSLEEI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SA EA  +G+VD V   R
Sbjct: 179 ERDTERDRFLSADEAVKYGLVDSVFTRR 206


>gi|146310565|ref|YP_001175639.1| ATP-dependent Clp protease proteolytic subunit [Enterobacter sp.
           638]
 gi|145317441|gb|ABP59588.1| ATP-dependent Clp protease proteolytic subunit ClpP [Enterobacter
           sp. 638]
          Length = 207

 Score =  291 bits (746), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 130/208 (62%), Positives = 174/208 (83%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYNG--ERDNIAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SASEA ++G+VD +L  R
Sbjct: 179 ERDTERDRFLSASEAVEYGLVDSILTHR 206


>gi|308185908|ref|YP_003930039.1| ATP-dependent proteolytic subunit of clpA-clpP serine protease,
           heat shock protein F21.5 [Pantoea vagans C9-1]
 gi|308056418|gb|ADO08590.1| ATP-dependent proteolytic subunit of clpA-clpP serine protease,
           heat shock protein F21.5 [Pantoea vagans C9-1]
          Length = 207

 Score =  291 bits (746), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 166/192 (86%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA LI AQ+LFLEAENP+K+I 
Sbjct: 15  ALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIY 74

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGV+TAGM+IYDTM+FIKP +ST CMGQA SMG+ LL+AG KG RF LPN+R++
Sbjct: 75  LYINSPGGVITAGMSIYDTMKFIKPDVSTICMGQACSMGAFLLTAGTKGKRFCLPNSRVM 134

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG+ GQASDIE HA++I+K+K+R+NE+  ++ GKT EE+E+  +RD  +SA+EA 
Sbjct: 135 IHQPLGGYQGQASDIEIHAREILKVKQRMNELMAEHTGKTLEEIERDTERDRFLSANEAV 194

Query: 197 DWGVVDKVLMSR 208
           ++G+VD +L  R
Sbjct: 195 EYGLVDSILTHR 206


>gi|291085757|ref|ZP_06571180.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Citrobacter
           youngae ATCC 29220]
 gi|291069764|gb|EFE07873.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Citrobacter
           youngae ATCC 29220]
          Length = 243

 Score =  291 bits (746), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 130/208 (62%), Positives = 174/208 (83%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 37  MSYSG--ERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFMTGQVEDHMANLIV 94

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 95  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 154

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 155 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 214

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SASEA ++G+VD +L  R
Sbjct: 215 ERDTERDRFLSASEAVEYGLVDSILTHR 242


>gi|37527729|ref|NP_931074.1| ATP-dependent Clp protease proteolytic subunit [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|60389709|sp|Q7N0L3|CLPP_PHOLL RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|36787165|emb|CAE16241.1| ATP-dependent proteolytic subunit of clpA-clpP serine protease,
           heat shock protein F21.5 (Endopeptidase Clp)
           [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 207

 Score =  291 bits (746), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 131/201 (65%), Positives = 164/201 (81%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           K+D     + LVPMVVEQT RGERSYDIYSRLLKERI+F+TGQ+EDHMA L+ AQ+LFLE
Sbjct: 6   KRDQYAPHMALVPMVVEQTTRGERSYDIYSRLLKERIIFLTGQVEDHMANLVAAQMLFLE 65

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+AG KG R
Sbjct: 66  AENPEKDIFLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGAKGKR 125

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
             LPN+R+++HQP GGF GQA+DIE HAQ+I+K+K R+NE+  K+ G+  EE+ K  +RD
Sbjct: 126 ICLPNSRVMIHQPLGGFQGQATDIEIHAQEILKVKSRMNELMAKHTGRPIEEIAKDTERD 185

Query: 188 HIMSASEACDWGVVDKVLMSR 208
             +SA EA ++G+VDK+   R
Sbjct: 186 RFLSADEAVEYGLVDKIFTHR 206


>gi|149916365|ref|ZP_01904885.1| phosphoglycerate kinase [Roseobacter sp. AzwK-3b]
 gi|149809819|gb|EDM69671.1| phosphoglycerate kinase [Roseobacter sp. AzwK-3b]
          Length = 210

 Score =  291 bits (745), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 172/197 (87%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQT+RGER+YDI+SRLLKERI+FV G + D M++LI AQLL LEAENP KEIS+
Sbjct: 12  LVPMVVEQTSRGERAYDIFSRLLKERIIFVNGPVHDGMSSLIVAQLLHLEAENPAKEISM 71

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AGEKGMRF+LPN+RI++
Sbjct: 72  YINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAGEKGMRFSLPNSRIMV 131

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGG+ GQA+DI  HA++ +K+K+RLN+IYVK+ G+T ++VE  L+RD+ MS  EA +
Sbjct: 132 HQPSGGYQGQATDIMIHAEETLKLKKRLNQIYVKHTGQTLKKVEDALERDNFMSPEEAKN 191

Query: 198 WGVVDKVLMSRIDIEEK 214
           WG++D+++ SR+  +++
Sbjct: 192 WGLIDEIVESRVKTDDE 208


>gi|291616549|ref|YP_003519291.1| ClpP [Pantoea ananatis LMG 20103]
 gi|291151579|gb|ADD76163.1| ClpP [Pantoea ananatis LMG 20103]
 gi|327392981|dbj|BAK10403.1| ATP-dependent Clp protease proteolytic subunit ClpP [Pantoea
           ananatis AJ13355]
          Length = 218

 Score =  291 bits (744), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 128/192 (66%), Positives = 166/192 (86%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA LI AQ+LFLEAENP+K+I 
Sbjct: 26  ALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIY 85

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGV+TAGM+IYDTM+FIKP +ST CMGQA SMG+ LL+AG KG RF LPN+R++
Sbjct: 86  LYINSPGGVITAGMSIYDTMKFIKPDVSTICMGQACSMGAFLLTAGTKGKRFCLPNSRVM 145

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG+ GQA+DIE HA++I+K+K+R+NE+  ++ GK+ EE+E+  +RD  +SASEA 
Sbjct: 146 IHQPLGGYQGQATDIEIHAREILKVKQRMNELMAEHTGKSLEEIERDTERDRFLSASEAV 205

Query: 197 DWGVVDKVLMSR 208
           ++G+VD +L  R
Sbjct: 206 EYGLVDSILTHR 217


>gi|170744618|ref|YP_001773273.1| ATP-dependent Clp protease proteolytic subunit [Methylobacterium
           sp. 4-46]
 gi|168198892|gb|ACA20839.1| Endopeptidase Clp [Methylobacterium sp. 4-46]
          Length = 208

 Score =  291 bits (744), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 131/194 (67%), Positives = 169/194 (87%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQ++RGER++DIYSRLL+ERI+F+TG +ED+ A+LI AQLLFLEAENP+KEIS
Sbjct: 11  ALVPMVVEQSSRGERAFDIYSRLLRERIIFLTGPVEDYSASLIVAQLLFLEAENPKKEIS 70

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
            YINSPGGVVT+G++IYDTMQFI+ P++T C+GQAASMGSLLL+AGE G RFALPNARI+
Sbjct: 71  FYINSPGGVVTSGLSIYDTMQFIRCPVATLCVGQAASMGSLLLAAGEPGHRFALPNARIM 130

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGGF GQA+DI  HA++I  +KRRLNEIYVK+ G+ Y+ +E+ L+RD+ M+A  A 
Sbjct: 131 VHQPSGGFQGQATDILIHAREIEALKRRLNEIYVKHTGRDYDAIEQGLERDNFMTADAAK 190

Query: 197 DWGVVDKVLMSRID 210
           +WG++D+VL  R +
Sbjct: 191 EWGLIDEVLQKRAE 204


>gi|317492909|ref|ZP_07951333.1| Clp protease [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316919031|gb|EFV40366.1| Clp protease [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 206

 Score =  291 bits (744), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 164/193 (84%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI AQ+LFLEAENP+K+I
Sbjct: 13  MALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLIVAQMLFLEAENPEKDI 72

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+AG KG RF LPN+R+
Sbjct: 73  HLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGAKGKRFCLPNSRV 132

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DIE HA++I+K+K R+NE+  K+ GK  EE+E+  +RD  +SA EA
Sbjct: 133 MIHQPLGGFQGQATDIEIHAKEILKVKARMNELMAKHSGKPLEEIERDTERDRFLSADEA 192

Query: 196 CDWGVVDKVLMSR 208
            ++G+VD V+  R
Sbjct: 193 VEYGLVDSVMTHR 205


>gi|212709197|ref|ZP_03317325.1| hypothetical protein PROVALCAL_00230 [Providencia alcalifaciens DSM
           30120]
 gi|212688109|gb|EEB47637.1| hypothetical protein PROVALCAL_00230 [Providencia alcalifaciens DSM
           30120]
          Length = 206

 Score =  291 bits (744), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 165/193 (85%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMV+EQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA LI AQ+LFLEAENP+K+I
Sbjct: 14  MALVPMVIEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLIVAQMLFLEAENPEKDI 73

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+AG KG RF LPN+R+
Sbjct: 74  QLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGTKGKRFCLPNSRV 133

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG+ GQA+DIE HAQ+I+K+K R+NE+  ++ GK+ EE+ +  +RD  +SA+EA
Sbjct: 134 MIHQPLGGYQGQATDIEIHAQEILKVKSRMNELMAQHTGKSIEEISRDTERDRFLSANEA 193

Query: 196 CDWGVVDKVLMSR 208
            ++G+VD +  SR
Sbjct: 194 KEYGLVDHIYTSR 206


>gi|242240292|ref|YP_002988473.1| ATP-dependent Clp protease proteolytic subunit ClpP [Dickeya
           dadantii Ech703]
 gi|242132349|gb|ACS86651.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Dickeya
           dadantii Ech703]
          Length = 207

 Score =  290 bits (743), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 131/208 (62%), Positives = 173/208 (83%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  +++ +   + LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+ED+MA LI 
Sbjct: 1   MSYSG--EQEKQTPHMALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDYMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GGF GQA+DIE HA++I+K+K R+NE+  K+ G++ + +
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKARMNELMAKHTGQSLDII 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SA EA ++G+VD VL  R
Sbjct: 179 ERDTERDRFLSAGEAVEYGLVDSVLTHR 206


>gi|206578475|ref|YP_002240083.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Klebsiella
           pneumoniae 342]
 gi|238893386|ref|YP_002918120.1| ATP-dependent Clp protease proteolytic subunit [Klebsiella
           pneumoniae NTUH-K2044]
 gi|288936834|ref|YP_003440893.1| ATP-dependent Clp protease proteolytic subunit ClpP [Klebsiella
           variicola At-22]
 gi|290510110|ref|ZP_06549480.1| Clp protease [Klebsiella sp. 1_1_55]
 gi|206567533|gb|ACI09309.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Klebsiella
           pneumoniae 342]
 gi|238545702|dbj|BAH62053.1| ATP-dependent Clp protease proteolytic subunit [Klebsiella
           pneumoniae subsp. pneumoniae NTUH-K2044]
 gi|288891543|gb|ADC59861.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Klebsiella
           variicola At-22]
 gi|289776826|gb|EFD84824.1| Clp protease [Klebsiella sp. 1_1_55]
          Length = 207

 Score =  290 bits (743), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 174/208 (83%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SA+EA ++G+VD +L  R
Sbjct: 179 ERDTERDRFLSAAEAVEYGLVDSILTHR 206


>gi|271499597|ref|YP_003332622.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Dickeya
           dadantii Ech586]
 gi|270343152|gb|ACZ75917.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Dickeya
           dadantii Ech586]
          Length = 207

 Score =  290 bits (743), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 173/208 (83%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  +K +    + LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+ED+MA LI 
Sbjct: 1   MSYSGEQEKLAPH--MALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDYMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GGF GQA+DIE HA++I+K+K R+NE+  K+ G++ + +
Sbjct: 119 AGTKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKARMNELMAKHTGQSLDVI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SA+EA ++G+VD VL  R
Sbjct: 179 ERDTERDRFLSAAEAVEYGLVDSVLTHR 206


>gi|317047175|ref|YP_004114823.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Pantoea sp.
           At-9b]
 gi|316948792|gb|ADU68267.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Pantoea sp.
           At-9b]
          Length = 207

 Score =  290 bits (743), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 130/208 (62%), Positives = 173/208 (83%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G   ++     + LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--DREFTAPHMALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTM+FIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMKFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K+R+NE+  ++ GK+ E++
Sbjct: 119 AGTKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKQRMNELMAEHTGKSLEQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SASEA ++G+VD +L  R
Sbjct: 179 ERDTERDRFLSASEAVEYGLVDSILTHR 206


>gi|268592036|ref|ZP_06126257.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Providencia
           rettgeri DSM 1131]
 gi|291312428|gb|EFE52881.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Providencia
           rettgeri DSM 1131]
          Length = 206

 Score =  290 bits (743), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 129/193 (66%), Positives = 165/193 (85%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMV+EQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA LI AQ+LFLEAENP+K+I
Sbjct: 14  MALVPMVIEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLIVAQMLFLEAENPEKDI 73

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+AG KG RF LPN+R+
Sbjct: 74  HLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGTKGKRFCLPNSRV 133

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG+ GQASDIE HAQ+I+K+K R+NE+   + GK+ EE+ +  +RD  +SA+EA
Sbjct: 134 MIHQPLGGYQGQASDIEIHAQEILKVKSRMNELMALHTGKSIEEITRDTERDRFLSANEA 193

Query: 196 CDWGVVDKVLMSR 208
            ++G+VD++  SR
Sbjct: 194 KEYGLVDQIYSSR 206


>gi|161615359|ref|YP_001589324.1| hypothetical protein SPAB_03130 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|197263975|ref|ZP_03164049.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|198242637|ref|YP_002214402.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|200390046|ref|ZP_03216657.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|205357179|ref|ZP_02345490.2| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|205359635|ref|ZP_02830941.2| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|224582286|ref|YP_002636084.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|161364723|gb|ABX68491.1| hypothetical protein SPAB_03130 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|197242230|gb|EDY24850.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|197937153|gb|ACH74486.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|199602491|gb|EDZ01037.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|205323485|gb|EDZ11324.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|205344194|gb|EDZ30958.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|224466813|gb|ACN44643.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|322713521|gb|EFZ05092.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. A50]
 gi|326622151|gb|EGE28496.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Dublin str. 3246]
          Length = 243

 Score =  290 bits (742), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 173/208 (83%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 37  MSYSG--ERDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 94

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 95  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 154

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 155 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 214

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SA EA ++G+VD +L  R
Sbjct: 215 ERDTERDRFLSAPEAVEYGLVDSILTHR 242


>gi|310816210|ref|YP_003964174.1| Protease subunit of ATP-dependent Clp protease [Ketogulonicigenium
           vulgare Y25]
 gi|308754945|gb|ADO42874.1| Protease subunit of ATP-dependent Clp protease [Ketogulonicigenium
           vulgare Y25]
          Length = 207

 Score =  290 bits (742), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 131/206 (63%), Positives = 174/206 (84%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D  + ++ LVPMVVEQT+RGER+YDI+SRLLKERI+FV+G +ED M+ LI AQLL LEA
Sbjct: 2   RDPVETYMNLVPMVVEQTSRGERAYDIFSRLLKERIIFVSGVVEDGMSQLIVAQLLHLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEIS+YINSPGGVVT+G++IYDTMQ+I+P +ST  +GQAASMGSLLL+AGE GMR+
Sbjct: 62  ENPKKEISMYINSPGGVVTSGLSIYDTMQYIRPKVSTLVIGQAASMGSLLLAAGEAGMRY 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           +LPN+R+++HQPSGGF GQ +DI  HA++  K+KRRLNEIYVK+ G++YE VE  L+RD+
Sbjct: 122 SLPNSRVMVHQPSGGFQGQVTDIMIHARESEKLKRRLNEIYVKHTGQSYEAVEAALERDN 181

Query: 189 IMSASEACDWGVVDKVLMSRIDIEEK 214
             SA EA ++G++D++L  R +  EK
Sbjct: 182 FKSAEEAKEFGLIDEILEKRGETPEK 207


>gi|119384010|ref|YP_915066.1| endopeptidase Clp [Paracoccus denitrificans PD1222]
 gi|119373777|gb|ABL69370.1| ATP-dependent Clp protease proteolytic subunit ClpP [Paracoccus
           denitrificans PD1222]
          Length = 209

 Score =  290 bits (742), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 131/191 (68%), Positives = 167/191 (87%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQT+RGER+YDI+SRLLKERI+F++G + D MATLI AQLLFLEAENP K+IS+
Sbjct: 12  LVPMVVEQTSRGERAYDIFSRLLKERIIFLSGPVHDGMATLISAQLLFLEAENPTKDISM 71

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL AG+ G RF+LPN+R+++
Sbjct: 72  YINSPGGVVTSGLSIYDTMQYIKPRVSTLVVGQAASMGSLLLCAGQPGQRFSLPNSRVMV 131

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGGF GQA+DI  HA++  K+KRRLNEIYVK+ G+T EEVE+ L+RD  MS  EA +
Sbjct: 132 HQPSGGFQGQATDILIHARETEKLKRRLNEIYVKHTGRTLEEVEQALERDRFMSPEEAKE 191

Query: 198 WGVVDKVLMSR 208
           WG++D++L++R
Sbjct: 192 WGLIDEILVAR 202


>gi|194471774|ref|ZP_03077758.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|197249758|ref|YP_002145429.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
 gi|205357584|ref|ZP_02571531.2| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|205358475|ref|ZP_02656494.2| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|205358901|ref|ZP_02665206.2| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|289827300|ref|ZP_06545983.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-3139]
 gi|194458138|gb|EDX46977.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|197213461|gb|ACH50858.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
 gi|205331008|gb|EDZ17772.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|205334088|gb|EDZ20852.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|205340153|gb|EDZ26917.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|321226026|gb|EFX51077.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Typhimurium str. TN061786]
          Length = 243

 Score =  290 bits (742), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 173/208 (83%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 37  MSYSG--ERDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 94

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 95  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 154

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 155 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 214

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SA EA ++G+VD +L  R
Sbjct: 215 ERDTERDRFLSAPEAVEYGLVDSILTHR 242


>gi|161504375|ref|YP_001571487.1| hypothetical protein SARI_02486 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865722|gb|ABX22345.1| hypothetical protein SARI_02486 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 243

 Score =  290 bits (742), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 173/208 (83%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 37  MSYSG--ERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 94

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 95  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 154

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 155 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 214

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SA EA ++G+VD +L  R
Sbjct: 215 ERDTERDRFLSAPEAVEYGLVDSILTHR 242


>gi|16759428|ref|NP_455045.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. CT18]
 gi|16763829|ref|NP_459444.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|29142800|ref|NP_806142.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|162139608|ref|YP_215477.2| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|168237562|ref|ZP_02662620.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|168261116|ref|ZP_02683089.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|168465541|ref|ZP_02699423.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|194443946|ref|YP_002039691.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194451357|ref|YP_002044483.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194734455|ref|YP_002113479.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|204930575|ref|ZP_03221505.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|207855928|ref|YP_002242579.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|213025962|ref|ZP_03340409.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Typhi str. 404ty]
 gi|213419494|ref|ZP_03352560.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Typhi str. E01-6750]
 gi|213425858|ref|ZP_03358608.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Typhi str. E02-1180]
 gi|213646005|ref|ZP_03376058.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Typhi str. J185]
 gi|213853068|ref|ZP_03382600.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Typhi str. M223]
 gi|238911421|ref|ZP_04655258.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Tennessee str. CDC07-0191]
 gi|60391923|sp|P0A1D7|CLPP_SALTY RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp; Flags: Precursor
 gi|60391924|sp|P0A1D8|CLPP_SALTI RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp; Flags: Precursor
 gi|67460140|sp|Q57SB5|CLPP_SALCH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp; Flags: Precursor
 gi|226706468|sp|B5QTJ6|CLPP_SALEP RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|226706469|sp|B4T9E3|CLPP_SALHS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|226706470|sp|B4SWU1|CLPP_SALNS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|226706472|sp|B4TMC6|CLPP_SALSV RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|25289858|pir||AC0558 ATP-dependent clp protease proteolytic chain [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)
 gi|7594816|dbj|BAA94668.1| serine protease subunit [Salmonella enterica subsp. enterica
           serovar Typhimurium]
 gi|16418955|gb|AAL19403.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. LT2]
 gi|16501719|emb|CAD08907.1| ATP-dependent clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Typhi]
 gi|29138432|gb|AAO70002.1| ATP-dependent clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|194402609|gb|ACF62831.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
 gi|194409661|gb|ACF69880.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|194709957|gb|ACF89178.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|195631923|gb|EDX50443.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|197289522|gb|EDY28885.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|204320509|gb|EDZ05712.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|205350070|gb|EDZ36701.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|206707731|emb|CAR32016.1| ATP-dependent clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|261245731|emb|CBG23528.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Typhimurium str. D23580]
 gi|267992163|gb|ACY87048.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|301157059|emb|CBW16543.1| ATP-dependent clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Typhimurium str. SL1344]
 gi|312911481|dbj|BAJ35455.1| ATP-dependent Clp protease proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           T000240]
 gi|320084722|emb|CBY94513.1| ATP-dependent clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|322614726|gb|EFY11655.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315996572]
 gi|322618832|gb|EFY15720.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-1]
 gi|322623539|gb|EFY20378.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-3]
 gi|322629162|gb|EFY25941.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-4]
 gi|322631883|gb|EFY28637.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-1]
 gi|322637380|gb|EFY34082.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-2]
 gi|322642065|gb|EFY38675.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str. 531954]
 gi|322647884|gb|EFY44359.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322652562|gb|EFY48916.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           OH_2009072675]
 gi|322653276|gb|EFY49609.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322660575|gb|EFY56811.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str. 19N]
 gi|322664727|gb|EFY60920.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           81038-01]
 gi|322669220|gb|EFY65370.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MD_MDA09249507]
 gi|322670765|gb|EFY66898.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str. 414877]
 gi|322678996|gb|EFY75051.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str. 366867]
 gi|322682025|gb|EFY78050.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str. 413180]
 gi|322685146|gb|EFY81143.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str. 446600]
 gi|323192960|gb|EFZ78183.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           609458-1]
 gi|323196958|gb|EFZ82100.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           556150-1]
 gi|323203943|gb|EFZ88960.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str. 609460]
 gi|323206972|gb|EFZ91925.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           507440-20]
 gi|323214175|gb|EFZ98933.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str. 556152]
 gi|323214501|gb|EFZ99252.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB101509-0077]
 gi|323223058|gb|EGA07401.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB102109-0047]
 gi|323227007|gb|EGA11188.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB110209-0055]
 gi|323230175|gb|EGA14295.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB111609-0052]
 gi|323233913|gb|EGA18002.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009083312]
 gi|323238393|gb|EGA22451.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009085258]
 gi|323244080|gb|EGA28089.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315731156]
 gi|323246241|gb|EGA30224.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2009159199]
 gi|323251867|gb|EGA35730.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008282]
 gi|323257864|gb|EGA41543.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008283]
 gi|323261123|gb|EGA44715.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008284]
 gi|323264947|gb|EGA48446.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008285]
 gi|323272510|gb|EGA55917.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008287]
          Length = 207

 Score =  290 bits (742), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 173/208 (83%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SA EA ++G+VD +L  R
Sbjct: 179 ERDTERDRFLSAPEAVEYGLVDSILTHR 206


>gi|261346364|ref|ZP_05974008.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Providencia
           rustigianii DSM 4541]
 gi|282565678|gb|EFB71213.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Providencia
           rustigianii DSM 4541]
          Length = 206

 Score =  290 bits (742), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 164/193 (84%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMV+EQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA LI AQ+LFLEAENP+K+I
Sbjct: 14  MALVPMVIEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLIVAQMLFLEAENPEKDI 73

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+AG KG RF LPN+R+
Sbjct: 74  HLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGTKGKRFCLPNSRV 133

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG+ GQA+DIE HAQ+I+K+K R+NE+   + GK+ EE+ +  +RD  +SA+EA
Sbjct: 134 MIHQPLGGYQGQATDIEIHAQEILKVKSRMNELMAHHTGKSIEEISRDTERDRFLSANEA 193

Query: 196 CDWGVVDKVLMSR 208
            ++G+VD +  SR
Sbjct: 194 KEYGLVDHIYTSR 206


>gi|310766842|gb|ADP11792.1| ATP-dependent Clp protease proteolytic subunit clpP [Erwinia sp.
           Ejp617]
          Length = 215

 Score =  290 bits (741), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 171/208 (82%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  +++     + LVPMVVEQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 9   MSYSG--ERELTAPHMALVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLIV 66

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 67  AQMLFLEAENPEKDIHLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 126

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG R+ LPN+R+++HQP GGF GQASDI+ HA++I+K K+ +NE+  K+ G+T E +
Sbjct: 127 AGAKGKRYCLPNSRVMIHQPLGGFQGQASDIDIHAREIIKTKQMMNELMAKHTGQTIETI 186

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SASE+ ++G+VD VL  R
Sbjct: 187 ERDTNRDRFLSASESVEYGLVDSVLSQR 214


>gi|292487467|ref|YP_003530339.1| ATP-dependent Clp protease proteolytic subunit ClpP [Erwinia
           amylovora CFBP1430]
 gi|292898709|ref|YP_003538078.1| ATP-dependent clp protease proteolytic subunit [Erwinia amylovora
           ATCC 49946]
 gi|291198557|emb|CBJ45665.1| ATP-dependent clp protease proteolytic subunit [Erwinia amylovora
           ATCC 49946]
 gi|291552886|emb|CBA19931.1| ATP-dependent Clp protease proteolytic subunit clpP [Erwinia
           amylovora CFBP1430]
 gi|312171571|emb|CBX79829.1| ATP-dependent Clp protease proteolytic subunit clpP [Erwinia
           amylovora ATCC BAA-2158]
          Length = 207

 Score =  290 bits (741), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 171/208 (82%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  +++     + LVPMVVEQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERELTAPHMALVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIHLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG R+ LPN+R+++HQP GGF GQASDI+ HA++I+K K+ +NE+  K+ G+T E +
Sbjct: 119 AGAKGKRYCLPNSRVMIHQPLGGFQGQASDIDIHAREIIKTKQMMNELMAKHTGQTIENI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SASE+ ++G+VD VL  R
Sbjct: 179 ERDTNRDRFLSASESVEYGLVDSVLSQR 206


>gi|227113465|ref|ZP_03827121.1| ATP-dependent Clp protease proteolytic subunit [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
 gi|253687443|ref|YP_003016633.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251754021|gb|ACT12097.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 207

 Score =  290 bits (741), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 131/208 (62%), Positives = 171/208 (82%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  +++ +   + LVPMVVEQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA L+ 
Sbjct: 1   MSYSG--EQERQAPHMALVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG R  LPN+R+++HQP GGF GQA+DIE HA++I+K+K ++NE+  K+ G+  E +
Sbjct: 119 AGAKGKRICLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKAKMNELMAKHTGQPLEAI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SASEA D+G+VD V  +R
Sbjct: 179 ERDTERDRFLSASEAVDYGLVDSVFTNR 206


>gi|259909254|ref|YP_002649610.1| Putative ATP-dependent Clp protease proteolytic subunit [Erwinia
           pyrifoliae Ep1/96]
 gi|224964876|emb|CAX56398.1| Putative ATP-dependent Clp protease proteolytic subunit [Erwinia
           pyrifoliae Ep1/96]
          Length = 207

 Score =  290 bits (741), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 171/208 (82%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  +++     + LVPMVVEQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERELTAPHMALVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIHLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG R+ LPN+R+++HQP GGF GQASDI+ HA++I+K K+ +NE+  K+ G+T E +
Sbjct: 119 AGAKGKRYCLPNSRVMIHQPLGGFQGQASDIDIHAREIIKTKQMMNELMAKHTGQTIETI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SASE+ ++G+VD VL  R
Sbjct: 179 ERDTNRDRFLSASESVEYGLVDSVLSQR 206


>gi|23014984|ref|ZP_00054776.1| COG0740: Protease subunit of ATP-dependent Clp proteases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 213

 Score =  290 bits (741), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 175/209 (83%), Gaps = 1/209 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
           ++D  DV++  LVPMVVEQTNRGERSYDIYSRLLKERIVF+TGQ+ D +A+LICAQLLFL
Sbjct: 3   ERDPIDVYMNTLVPMVVEQTNRGERSYDIYSRLLKERIVFLTGQVYDEVASLICAQLLFL 62

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP K+IS YINSPGGVVT+G+AIYDTMQ+I+P +ST C+GQAASMGSLL++AGEKG 
Sbjct: 63  ESENPSKDISFYINSPGGVVTSGLAIYDTMQYIRPAVSTLCIGQAASMGSLLMTAGEKGK 122

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RF+LPN+RI++HQPSGG  GQA+DIE  A++I+ ++ RLN IYV + G+  E +EK ++R
Sbjct: 123 RFSLPNSRIMVHQPSGGAQGQATDIEIQAREILALRARLNNIYVDHTGQPLEVIEKVMER 182

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEEKS 215
           D  M+A EA ++G++D+V+  R   E+ S
Sbjct: 183 DKFMTAEEAKEFGLIDEVVNKRPVAEDDS 211


>gi|188534634|ref|YP_001908431.1| Putative ATP-dependent Clp protease proteolytic subunit [Erwinia
           tasmaniensis Et1/99]
 gi|188029676|emb|CAO97555.1| Putative ATP-dependent Clp protease proteolytic subunit [Erwinia
           tasmaniensis Et1/99]
          Length = 207

 Score =  290 bits (741), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 171/208 (82%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  +++     + LVPMVVEQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERELTAPHMALVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIHLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG R+ LPN+R+++HQP GGF GQASDI+ HA++I+K K+ +NE+  K+ G+T E +
Sbjct: 119 AGAKGKRYCLPNSRVMIHQPLGGFQGQASDIDIHAREIIKTKQMMNELMAKHTGQTIETI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SASE+ ++G+VD VL  R
Sbjct: 179 ERDTNRDRFLSASESVEYGLVDSVLAQR 206


>gi|329296782|ref|ZP_08254118.1| ClpP [Plautia stali symbiont]
          Length = 207

 Score =  290 bits (741), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 166/192 (86%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA LI AQ+LFLEAENP+K+I 
Sbjct: 15  ALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIY 74

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGV+TAGM+IYDTM+FIKP +ST CMGQA SMG+ LL+AG KG RF LPN+R++
Sbjct: 75  LYINSPGGVITAGMSIYDTMKFIKPDVSTICMGQACSMGAFLLTAGTKGKRFCLPNSRVM 134

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG+ GQA+DIE HA++I+K+K+R+NE+  ++ GK+ E++E+  +RD  +SASEA 
Sbjct: 135 IHQPLGGYQGQATDIEIHAREILKVKQRMNELMAEHTGKSLEQIERDTERDRFLSASEAV 194

Query: 197 DWGVVDKVLMSR 208
           ++G+VD +L  R
Sbjct: 195 EYGLVDSILTHR 206


>gi|144899460|emb|CAM76324.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 214

 Score =  290 bits (741), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 130/207 (62%), Positives = 177/207 (85%), Gaps = 1/207 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
           ++D  D+++  LVPMVVEQTNRGERSYDIYSRLLKERIVF+TGQ+ D ++TLICAQLLFL
Sbjct: 3   ERDPIDLYMNTLVPMVVEQTNRGERSYDIYSRLLKERIVFLTGQVYDEVSTLICAQLLFL 62

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP K+I+ YINSPGGVVT+G+A+YDTMQ+I+P +ST C+GQAASMGSLLL+AG KG 
Sbjct: 63  ESENPNKDIAFYINSPGGVVTSGLAMYDTMQYIRPSVSTVCLGQAASMGSLLLTAGAKGK 122

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RF+LPNAR+++HQPSGG  GQA+DIE  A++I+ ++ RLN +YV++ G+T E +E+ ++R
Sbjct: 123 RFSLPNARVMIHQPSGGAQGQATDIEIQAREILALRARLNNMYVQHTGQTLEVIERAMER 182

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEE 213
           D  M+A EA ++G++D+V+ +R  +EE
Sbjct: 183 DKYMTADEAKEFGLIDEVVSNRPTLEE 209


>gi|220927143|ref|YP_002502445.1| ATP-dependent Clp protease proteolytic subunit [Methylobacterium
           nodulans ORS 2060]
 gi|254763797|sp|B8IN26|CLPP_METNO RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|219951750|gb|ACL62142.1| peptidase S14 ClpP [Methylobacterium nodulans ORS 2060]
          Length = 209

 Score =  290 bits (741), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 131/194 (67%), Positives = 168/194 (86%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQ++RGER++DIYSRLL+ERI+F+TG +ED+ A+LI AQLLFLEAENP+KEIS
Sbjct: 11  ALVPMVVEQSSRGERAFDIYSRLLRERIIFLTGPVEDYSASLIVAQLLFLEAENPKKEIS 70

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
            YINSPGGVVT+G++IYDTMQFI+ P++T C+GQAASMGSLLL+AGE G RFALPNARI+
Sbjct: 71  FYINSPGGVVTSGLSIYDTMQFIRCPVATLCVGQAASMGSLLLAAGEPGHRFALPNARIM 130

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGGF GQA+DI  HA++I  +KRRLNEIYVK+ G+ Y+ +E  L+RD+ M+A  A 
Sbjct: 131 VHQPSGGFQGQATDILIHAREIEALKRRLNEIYVKHTGRDYDTIELGLERDNFMTADAAR 190

Query: 197 DWGVVDKVLMSRID 210
           +WG++D+VL  R +
Sbjct: 191 EWGLIDEVLQKRAE 204


>gi|323128768|gb|ADX16198.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 4/74]
          Length = 246

 Score =  290 bits (741), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 173/208 (83%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 40  MSYSG--ERDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 97

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 98  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 157

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 158 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 217

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SA EA ++G+VD +L  R
Sbjct: 218 ERDTERDRFLSAPEAVEYGLVDSILTHR 245


>gi|62126693|gb|AAX64396.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease,
           heat shock protein F215 [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
          Length = 246

 Score =  290 bits (741), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 173/208 (83%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 40  MSYSG--ERDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 97

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 98  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 157

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 158 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 217

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SA EA ++G+VD +L  R
Sbjct: 218 ERDTERDRFLSAPEAVEYGLVDSILTHR 245


>gi|238751006|ref|ZP_04612502.1| ATP-dependent Clp protease proteolytic subunit [Yersinia rohdei
           ATCC 43380]
 gi|238710696|gb|EEQ02918.1| ATP-dependent Clp protease proteolytic subunit [Yersinia rohdei
           ATCC 43380]
          Length = 207

 Score =  289 bits (740), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 170/208 (81%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D     + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDQFAPNMALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLIT 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIFLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GGF GQA+DIE HA++I+K+K R+NE+   + GK+ EE+
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKSRMNELMAHHTGKSLEEI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SA +A ++G+VD V   R
Sbjct: 179 ERDTERDRFLSAEQAVEYGLVDSVFTRR 206


>gi|78485521|ref|YP_391446.1| ATP-dependent Clp protease proteolytic subunit [Thiomicrospira
           crunogena XCL-2]
 gi|110816468|sp|Q31GF1|CLPP_THICR RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|78363807|gb|ABB41772.1| ATP-dependent Clp protease proteolytic subunit ClpP [Thiomicrospira
           crunogena XCL-2]
          Length = 200

 Score =  289 bits (740), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 162/192 (84%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMV+EQT+RGERS+DIYSRLLKER++F+ GQ+EDHMA LI AQLLFLE+ENP K+I 
Sbjct: 9   ALVPMVIEQTSRGERSFDIYSRLLKERVIFLVGQVEDHMANLIVAQLLFLESENPDKDIH 68

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGMAIYDTM+FIKP +ST C+GQAASMGS LLSAG +G R+ALPN+R++
Sbjct: 69  LYINSPGGSVTAGMAIYDTMRFIKPDVSTMCIGQAASMGSFLLSAGAEGKRYALPNSRVM 128

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDIE HA++I++IK++LN+    + G+  E +E   DRD+ MSA EAC
Sbjct: 129 IHQPLGGFQGQASDIEIHAKEIIQIKQKLNKALADHTGQPIEVIENDTDRDNFMSADEAC 188

Query: 197 DWGVVDKVLMSR 208
           D+G+VDKVL  R
Sbjct: 189 DYGLVDKVLTRR 200


>gi|283479306|emb|CAY75222.1| ATP-dependent Clp protease proteolytic subunit clpP [Erwinia
           pyrifoliae DSM 12163]
          Length = 218

 Score =  289 bits (740), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 171/208 (82%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  +++     + LVPMVVEQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 12  MSYSG--ERELTAPHMALVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLIV 69

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 70  AQMLFLEAENPEKDIHLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 129

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG R+ LPN+R+++HQP GGF GQASDI+ HA++I+K K+ +NE+  K+ G+T E +
Sbjct: 130 AGAKGKRYCLPNSRVMIHQPLGGFQGQASDIDIHAREIIKTKQMMNELMAKHTGQTIETI 189

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SASE+ ++G+VD VL  R
Sbjct: 190 ERDTNRDRFLSASESVEYGLVDSVLSQR 217


>gi|283784263|ref|YP_003364128.1| ATP-dependent clp protease proteolytic subunit [Citrobacter
           rodentium ICC168]
 gi|282947717|emb|CBG87272.1| ATP-dependent clp protease proteolytic subunit [Citrobacter
           rodentium ICC168]
          Length = 207

 Score =  289 bits (740), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 173/208 (83%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SA EA ++G+VD +L  R
Sbjct: 179 ERDTERDRFLSAPEAVEYGLVDSILTHR 206


>gi|87201067|ref|YP_498324.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Novosphingobium aromaticivorans DSM 12444]
 gi|115311787|sp|Q2G3T3|CLPP_NOVAD RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|87136748|gb|ABD27490.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Novosphingobium aromaticivorans DSM 12444]
          Length = 235

 Score =  289 bits (740), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 173/207 (83%)

Query: 2   SFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICA 61
           +F    K  ++ V   L+P+VVEQ++RGERS+DIYSRLL+ERI+FVTG++EDHMA++I A
Sbjct: 12  TFGNQGKFTTDPVTGALIPVVVEQSSRGERSFDIYSRLLRERIIFVTGEVEDHMASVIIA 71

Query: 62  QLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSA 121
           QLLFLE+ENP K+IS+YINSPGGVVTAG+AIYDTMQ+I+P +ST C+GQAASMGS LL+A
Sbjct: 72  QLLFLESENPSKDISMYINSPGGVVTAGLAIYDTMQYIRPRVSTVCIGQAASMGSFLLAA 131

Query: 122 GEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVE 181
           GE GMR ALPNARI++HQPSGG  G ASDIE  A++I++I++R+N++YVK  G++ +E+E
Sbjct: 132 GEPGMRIALPNARIMIHQPSGGARGMASDIEIQAREILRIRKRMNDLYVKFTGRSLDEIE 191

Query: 182 KTLDRDHIMSASEACDWGVVDKVLMSR 208
           K +DRD  + A EA  +G+VDKV  SR
Sbjct: 192 KAMDRDTFLEAEEAMKFGLVDKVFESR 218


>gi|284006421|emb|CBA71657.1| ATP-dependent Clp protease proteolytic subunit [Arsenophonus
           nasoniae]
          Length = 209

 Score =  289 bits (740), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 129/193 (66%), Positives = 162/193 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMV+EQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA L+ AQ+LFLEAENP K+I
Sbjct: 16  MALVPMVIEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLVVAQMLFLEAENPDKDI 75

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+AG KG R+ LPN+R+
Sbjct: 76  HLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGAKGKRYCLPNSRV 135

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDIE HA++I+KIK R+NE+  K+ GK  +EVE   +RD  ++A EA
Sbjct: 136 MIHQPLGGFQGQASDIEIHAKEILKIKSRMNELMAKHTGKKIKEVENDTERDRFLTAEEA 195

Query: 196 CDWGVVDKVLMSR 208
             +G+VDK+  +R
Sbjct: 196 VSYGLVDKIYTNR 208


>gi|237707568|ref|ZP_04538049.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Escherichia
           sp. 3_2_53FAA]
 gi|226898778|gb|EEH85037.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Escherichia
           sp. 3_2_53FAA]
 gi|332103940|gb|EGJ07286.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Shigella sp.
           D9]
          Length = 227

 Score =  289 bits (739), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 173/208 (83%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 21  MSYSG--ERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 78

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 79  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 138

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 139 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQI 198

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SA EA ++G+VD +L  R
Sbjct: 199 ERDTERDRFLSAPEAVEYGLVDSILTHR 226


>gi|254485779|ref|ZP_05098984.1| Clp protease [Roseobacter sp. GAI101]
 gi|214042648|gb|EEB83286.1| Clp protease [Roseobacter sp. GAI101]
          Length = 215

 Score =  289 bits (739), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 130/198 (65%), Positives = 170/198 (85%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQT+RGER+YDI+SRLLKERI+F++G + D M++LI AQLL LEAENP KEIS+
Sbjct: 12  LVPMVVEQTSRGERAYDIFSRLLKERIIFLSGPVHDGMSSLIVAQLLHLEAENPSKEISM 71

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL AGEKGMRF+LPN+R+++
Sbjct: 72  YINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLQAGEKGMRFSLPNSRVMV 131

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGG+ GQA+DI  HAQ+  K+K RLNEIYVK+ G++ E+VE  L+RD+ MS  EA D
Sbjct: 132 HQPSGGYQGQATDIMIHAQETQKLKTRLNEIYVKHTGQSLEKVEAALERDNFMSPEEAKD 191

Query: 198 WGVVDKVLMSRIDIEEKS 215
           WG++D+++ +R  +++ S
Sbjct: 192 WGLIDEIVENRGKMDDPS 209


>gi|114767020|ref|ZP_01445928.1| Protease subunit of ATP-dependent Clp protease [Pelagibaca
           bermudensis HTCC2601]
 gi|114540804|gb|EAU43868.1| Protease subunit of ATP-dependent Clp protease [Roseovarius sp.
           HTCC2601]
          Length = 210

 Score =  289 bits (739), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 131/206 (63%), Positives = 174/206 (84%), Gaps = 1/206 (0%)

Query: 9   KDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           KD  + ++  LVPMVVEQT+RGER+YDI+SRLLKERI+FV+G + D M++LI AQLL LE
Sbjct: 2   KDPFETYMNTLVPMVVEQTSRGERAYDIFSRLLKERIIFVSGPVHDGMSSLIVAQLLHLE 61

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP KEIS+YINSPGGVVT+G++IYDTMQ+I+P +ST  +GQAASMGSLLL+AGE GMR
Sbjct: 62  AENPSKEISMYINSPGGVVTSGLSIYDTMQYIRPKVSTLVIGQAASMGSLLLTAGEAGMR 121

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPN+RI++HQPSGG+ GQA+DI  HA++ +K+KRRLNEIYV++ G+T E VE  L+RD
Sbjct: 122 FSLPNSRIMVHQPSGGYQGQATDIMIHAEETLKLKRRLNEIYVRHTGQTLENVEAALERD 181

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEE 213
           + M+  +A +WG++D+++ SR   EE
Sbjct: 182 NFMAPEDAKEWGLIDEIVESRGAAEE 207


>gi|170767754|ref|ZP_02902207.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           albertii TW07627]
 gi|170123242|gb|EDS92173.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           albertii TW07627]
          Length = 207

 Score =  289 bits (739), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 173/208 (83%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SA EA ++G+VD +L  R
Sbjct: 179 ERDTERDRFLSAPEAVEYGLVDSILTHR 206


>gi|288549991|ref|ZP_05968896.2| ATP-dependent Clp protease, proteolytic subunit ClpP [Enterobacter
           cancerogenus ATCC 35316]
 gi|288316903|gb|EFC55841.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Enterobacter
           cancerogenus ATCC 35316]
          Length = 194

 Score =  289 bits (739), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 166/193 (86%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI AQ+LFLEAENP+K+I
Sbjct: 1   MALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+AG KG RF LPN+R+
Sbjct: 61  YLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG+ GQA+DIE HA++I+K+K R+NE+  ++ G++ E++E+  +RD  +SA EA
Sbjct: 121 MIHQPLGGYQGQATDIEIHAREILKVKARMNELMAQHTGQSLEQIERDTERDRFLSAPEA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G+VD VL  R
Sbjct: 181 VEYGLVDSVLTHR 193


>gi|238759262|ref|ZP_04620429.1| ATP-dependent Clp protease proteolytic subunit [Yersinia aldovae
           ATCC 35236]
 gi|238702549|gb|EEP95099.1| ATP-dependent Clp protease proteolytic subunit [Yersinia aldovae
           ATCC 35236]
          Length = 194

 Score =  289 bits (739), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 163/193 (84%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI AQ+LFLEAENP+K+I
Sbjct: 1   MALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLITAQMLFLEAENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+AG KG RF LPN+R+
Sbjct: 61  FLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGAKGKRFCLPNSRV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DIE HA++I+K+K R+NE+   + GK+ EE+E+  +RD  +SA +A
Sbjct: 121 MIHQPLGGFQGQATDIEIHAKEILKVKSRMNELMAHHTGKSLEEIERDTERDRFLSAQQA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G+VD V   R
Sbjct: 181 VEYGLVDSVFTRR 193


>gi|197284027|ref|YP_002149899.1| ATP-dependent Clp protease proteolytic subunit [Proteus mirabilis
           HI4320]
 gi|226329068|ref|ZP_03804586.1| hypothetical protein PROPEN_02971 [Proteus penneri ATCC 35198]
 gi|227358102|ref|ZP_03842444.1| ATP-dependent Clp protease proteolytic subunit [Proteus mirabilis
           ATCC 29906]
 gi|226706465|sp|B4EU53|CLPP_PROMH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|194681514|emb|CAR40393.1| ATP-dependent Clp protease proteolytic subunit [Proteus mirabilis
           HI4320]
 gi|225202254|gb|EEG84608.1| hypothetical protein PROPEN_02971 [Proteus penneri ATCC 35198]
 gi|227161837|gb|EEI46869.1| ATP-dependent Clp protease proteolytic subunit [Proteus mirabilis
           ATCC 29906]
          Length = 207

 Score =  289 bits (739), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 132/211 (62%), Positives = 173/211 (81%), Gaps = 8/211 (3%)

Query: 1   MSFEGCAKKDSEDVF---LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMAT 57
           MSF      D+++ F   + LVPMV+EQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA 
Sbjct: 1   MSF-----NDTQEQFAPNMALVPMVIEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMAN 55

Query: 58  LICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSL 117
           LI AQ+LFLEAENP+K+I+LYINSPGGV+TAGM+IYDTMQ+IK  +ST CMGQA SMG+ 
Sbjct: 56  LIVAQMLFLEAENPEKDINLYINSPGGVITAGMSIYDTMQYIKADVSTICMGQACSMGAF 115

Query: 118 LLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTY 177
           LLSAG KG R  LPN+R+++HQP GG+ GQA+DI+ HAQ+I+K+K R+NE+  ++ GK+ 
Sbjct: 116 LLSAGAKGKRICLPNSRVMIHQPLGGYQGQATDIQIHAQEILKVKSRMNELMAQHTGKSI 175

Query: 178 EEVEKTLDRDHIMSASEACDWGVVDKVLMSR 208
           EE+E+  +RD  +SA+EA ++G+VDKV   R
Sbjct: 176 EEIERDTERDRFLSANEALEYGLVDKVYTQR 206


>gi|238788008|ref|ZP_04631804.1| ATP-dependent Clp protease proteolytic subunit [Yersinia
           frederiksenii ATCC 33641]
 gi|238723956|gb|EEQ15600.1| ATP-dependent Clp protease proteolytic subunit [Yersinia
           frederiksenii ATCC 33641]
          Length = 194

 Score =  289 bits (739), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 163/193 (84%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI AQ+LFLEAENP+K+I
Sbjct: 1   MALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLITAQMLFLEAENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+AG KG RF LPN+R+
Sbjct: 61  FLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGAKGKRFCLPNSRV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DIE HA++I+K+K R+NE+   + GK+ EE+E+  +RD  +SA +A
Sbjct: 121 MIHQPLGGFQGQATDIEIHAKEILKVKSRMNELMAHHTGKSLEEIERDTERDRFLSAEQA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G+VD V   R
Sbjct: 181 VEYGLVDSVFTRR 193


>gi|15800167|ref|NP_286179.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O157:H7 EDL933]
 gi|15829745|ref|NP_308518.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O157:H7 str. Sakai]
 gi|16128422|ref|NP_414971.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli str. K-12 substr. MG1655]
 gi|26246448|ref|NP_752487.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           CFT073]
 gi|30061939|ref|NP_836110.1| ATP-dependent Clp protease proteolytic subunit [Shigella flexneri
           2a str. 2457T]
 gi|56479658|ref|NP_706331.2| ATP-dependent Clp protease proteolytic subunit [Shigella flexneri
           2a str. 301]
 gi|74311012|ref|YP_309431.1| ATP-dependent Clp protease proteolytic subunit [Shigella sonnei
           Ss046]
 gi|82542925|ref|YP_406872.1| ATP-dependent Clp protease proteolytic subunit [Shigella boydii
           Sb227]
 gi|82775656|ref|YP_402003.1| ATP-dependent Clp protease proteolytic subunit [Shigella
           dysenteriae Sd197]
 gi|89107307|ref|AP_001087.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli str. K-12 substr. W3110]
 gi|91209511|ref|YP_539497.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           UTI89]
 gi|110640698|ref|YP_668426.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           536]
 gi|110804465|ref|YP_687985.1| ATP-dependent Clp protease proteolytic subunit [Shigella flexneri 5
           str. 8401]
 gi|117622697|ref|YP_851610.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           APEC O1]
 gi|157158299|ref|YP_001461624.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           E24377A]
 gi|157159964|ref|YP_001457282.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           HS]
 gi|168754541|ref|ZP_02779548.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC4401]
 gi|168768391|ref|ZP_02793398.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC4486]
 gi|168778128|ref|ZP_02803135.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC4196]
 gi|168778929|ref|ZP_02803936.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC4076]
 gi|168786287|ref|ZP_02811294.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC869]
 gi|170021190|ref|YP_001726144.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           ATCC 8739]
 gi|170080023|ref|YP_001729343.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli str. K-12 substr. DH10B]
 gi|170683276|ref|YP_001742581.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           SMS-3-5]
 gi|187731303|ref|YP_001879148.1| ATP-dependent Clp protease proteolytic subunit [Shigella boydii CDC
           3083-94]
 gi|188492597|ref|ZP_02999867.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli 53638]
 gi|191174674|ref|ZP_03036146.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli F11]
 gi|193064129|ref|ZP_03045213.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli E22]
 gi|195938496|ref|ZP_03083878.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O157:H7 str. EC4024]
 gi|208809540|ref|ZP_03251877.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC4206]
 gi|208815859|ref|ZP_03257038.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC4045]
 gi|208822964|ref|ZP_03263282.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC4042]
 gi|209917654|ref|YP_002291738.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           SE11]
 gi|215485518|ref|YP_002327949.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O127:H6 str. E2348/69]
 gi|217326412|ref|ZP_03442496.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. TW14588]
 gi|218549895|ref|YP_002383686.1| ATP-dependent Clp protease proteolytic subunit [Escherichia
           fergusonii ATCC 35469]
 gi|218553004|ref|YP_002385917.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           IAI1]
 gi|218557347|ref|YP_002390260.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           S88]
 gi|218688301|ref|YP_002396513.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           ED1a]
 gi|218693900|ref|YP_002401567.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           55989]
 gi|218698651|ref|YP_002406280.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           IAI39]
 gi|218703721|ref|YP_002411240.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           UMN026]
 gi|227884552|ref|ZP_04002357.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           83972]
 gi|238899725|ref|YP_002925521.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli BW2952]
 gi|253774574|ref|YP_003037405.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254160506|ref|YP_003043614.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli B
           str. REL606]
 gi|254791621|ref|YP_003076458.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O157:H7 str. TW14359]
 gi|256020408|ref|ZP_05434273.1| ATP-dependent Clp protease proteolytic subunit [Shigella sp. D9]
 gi|256023945|ref|ZP_05437810.1| ATP-dependent Clp protease proteolytic subunit [Escherichia sp.
           4_1_40B]
 gi|260842638|ref|YP_003220416.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O103:H2 str. 12009]
 gi|260853660|ref|YP_003227551.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O26:H11 str. 11368]
 gi|260866598|ref|YP_003233000.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O111:H- str. 11128]
 gi|261223919|ref|ZP_05938200.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli O157:H7 str. FRIK2000]
 gi|261256367|ref|ZP_05948900.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291281344|ref|YP_003498162.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O55:H7 str. CB9615]
 gi|293403558|ref|ZP_06647649.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           FVEC1412]
 gi|293408587|ref|ZP_06652426.1| Clp protease [Escherichia coli B354]
 gi|297516115|ref|ZP_06934501.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           OP50]
 gi|298379170|ref|ZP_06989051.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           FVEC1302]
 gi|300818231|ref|ZP_07098442.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 107-1]
 gi|300820317|ref|ZP_07100469.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 119-7]
 gi|300903295|ref|ZP_07121223.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 84-1]
 gi|300918180|ref|ZP_07134787.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 115-1]
 gi|300930260|ref|ZP_07145673.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 187-1]
 gi|300947910|ref|ZP_07162058.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 116-1]
 gi|301025667|ref|ZP_07189185.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 196-1]
 gi|301330696|ref|ZP_07223298.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 78-1]
 gi|306813096|ref|ZP_07447289.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           NC101]
 gi|307137081|ref|ZP_07496437.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           H736]
 gi|307312185|ref|ZP_07591821.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli W]
 gi|309794830|ref|ZP_07689251.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 145-7]
 gi|331640957|ref|ZP_08342092.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli H736]
 gi|331645613|ref|ZP_08346717.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli M605]
 gi|331651375|ref|ZP_08352400.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli M718]
 gi|331656494|ref|ZP_08357456.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli TA206]
 gi|331661818|ref|ZP_08362741.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli TA143]
 gi|331666792|ref|ZP_08367666.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli TA271]
 gi|331671984|ref|ZP_08372780.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli TA280]
 gi|331676109|ref|ZP_08376821.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli H591]
 gi|331681832|ref|ZP_08382465.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli H299]
 gi|62288033|sp|P0A6G7|CLPP_ECOLI RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Caseinolytic protease; AltName:
           Full=Endopeptidase Clp; AltName: Full=Heat shock protein
           F21.5; AltName: Full=Protease Ti; Flags: Precursor
 gi|62288034|sp|P0A6G8|CLPP_ECOL6 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp; Flags: Precursor
 gi|62288035|sp|P0A6G9|CLPP_ECO57 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp; Flags: Precursor
 gi|62288036|sp|P0A6H0|CLPP_SHIFL RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|90183183|sp|Q325G4|CLPP_SHIBS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|90183184|sp|Q32JJ3|CLPP_SHIDS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|110816465|sp|Q3Z4W6|CLPP_SHISS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|116243134|sp|Q0TKK4|CLPP_ECOL5 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp; Flags: Precursor
 gi|116243136|sp|Q1RF98|CLPP_ECOUT RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp; Flags: Precursor
 gi|122957620|sp|Q0T7E6|CLPP_SHIF8 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166201821|sp|A1A8A6|CLPP_ECOK1 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|167008648|sp|A7ZIJ5|CLPP_ECO24 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|167008649|sp|A7ZX95|CLPP_ECOHS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|189082457|sp|B1J011|CLPP_ECOLC RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|310942734|pdb|3MT6|R Chain R, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942735|pdb|3MT6|S Chain S, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942736|pdb|3MT6|T Chain T, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942737|pdb|3MT6|U Chain U, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942738|pdb|3MT6|O Chain O, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942739|pdb|3MT6|P Chain P, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942740|pdb|3MT6|Q Chain Q, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942741|pdb|3MT6|Y Chain Y, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942742|pdb|3MT6|Z Chain Z, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942743|pdb|3MT6|AA Chain a, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942744|pdb|3MT6|BB Chain b, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942745|pdb|3MT6|V Chain V, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942746|pdb|3MT6|W Chain W, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942747|pdb|3MT6|X Chain X, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942748|pdb|3MT6|M Chain M, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942749|pdb|3MT6|L Chain L, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942750|pdb|3MT6|K Chain K, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942751|pdb|3MT6|J Chain J, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942752|pdb|3MT6|I Chain I, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942753|pdb|3MT6|H Chain H, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942754|pdb|3MT6|N Chain N, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942755|pdb|3MT6|F Chain F, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942756|pdb|3MT6|E Chain E, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942757|pdb|3MT6|D Chain D, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942758|pdb|3MT6|C Chain C, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942759|pdb|3MT6|B Chain B, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942760|pdb|3MT6|A Chain A, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942761|pdb|3MT6|G Chain G, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|12513299|gb|AAG54787.1|AE005223_2 ATP-dependent proteolytic subunit of clpA-clpP serine protease,
           heat shock protein F21.5 [Escherichia coli O157:H7 str.
           EDL933]
 gi|26106846|gb|AAN79031.1|AE016756_214 ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           CFT073]
 gi|145556|gb|AAA23588.1| ATP-dependent protease (clpP) [Escherichia coli]
 gi|1773121|gb|AAB40193.1| ATP-dependent Clp proteinase [Escherichia coli]
 gi|1786641|gb|AAC73540.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli str. K-12 substr. MG1655]
 gi|13359948|dbj|BAB33914.1| ATP-dependent proteolytic subunit of clpA-clpP serine protease ClpP
           [Escherichia coli O157:H7 str. Sakai]
 gi|30040183|gb|AAP15916.1| ATP-dependent proteolytic subunit of clpA-clpP serine protease,
           heat shock protein F21.5 [Shigella flexneri 2a str.
           2457T]
 gi|56383209|gb|AAN42038.2| ATP-dependent proteolytic subunit of clpA-clpP serine protease,
           heat shock protein F21.5 [Shigella flexneri 2a str. 301]
 gi|73854489|gb|AAZ87196.1| ATP-dependent proteolytic subunit of clpA-clpP serine protease
           [Shigella sonnei Ss046]
 gi|81239804|gb|ABB60514.1| ATP-dependent proteolytic subunit of clpA-clpP serine protease
           [Shigella dysenteriae Sd197]
 gi|81244336|gb|ABB65044.1| ATP-dependent proteolytic subunit of clpA-clpP serine protease
           [Shigella boydii Sb227]
 gi|85674577|dbj|BAE76217.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli str. K12 substr. W3110]
 gi|91071085|gb|ABE05966.1| ATP-dependent proteolytic subunit of clpA-ClpP serine protease,
           heat shock protein F21.5 [Escherichia coli UTI89]
 gi|110342290|gb|ABG68527.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           536]
 gi|110614013|gb|ABF02680.1| ATP-dependent proteolytic subunit of clpA-clpP serine protease
           [Shigella flexneri 5 str. 8401]
 gi|115511821|gb|ABI99895.1| ATP-dependent proteolytic subunit of ClpA-ClpP serine protease
           [Escherichia coli APEC O1]
 gi|157065644|gb|ABV04899.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli HS]
 gi|157080329|gb|ABV20037.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli E24377A]
 gi|169756118|gb|ACA78817.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli ATCC 8739]
 gi|169887858|gb|ACB01565.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli str. K-12 substr. DH10B]
 gi|170520994|gb|ACB19172.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli SMS-3-5]
 gi|187428295|gb|ACD07569.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shigella
           boydii CDC 3083-94]
 gi|187766815|gb|EDU30659.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC4196]
 gi|188487796|gb|EDU62899.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli 53638]
 gi|189003087|gb|EDU72073.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC4076]
 gi|189358046|gb|EDU76465.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC4401]
 gi|189362475|gb|EDU80894.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC4486]
 gi|189373600|gb|EDU92016.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC869]
 gi|190905047|gb|EDV64714.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli F11]
 gi|192929158|gb|EDV82768.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli E22]
 gi|208729341|gb|EDZ78942.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC4206]
 gi|208732507|gb|EDZ81195.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC4045]
 gi|208737157|gb|EDZ84841.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC4042]
 gi|209743854|gb|ACI70234.1| ATP-dependent proteolytic subunit of clpA-clpP serine protease ClpP
           [Escherichia coli]
 gi|209743856|gb|ACI70235.1| ATP-dependent proteolytic subunit of clpA-clpP serine protease ClpP
           [Escherichia coli]
 gi|209743858|gb|ACI70236.1| ATP-dependent proteolytic subunit of clpA-clpP serine protease ClpP
           [Escherichia coli]
 gi|209743860|gb|ACI70237.1| ATP-dependent proteolytic subunit of clpA-clpP serine protease ClpP
           [Escherichia coli]
 gi|209743862|gb|ACI70238.1| ATP-dependent proteolytic subunit of clpA-clpP serine protease ClpP
           [Escherichia coli]
 gi|209910913|dbj|BAG75987.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           SE11]
 gi|215263590|emb|CAS07920.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli O127:H6 str. E2348/69]
 gi|217322633|gb|EEC31057.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. TW14588]
 gi|218350632|emb|CAU96324.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli 55989]
 gi|218357436|emb|CAQ90075.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia fergusonii ATCC 35469]
 gi|218359772|emb|CAQ97313.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli IAI1]
 gi|218364116|emb|CAR01781.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli S88]
 gi|218368637|emb|CAR16376.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli IAI39]
 gi|218425865|emb|CAR06671.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli ED1a]
 gi|218430818|emb|CAR11692.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli UMN026]
 gi|222032232|emb|CAP74971.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           LF82]
 gi|227838638|gb|EEJ49104.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           83972]
 gi|238863325|gb|ACR65323.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli BW2952]
 gi|242376218|emb|CAQ30909.1| clpP, subunit of ClpP serine protease, ClpAP, ClpXP and ClpAXP
           [Escherichia coli BL21(DE3)]
 gi|253325618|gb|ACT30220.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli 'BL21-Gold(DE3)pLysS AG']
 gi|253972407|gb|ACT38078.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli B
           str. REL606]
 gi|253976617|gb|ACT42287.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           BL21(DE3)]
 gi|254591021|gb|ACT70382.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli O157:H7 str. TW14359]
 gi|257752309|dbj|BAI23811.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O26:H11 str. 11368]
 gi|257757785|dbj|BAI29282.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O103:H2 str. 12009]
 gi|257762954|dbj|BAI34449.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O111:H- str. 11128]
 gi|260450376|gb|ACX40798.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli DH1]
 gi|281177608|dbj|BAI53938.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           SE15]
 gi|281599777|gb|ADA72761.1| ATP-dependent Clp protease proteolytic subunit [Shigella flexneri
           2002017]
 gi|284920247|emb|CBG33306.1| ATP-dependent clp protease proteolytic subunit [Escherichia coli
           042]
 gi|290761217|gb|ADD55178.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O55:H7 str. CB9615]
 gi|291429411|gb|EFF02431.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           FVEC1412]
 gi|291471765|gb|EFF14248.1| Clp protease [Escherichia coli B354]
 gi|294492533|gb|ADE91289.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli IHE3034]
 gi|298280283|gb|EFI21787.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           FVEC1302]
 gi|299880021|gb|EFI88232.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 196-1]
 gi|300404590|gb|EFJ88128.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 84-1]
 gi|300414631|gb|EFJ97941.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 115-1]
 gi|300452510|gb|EFK16130.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 116-1]
 gi|300461832|gb|EFK25325.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 187-1]
 gi|300527102|gb|EFK48171.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 119-7]
 gi|300529122|gb|EFK50184.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 107-1]
 gi|300843357|gb|EFK71117.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 78-1]
 gi|305853859|gb|EFM54298.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           NC101]
 gi|306907687|gb|EFN38189.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli W]
 gi|307552344|gb|ADN45119.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           ABU 83972]
 gi|307628093|gb|ADN72397.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           UM146]
 gi|308121483|gb|EFO58745.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 145-7]
 gi|309700698|emb|CBI99994.1| ATP-dependent clp protease proteolytic subunit [Escherichia coli
           ETEC H10407]
 gi|312945015|gb|ADR25842.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O83:H1 str. NRG 857C]
 gi|315059717|gb|ADT74044.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli W]
 gi|315135119|dbj|BAJ42278.1| conserved hypothetical protein [Escherichia coli DH1]
 gi|320173743|gb|EFW48926.1| ATP-dependent Clp protease proteolytic subunit [Shigella
           dysenteriae CDC 74-1112]
 gi|320178281|gb|EFW53255.1| ATP-dependent Clp protease proteolytic subunit [Shigella boydii
           ATCC 9905]
 gi|320186067|gb|EFW60812.1| ATP-dependent Clp protease proteolytic subunit [Shigella flexneri
           CDC 796-83]
 gi|320192853|gb|EFW67493.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O157:H7 str. EC1212]
 gi|320197089|gb|EFW71708.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           WV_060327]
 gi|320201681|gb|EFW76257.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           EC4100B]
 gi|320638432|gb|EFX08146.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O157:H7 str. G5101]
 gi|320643812|gb|EFX12935.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O157:H- str. 493-89]
 gi|320649163|gb|EFX17741.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O157:H- str. H 2687]
 gi|320656056|gb|EFX23972.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O55:H7 str. 3256-97 TW 07815]
 gi|320661206|gb|EFX28637.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O55:H7 str. USDA 5905]
 gi|320665182|gb|EFX32275.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O157:H7 str. LSU-61]
 gi|323379718|gb|ADX51986.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli KO11]
 gi|323938623|gb|EGB34872.1| Clp protease [Escherichia coli E1520]
 gi|323943244|gb|EGB39400.1| Clp protease [Escherichia coli E482]
 gi|323945342|gb|EGB41398.1| Clp protease [Escherichia coli H120]
 gi|323952951|gb|EGB48819.1| Clp protease [Escherichia coli H252]
 gi|323958630|gb|EGB54333.1| Clp protease [Escherichia coli H263]
 gi|323963427|gb|EGB58989.1| Clp protease [Escherichia coli H489]
 gi|323965124|gb|EGB60583.1| Clp protease [Escherichia coli M863]
 gi|323972291|gb|EGB67501.1| Clp protease [Escherichia coli TA007]
 gi|323976078|gb|EGB71171.1| Clp protease [Escherichia coli TW10509]
 gi|324114664|gb|EGC08632.1| Clp protease [Escherichia fergusonii B253]
 gi|324116925|gb|EGC10838.1| Clp protease [Escherichia coli E1167]
 gi|326341201|gb|EGD64993.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O157:H7 str. 1044]
 gi|326346024|gb|EGD69763.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O157:H7 str. 1125]
 gi|330910231|gb|EGH38741.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           AA86]
 gi|331037755|gb|EGI09975.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli H736]
 gi|331045775|gb|EGI17901.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli M605]
 gi|331051116|gb|EGI23168.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli M718]
 gi|331054742|gb|EGI26751.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli TA206]
 gi|331060240|gb|EGI32204.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli TA143]
 gi|331066016|gb|EGI37900.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli TA271]
 gi|331070973|gb|EGI42332.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli TA280]
 gi|331076167|gb|EGI47449.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli H591]
 gi|331081034|gb|EGI52199.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli H299]
          Length = 207

 Score =  288 bits (738), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 173/208 (83%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SA EA ++G+VD +L  R
Sbjct: 179 ERDTERDRFLSAPEAVEYGLVDSILTHR 206


>gi|300721991|ref|YP_003711271.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease
           [Xenorhabdus nematophila ATCC 19061]
 gi|297628488|emb|CBJ89055.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease
           [Xenorhabdus nematophila ATCC 19061]
          Length = 207

 Score =  288 bits (738), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 131/208 (62%), Positives = 170/208 (81%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  K+D     + LVPMVVEQT RGER++DIYSRLLK+RI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--KQDQYAPNMSLVPMVVEQTARGERAFDIYSRLLKDRIIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMGS LL+
Sbjct: 59  AQMLFLEAENPEKDIHLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGSFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG +G RF LPN+R+++HQP GGF GQA+DI+ HAQ+I+K+K R+NE+  K+ G+  +++
Sbjct: 119 AGAEGKRFCLPNSRVMIHQPLGGFQGQATDIQIHAQEILKVKARMNELMAKHTGQPLDKI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SASEA D+G+VD +   R
Sbjct: 179 EEDTERDRFLSASEAVDYGLVDSIFTQR 206


>gi|238764860|ref|ZP_04625801.1| ATP-dependent Clp protease proteolytic subunit [Yersinia
           kristensenii ATCC 33638]
 gi|238696967|gb|EEP89743.1| ATP-dependent Clp protease proteolytic subunit [Yersinia
           kristensenii ATCC 33638]
          Length = 207

 Score =  288 bits (738), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 170/208 (81%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D     + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDQFAPNMALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLIT 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIFLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GGF GQA+DIE HA++I+K+K R+NE+   + GK+ EE+
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAREILKVKSRMNELMALHTGKSLEEI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SA +A ++G+VD V   R
Sbjct: 179 ERDTERDRFLSAEQAVEYGLVDSVFTRR 206


>gi|238783609|ref|ZP_04627630.1| ATP-dependent Clp protease proteolytic subunit [Yersinia bercovieri
           ATCC 43970]
 gi|238715487|gb|EEQ07478.1| ATP-dependent Clp protease proteolytic subunit [Yersinia bercovieri
           ATCC 43970]
          Length = 207

 Score =  288 bits (738), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 133/208 (63%), Positives = 169/208 (81%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D     + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDQFAPNMALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLIT 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIFLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GGF GQA+DIE HA++I+K+K R+NE+   + GK+ EE+
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAREILKVKSRMNELMALHTGKSLEEI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SA EA  +G+VD V   R
Sbjct: 179 ERDTERDRFLSAEEAVGYGLVDSVFTRR 206


>gi|83954269|ref|ZP_00962989.1| Protease subunit of ATP-dependent Clp protease [Sulfitobacter sp.
           NAS-14.1]
 gi|83841306|gb|EAP80476.1| Protease subunit of ATP-dependent Clp protease [Sulfitobacter sp.
           NAS-14.1]
          Length = 219

 Score =  288 bits (738), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 131/200 (65%), Positives = 168/200 (84%), Gaps = 1/200 (0%)

Query: 10  DSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           D  D ++  LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D M++LI AQLL LEA
Sbjct: 3   DPHDTYMNTLVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLIVAQLLHLEA 62

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP KEIS+YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL AGEKGMRF
Sbjct: 63  ENPSKEISMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLQAGEKGMRF 122

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           +LPN+R+++HQPSGG+ GQA+DI  HAQ+  K+K RLNEIYVK+ G+  E+VE  L+RD+
Sbjct: 123 SLPNSRVMVHQPSGGYQGQATDIMIHAQETQKLKTRLNEIYVKHTGQPLEKVEAALERDN 182

Query: 189 IMSASEACDWGVVDKVLMSR 208
            MS  EA DWG++D+++ +R
Sbjct: 183 FMSPEEAKDWGLIDEIVENR 202


>gi|183601061|ref|ZP_02962554.1| hypothetical protein PROSTU_04684 [Providencia stuartii ATCC 25827]
 gi|188019401|gb|EDU57441.1| hypothetical protein PROSTU_04684 [Providencia stuartii ATCC 25827]
          Length = 206

 Score =  288 bits (738), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 163/193 (84%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMV+EQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA LI AQ+LFLEAENP+K+I
Sbjct: 14  MALVPMVIEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLIVAQMLFLEAENPEKDI 73

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMGS LL+AG KG RF LPN+R+
Sbjct: 74  QLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGSFLLAAGTKGKRFCLPNSRV 133

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG+ GQA+DI+ HAQ+I+K+K R+NE+   + GK+ EE+ +  +RD  +SA EA
Sbjct: 134 MIHQPLGGYQGQATDIQIHAQEILKVKTRMNELMALHTGKSVEEINRDTERDRFLSADEA 193

Query: 196 CDWGVVDKVLMSR 208
            ++G+VD +  SR
Sbjct: 194 KEYGLVDHIYTSR 206


>gi|270263570|ref|ZP_06191839.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Serratia
           odorifera 4Rx13]
 gi|270042454|gb|EFA15549.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Serratia
           odorifera 4Rx13]
          Length = 207

 Score =  288 bits (738), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 131/208 (62%), Positives = 172/208 (82%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D     + LVPMVVEQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDQFAPNMALVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAE+P+K+I LYINSPGGV+TAGM+IYDTM+FIKP +ST CMGQA SMGS LL+
Sbjct: 59  AQMLFLEAESPEKDIYLYINSPGGVITAGMSIYDTMKFIKPDVSTICMGQACSMGSFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+  ++ G+T E++
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKARMNELMAEHTGQTLEQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  M+A EA ++G+VD +L  R
Sbjct: 179 ERDTERDRFMTAEEAVEYGLVDGILTHR 206


>gi|85704731|ref|ZP_01035832.1| Protease subunit of ATP-dependent Clp protease [Roseovarius sp.
           217]
 gi|85670549|gb|EAQ25409.1| Protease subunit of ATP-dependent Clp protease [Roseovarius sp.
           217]
          Length = 210

 Score =  288 bits (737), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 176/209 (84%), Gaps = 1/209 (0%)

Query: 9   KDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           KD  D+++  LVPMVVEQT+RGER+YDI+SRLLKERI+F++G + D M++LI AQLL LE
Sbjct: 2   KDPMDIYMNTLVPMVVEQTSRGERAYDIFSRLLKERIIFLSGPVHDGMSSLIVAQLLHLE 61

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP KEIS+YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AGE GMR
Sbjct: 62  AENPSKEISMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVVGQAASMGSLLLTAGEPGMR 121

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPN+R+++HQPSGG+ GQA+DI  HA++  K+K RLNEIYV++ G+T ++VE+ L+RD
Sbjct: 122 FSLPNSRVMVHQPSGGYQGQATDIMIHARETQKLKDRLNEIYVRHTGQTLKKVEEALERD 181

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           + MS  EA  WG++D+++ +R  ++E  K
Sbjct: 182 NFMSPDEAKAWGLIDEIVANRDKVDEAKK 210


>gi|83592885|ref|YP_426637.1| ATP-dependent Clp protease proteolytic subunit ClpP [Rhodospirillum
           rubrum ATCC 11170]
 gi|124013826|sp|Q2RU45|CLPP_RHORT RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|83575799|gb|ABC22350.1| ATP-dependent Clp protease proteolytic subunit ClpP [Rhodospirillum
           rubrum ATCC 11170]
          Length = 216

 Score =  288 bits (737), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 134/201 (66%), Positives = 167/201 (83%), Gaps = 1/201 (0%)

Query: 9   KDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           +D  DVF   LVPMVVEQTNRGERSYDIYSRLLKERI+F+TGQ+ D +A+LICAQLLFLE
Sbjct: 4   RDPIDVFNNTLVPMVVEQTNRGERSYDIYSRLLKERIIFLTGQVHDGVASLICAQLLFLE 63

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           +ENP K+IS YINSPGGVVT+GMAIYDTMQ+I+ P+ST C+GQAASMGSLLL AGE G R
Sbjct: 64  SENPSKDISFYINSPGGVVTSGMAIYDTMQYIRSPVSTVCIGQAASMGSLLLCAGEAGKR 123

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           +A PNARI++HQPSGGF GQA+DIE  A++I+ ++ RLN IYVK+ G+  E +E+ +DRD
Sbjct: 124 YATPNARIMIHQPSGGFQGQAADIEIQAREILALRERLNRIYVKHTGQPLETIERAMDRD 183

Query: 188 HIMSASEACDWGVVDKVLMSR 208
           + M+A E+  +G+ D V+  R
Sbjct: 184 NYMTAEESRAFGLTDSVIERR 204


>gi|56414396|ref|YP_151471.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|197363316|ref|YP_002142953.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|67460194|sp|Q5PFN4|CLPP_SALPA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp; Flags: Precursor
 gi|226706471|sp|B5BD83|CLPP_SALPK RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|56128653|gb|AAV78159.1| ATP-dependent clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|197094793|emb|CAR60326.1| ATP-dependent clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
          Length = 207

 Score =  288 bits (737), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 128/208 (61%), Positives = 173/208 (83%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAG++IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGISIYDTMQFIKPDVSTICMGQAASMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SA EA ++G+VD +L  R
Sbjct: 179 ERDTERDRFLSAPEAVEYGLVDSILTHR 206


>gi|205351759|ref|YP_002225560.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|205271540|emb|CAR36358.1| ATP-dependent clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
          Length = 207

 Score =  288 bits (737), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 172/208 (82%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  + D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ELDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SA EA ++G+VD +L  R
Sbjct: 179 ERDTERDRFLSAPEAVEYGLVDSILTHR 206


>gi|152968972|ref|YP_001334081.1| ATP-dependent Clp protease proteolytic subunit [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|262042473|ref|ZP_06015632.1| ATP-dependent Clp protease [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|330011533|ref|ZP_08307119.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Klebsiella sp. MS 92-3]
 gi|150953821|gb|ABR75851.1| ATP-dependent Clp protease proteolytic subunit [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|259040177|gb|EEW41289.1| ATP-dependent Clp protease [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328534150|gb|EGF60785.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Klebsiella sp. MS 92-3]
          Length = 194

 Score =  288 bits (737), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 125/193 (64%), Positives = 166/193 (86%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI AQ+LFLEAENP+K+I
Sbjct: 1   MALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+AG KG RF LPN+R+
Sbjct: 61  YLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++E+  +RD  +SA+EA
Sbjct: 121 MIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQIERDTERDRFLSAAEA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G+VD +L  R
Sbjct: 181 VEYGLVDSILTHR 193


>gi|261822507|ref|YP_003260613.1| ATP-dependent Clp protease proteolytic subunit [Pectobacterium
           wasabiae WPP163]
 gi|261606520|gb|ACX89006.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Pectobacterium wasabiae WPP163]
          Length = 207

 Score =  288 bits (737), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 130/208 (62%), Positives = 171/208 (82%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  +++ +   + LVPMVVEQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA L+ 
Sbjct: 1   MSYSG--EQERQAPHMALVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG R  LPN+R+++HQP GGF GQA+DIE HA++I+K+K ++NE+  K+ G+  E +
Sbjct: 119 AGAKGKRICLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKAKMNELMAKHTGQPLEAI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SASEA ++G+VD V  +R
Sbjct: 179 ERDTERDRFLSASEAVEYGLVDSVFTNR 206


>gi|311280666|ref|YP_003942897.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Enterobacter
           cloacae SCF1]
 gi|308749861|gb|ADO49613.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Enterobacter
           cloacae SCF1]
          Length = 207

 Score =  288 bits (736), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 128/208 (61%), Positives = 172/208 (82%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+  ++ G++  ++
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKARMNELMAQHTGQSLAQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E   +RD  +SA EA ++G+VD +L  R
Sbjct: 179 ESDTERDRFLSAPEAVEYGLVDSILTHR 206


>gi|238795542|ref|ZP_04639057.1| ATP-dependent Clp protease proteolytic subunit [Yersinia mollaretii
           ATCC 43969]
 gi|238720661|gb|EEQ12462.1| ATP-dependent Clp protease proteolytic subunit [Yersinia mollaretii
           ATCC 43969]
          Length = 194

 Score =  288 bits (736), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 129/193 (66%), Positives = 162/193 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI AQ+LFLEAENP+K+I
Sbjct: 1   MALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLITAQMLFLEAENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+AG KG RF LPN+R+
Sbjct: 61  FLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGAKGKRFCLPNSRV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DIE HA++I+K+K R+NE+   + GK+ EE+E+  +RD  +SA EA
Sbjct: 121 MIHQPLGGFQGQATDIEIHAREILKVKSRMNELMALHTGKSLEEIERDTERDRFLSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G+VD V   R
Sbjct: 181 VGYGLVDSVFTRR 193


>gi|157369338|ref|YP_001477327.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Serratia
           proteamaculans 568]
 gi|157321102|gb|ABV40199.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Serratia
           proteamaculans 568]
          Length = 207

 Score =  288 bits (736), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 131/208 (62%), Positives = 172/208 (82%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D     + LVPMVVEQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDQFAPNMALVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAE+P+K+I LYINSPGGV+TAGM+IYDTM+FIKP +ST CMGQA SMGS LL+
Sbjct: 59  AQMLFLEAESPEKDIFLYINSPGGVITAGMSIYDTMKFIKPDVSTICMGQACSMGSFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+  ++ G+T E++
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKARMNELMAEHTGQTLEQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  M+A EA ++G+VD +L  R
Sbjct: 179 ERDTERDRFMTAEEAVEYGLVDGILTHR 206


>gi|326626794|gb|EGE33137.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 9]
          Length = 246

 Score =  288 bits (736), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 172/208 (82%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  + D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 40  MSYSG--ELDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 97

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 98  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 157

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 158 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 217

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SA EA ++G+VD +L  R
Sbjct: 218 ERDTERDRFLSAPEAVEYGLVDSILTHR 245


>gi|22124934|ref|NP_668357.1| ATP-dependent Clp protease proteolytic subunit [Yersinia pestis KIM
           10]
 gi|45440623|ref|NP_992162.1| ATP-dependent Clp protease proteolytic subunit [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51595309|ref|YP_069500.1| ATP-dependent Clp protease proteolytic subunit [Yersinia
           pseudotuberculosis IP 32953]
 gi|108808643|ref|YP_652559.1| ATP-dependent Clp protease proteolytic subunit [Yersinia pestis
           Antiqua]
 gi|108811098|ref|YP_646865.1| ATP-dependent Clp protease proteolytic subunit [Yersinia pestis
           Nepal516]
 gi|145600052|ref|YP_001164128.1| ATP-dependent Clp protease proteolytic subunit [Yersinia pestis
           Pestoides F]
 gi|149364997|ref|ZP_01887032.1| ATP-dependent Clp protease proteolytic subunit ClpP [Yersinia
           pestis CA88-4125]
 gi|153950622|ref|YP_001402052.1| ATP-dependent Clp protease proteolytic subunit [Yersinia
           pseudotuberculosis IP 31758]
 gi|162419837|ref|YP_001607420.1| ATP-dependent Clp protease proteolytic subunit [Yersinia pestis
           Angola]
 gi|165926613|ref|ZP_02222445.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis biovar Orientalis str. F1991016]
 gi|165935884|ref|ZP_02224454.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis biovar Orientalis str. IP275]
 gi|166010967|ref|ZP_02231865.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis biovar Antiqua str. E1979001]
 gi|166212961|ref|ZP_02238996.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis biovar Antiqua str. B42003004]
 gi|167398957|ref|ZP_02304481.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis biovar Antiqua str. UG05-0454]
 gi|167421692|ref|ZP_02313445.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis biovar Orientalis str. MG05-1020]
 gi|167423463|ref|ZP_02315216.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis biovar Mediaevalis str. K1973002]
 gi|170025451|ref|YP_001721956.1| ATP-dependent Clp protease proteolytic subunit [Yersinia
           pseudotuberculosis YPIII]
 gi|186894326|ref|YP_001871438.1| ATP-dependent Clp protease proteolytic subunit [Yersinia
           pseudotuberculosis PB1/+]
 gi|218930187|ref|YP_002348062.1| ATP-dependent Clp protease proteolytic subunit [Yersinia pestis
           CO92]
 gi|229838761|ref|ZP_04458920.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229896085|ref|ZP_04511255.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Yersinia pestis Pestoides A]
 gi|229899329|ref|ZP_04514472.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229901327|ref|ZP_04516449.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Yersinia pestis Nepal516]
 gi|270489513|ref|ZP_06206587.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis KIM D27]
 gi|294504888|ref|YP_003568950.1| ATP-dependent Clp protease proteolytic subunit [Yersinia pestis
           Z176003]
 gi|21759072|sp|Q8ZC65|CLPP_YERPE RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|60389537|sp|Q66DT4|CLPP_YERPS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|122980282|sp|Q1CL65|CLPP_YERPN RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|123072666|sp|Q1C4K8|CLPP_YERPA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166214723|sp|A4TPE3|CLPP_YERPP RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|167008652|sp|A7FLC4|CLPP_YERP3 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|21957773|gb|AAM84608.1|AE013706_3 ATP-dependent proteolytic subunit of clpA-clpP serine protease,
           heat shock protein F21.5 [Yersinia pestis KIM 10]
 gi|45435480|gb|AAS61039.1| ATP-dependent Clp protease proteolytic subunit ClpP [Yersinia
           pestis biovar Microtus str. 91001]
 gi|51588591|emb|CAH20199.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease,
           heat shock protein F21.5 [Yersinia pseudotuberculosis IP
           32953]
 gi|108774746|gb|ABG17265.1| ATP-dependent Clp protease proteolytic subunit ClpP [Yersinia
           pestis Nepal516]
 gi|108780556|gb|ABG14614.1| ATP-dependent Clp protease proteolytic subunit ClpP [Yersinia
           pestis Antiqua]
 gi|115348798|emb|CAL21752.1| ATP-dependent Clp protease proteolytic subunit ClpP [Yersinia
           pestis CO92]
 gi|145211748|gb|ABP41155.1| ATP-dependent Clp protease proteolytic subunit ClpP [Yersinia
           pestis Pestoides F]
 gi|149291410|gb|EDM41484.1| ATP-dependent Clp protease proteolytic subunit ClpP [Yersinia
           pestis CA88-4125]
 gi|152962117|gb|ABS49578.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pseudotuberculosis IP 31758]
 gi|162352652|gb|ABX86600.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis Angola]
 gi|165916029|gb|EDR34636.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis biovar Orientalis str. IP275]
 gi|165921541|gb|EDR38738.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis biovar Orientalis str. F1991016]
 gi|165989967|gb|EDR42268.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis biovar Antiqua str. E1979001]
 gi|166205748|gb|EDR50228.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis biovar Antiqua str. B42003004]
 gi|166960611|gb|EDR56632.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis biovar Orientalis str. MG05-1020]
 gi|167051461|gb|EDR62869.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis biovar Antiqua str. UG05-0454]
 gi|167057633|gb|EDR67379.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis biovar Mediaevalis str. K1973002]
 gi|169751985|gb|ACA69503.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pseudotuberculosis YPIII]
 gi|186697352|gb|ACC87981.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pseudotuberculosis PB1/+]
 gi|229681256|gb|EEO77350.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Yersinia pestis Nepal516]
 gi|229687731|gb|EEO79804.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229695127|gb|EEO85174.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229701008|gb|EEO89037.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Yersinia pestis Pestoides A]
 gi|262362954|gb|ACY59675.1| ATP-dependent Clp protease proteolytic subunit [Yersinia pestis
           D106004]
 gi|262366873|gb|ACY63430.1| ATP-dependent Clp protease proteolytic subunit [Yersinia pestis
           D182038]
 gi|270338017|gb|EFA48794.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis KIM D27]
 gi|294355347|gb|ADE65688.1| ATP-dependent Clp protease proteolytic subunit [Yersinia pestis
           Z176003]
 gi|320016343|gb|ADV99914.1| ATP-dependent Clp protease proteolytic subunit [Yersinia pestis
           biovar Medievalis str. Harbin 35]
          Length = 207

 Score =  288 bits (736), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 131/208 (62%), Positives = 170/208 (81%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D     + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDQFAPNMALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLIT 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIFLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GGF GQA+DIE HA++I+K+K R+NE+   + GK+ EE+
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKSRMNELMAYHTGKSLEEI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SA ++ ++G+VD V   R
Sbjct: 179 ERDTERDRFLSAEQSVEYGLVDSVFTRR 206


>gi|294635324|ref|ZP_06713821.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Edwardsiella
           tarda ATCC 23685]
 gi|291091300|gb|EFE23861.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Edwardsiella
           tarda ATCC 23685]
          Length = 194

 Score =  287 bits (735), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 161/193 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI AQ+LFLEAENP+K+I
Sbjct: 1   MALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLIVAQMLFLEAENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMGS LL+AG +G RF LPN+R+
Sbjct: 61  HLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGSFLLAAGAQGKRFCLPNSRV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DIE HA++I+ IK R+N +  K+ G+  E +E+  +RD  MSA EA
Sbjct: 121 MIHQPLGGFQGQATDIEIHAKEILSIKARMNTLMAKHSGQPLEVIERDTERDRFMSAQEA 180

Query: 196 CDWGVVDKVLMSR 208
            D+G+VD VL  R
Sbjct: 181 VDYGLVDAVLTQR 193


>gi|159043937|ref|YP_001532731.1| ATP-dependent Clp protease proteolytic subunit [Dinoroseobacter
           shibae DFL 12]
 gi|189082456|sp|A8LJA8|CLPP_DINSH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|157911697|gb|ABV93130.1| endopeptidase Clp [Dinoroseobacter shibae DFL 12]
          Length = 208

 Score =  287 bits (735), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 132/207 (63%), Positives = 172/207 (83%), Gaps = 1/207 (0%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           D  D ++ LVPMVVEQT+RGER+YDI+SRLLKERIVFV G + D M+ L+ AQLL LEAE
Sbjct: 3   DPVDTYMNLVPMVVEQTSRGERAYDIFSRLLKERIVFVNGPVHDGMSQLVVAQLLHLEAE 62

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP KEIS+YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AGEKGMRF+
Sbjct: 63  NPSKEISMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVVGQAASMGSLLLTAGEKGMRFS 122

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPN+RI++HQPSGG+ GQA+DI  HAQ+  K+K RLN+IYVK+ G+  ++V   L+RD+ 
Sbjct: 123 LPNSRIMVHQPSGGYQGQATDIMIHAQETQKLKDRLNQIYVKHTGQPLKKVVDALERDNF 182

Query: 190 MSASEACDWGVVDKVLMSRIDIEEKSK 216
           M A +A +WG++D+++ SR + E+ SK
Sbjct: 183 MDAEQAKEWGLIDEIVESRAN-EDTSK 208


>gi|322834046|ref|YP_004214073.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Rahnella sp.
           Y9602]
 gi|321169247|gb|ADW74946.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Rahnella sp.
           Y9602]
          Length = 207

 Score =  287 bits (735), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 163/193 (84%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI AQ+LFLEAE+P+K+I
Sbjct: 14  MALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLIVAQMLFLEAESPEKDI 73

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+AG +G RF LPN+R+
Sbjct: 74  YLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGAEGKRFCLPNSRV 133

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DIE HA++I+K+K R+NE+  K+ GK+ EE+E+  +RD  +SA EA
Sbjct: 134 MIHQPLGGFQGQATDIEIHAKEILKVKSRMNELMAKHTGKSLEEIERDTERDRFLSADEA 193

Query: 196 CDWGVVDKVLMSR 208
             +G+VD V   R
Sbjct: 194 VQYGLVDSVFTHR 206


>gi|83311891|ref|YP_422155.1| protease subunit of ATP-dependent Clp protease [Magnetospirillum
           magneticum AMB-1]
 gi|82946732|dbj|BAE51596.1| Protease subunit of ATP-dependent Clp protease [Magnetospirillum
           magneticum AMB-1]
          Length = 244

 Score =  287 bits (735), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 177/209 (84%), Gaps = 1/209 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
           ++D  D+++  LVPMVVEQTNRGERSYDIYSRLLKERI+F+TGQ+ D +A+LICAQLLFL
Sbjct: 34  ERDPIDLYMNTLVPMVVEQTNRGERSYDIYSRLLKERIIFLTGQVYDEVASLICAQLLFL 93

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP K+I+ YINSPGGVVT+G+AIYDTMQ+I+P +ST C+GQAASMGSLL++AGEKG 
Sbjct: 94  ESENPSKDIAFYINSPGGVVTSGLAIYDTMQYIRPKVSTVCIGQAASMGSLLMTAGEKGK 153

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RF+LPN+RI++HQPSGG  GQA+DIE  A++I+ ++ RLN IYV++ G+  + +EK ++R
Sbjct: 154 RFSLPNSRIMVHQPSGGAQGQATDIEIQAREILALRARLNNIYVEHTGQPLDVIEKVMER 213

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEEKS 215
           D  M+A EA ++G++D+V+  R  +E+ S
Sbjct: 214 DKFMTADEAKEFGLIDEVVNKRPAVEDDS 242


>gi|149201013|ref|ZP_01877988.1| Protease subunit of ATP-dependent Clp protease [Roseovarius sp.
           TM1035]
 gi|149145346|gb|EDM33372.1| Protease subunit of ATP-dependent Clp protease [Roseovarius sp.
           TM1035]
          Length = 210

 Score =  287 bits (735), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 131/209 (62%), Positives = 176/209 (84%), Gaps = 1/209 (0%)

Query: 9   KDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           KD  D+++  LVPMVVEQT+RGER+YDI+SRLLKERI+F++G + D M++LI AQLL LE
Sbjct: 2   KDPMDIYMNTLVPMVVEQTSRGERAYDIFSRLLKERIIFLSGPVHDGMSSLIVAQLLHLE 61

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP KEIS+YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AGE GMR
Sbjct: 62  AENPSKEISMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVVGQAASMGSLLLTAGEPGMR 121

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPN+R+++HQPSGG+ GQA+DI  HA++  K+K RLNEIYVK+ G+T ++VE+ L+RD
Sbjct: 122 FSLPNSRVMVHQPSGGYQGQATDIMIHARETQKLKDRLNEIYVKHTGQTLKKVEEALERD 181

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           + MS  EA  WG++D+++ +R   +E +K
Sbjct: 182 NFMSPEEAKAWGLIDEIVANRDKGDEAAK 210


>gi|227328849|ref|ZP_03832873.1| ATP-dependent Clp protease proteolytic subunit [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 207

 Score =  287 bits (735), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 130/208 (62%), Positives = 171/208 (82%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  +++ +   + LVPMVVEQT+RGERSYDIYSRLLKERI+F+TGQ+ED+MA L+ 
Sbjct: 1   MSYSG--EQERQAPHMALVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDYMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG R  LPN+R+++HQP GGF GQA+DIE HA++I+K+K ++NE+  K+ G+  E +
Sbjct: 119 AGAKGKRICLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKAKMNELMAKHTGQPLEAI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SASEA D+G+VD V  +R
Sbjct: 179 ERDTERDRFLSASEAVDYGLVDSVFTNR 206


>gi|83949690|ref|ZP_00958423.1| Protease subunit of ATP-dependent Clp protease [Roseovarius
           nubinhibens ISM]
 gi|83837589|gb|EAP76885.1| Protease subunit of ATP-dependent Clp protease [Roseovarius
           nubinhibens ISM]
          Length = 203

 Score =  287 bits (734), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 170/199 (85%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D M++L+ AQLL LEAENP KEIS+
Sbjct: 4   LVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLVVAQLLHLEAENPSKEISM 63

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G++IYDTMQ+I+P +ST  +GQAASMGSLLL+AG KGMR++LPN+RI++
Sbjct: 64  YINSPGGVVTSGLSIYDTMQYIRPAVSTLVIGQAASMGSLLLTAGAKGMRYSLPNSRIMV 123

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGG+ GQA+DI  HA++ +K+KRRLNEIYVK+ G+T ++VE+ L+RD+ MS  EA  
Sbjct: 124 HQPSGGYQGQATDIMIHAEETLKLKRRLNEIYVKHTGQTLKKVEEALERDNFMSPEEAKS 183

Query: 198 WGVVDKVLMSRIDIEEKSK 216
           WG++D+++ SR   +E  K
Sbjct: 184 WGLIDEIVESRGKADEDDK 202


>gi|163793182|ref|ZP_02187158.1| Protease subunit of ATP-dependent Clp protease [alpha
           proteobacterium BAL199]
 gi|159181828|gb|EDP66340.1| Protease subunit of ATP-dependent Clp protease [alpha
           proteobacterium BAL199]
          Length = 213

 Score =  287 bits (734), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 170/197 (86%), Gaps = 1/197 (0%)

Query: 13  DVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           D+++  LVPMVVEQTNRGER+YDIYSRLLKERI+FV G I D +A+++CAQLLFLEAENP
Sbjct: 6   DIYMNSLVPMVVEQTNRGERAYDIYSRLLKERIIFVMGPINDAVASVVCAQLLFLEAENP 65

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            K+I++YINSPGG+VT+GMA+YDTM++++P IST CMG AASMGSLLL+AG  G R+ LP
Sbjct: 66  TKDIAMYINSPGGIVTSGMAMYDTMEYVRPEISTVCMGHAASMGSLLLTAGAPGKRYCLP 125

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           NA++++HQPSGGF GQASDIE HA++I+K + RLN+IYVK+ G++ +E+EK +DRD+ M+
Sbjct: 126 NAKVMIHQPSGGFQGQASDIEIHAREIIKTRERLNQIYVKHSGRSIDEIEKGMDRDNFMT 185

Query: 192 ASEACDWGVVDKVLMSR 208
           A EA  +G++D+V+  R
Sbjct: 186 ADEAKAFGLIDEVIHKR 202


>gi|83943111|ref|ZP_00955571.1| Protease subunit of ATP-dependent Clp protease [Sulfitobacter sp.
           EE-36]
 gi|83846119|gb|EAP83996.1| Protease subunit of ATP-dependent Clp protease [Sulfitobacter sp.
           EE-36]
          Length = 211

 Score =  286 bits (733), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 129/191 (67%), Positives = 164/191 (85%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D M++LI AQLL LEAENP KEIS+
Sbjct: 4   LVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLIVAQLLHLEAENPSKEISM 63

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL AGEKGMRF+LPN+R+++
Sbjct: 64  YINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLQAGEKGMRFSLPNSRVMV 123

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGG+ GQA+DI  HAQ+  K+K RLNEIYVK+ G+  E+VE  L+RD+ MS  EA D
Sbjct: 124 HQPSGGYQGQATDIMIHAQETQKLKTRLNEIYVKHTGQPLEKVEAALERDNFMSPEEAKD 183

Query: 198 WGVVDKVLMSR 208
           WG++D+++ +R
Sbjct: 184 WGLIDEIVENR 194


>gi|261855007|ref|YP_003262290.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Halothiobacillus neapolitanus c2]
 gi|261835476|gb|ACX95243.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Halothiobacillus neapolitanus c2]
          Length = 210

 Score =  286 bits (733), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 160/192 (83%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT+RGER+YDIYSRLLKER+VFV G IEDHMA LI AQLLFLE+ENP K+I 
Sbjct: 18  ALVPMVVEQTSRGERAYDIYSRLLKERVVFVVGPIEDHMANLIVAQLLFLESENPDKDIH 77

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGVVTAGM+IYDTMQFIKP +ST C+GQAASMGS+LLS GE G RFALPN+R++
Sbjct: 78  LYINSPGGVVTAGMSIYDTMQFIKPHVSTLCIGQAASMGSILLSGGEPGKRFALPNSRVM 137

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI+ HA++I+K++  LN +  K+C +  E +E+  DRD  +SASEA 
Sbjct: 138 IHQPLGGFQGQASDIKIHAEEIIKLRHSLNGVLAKHCNQPMEVIERDTDRDKFLSASEAV 197

Query: 197 DWGVVDKVLMSR 208
           ++G++D VL  R
Sbjct: 198 EYGLIDAVLDKR 209


>gi|238754235|ref|ZP_04615592.1| ATP-dependent Clp protease proteolytic subunit [Yersinia ruckeri
           ATCC 29473]
 gi|238707482|gb|EEP99842.1| ATP-dependent Clp protease proteolytic subunit [Yersinia ruckeri
           ATCC 29473]
          Length = 194

 Score =  286 bits (733), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 162/193 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI AQ+LFLEAENP+K+I
Sbjct: 1   MALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLIVAQMLFLEAENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+AG KG RF LPN+R+
Sbjct: 61  FLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGAKGKRFCLPNSRV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DIE HA++I+K+K R+NE+  K+ GK  EE+E+  +RD  +SA E+
Sbjct: 121 MIHQPLGGFQGQATDIEIHAREILKVKSRMNELMAKHTGKPLEEIERDTERDRFLSAEES 180

Query: 196 CDWGVVDKVLMSR 208
             +G+VD +   R
Sbjct: 181 VKYGLVDDIFNRR 193


>gi|259416932|ref|ZP_05740852.1| Clp protease [Silicibacter sp. TrichCH4B]
 gi|259348371|gb|EEW60148.1| Clp protease [Silicibacter sp. TrichCH4B]
          Length = 218

 Score =  286 bits (733), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 126/197 (63%), Positives = 171/197 (86%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D M++LI AQLL LEAENP KEIS+
Sbjct: 20  LVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLIVAQLLHLEAENPSKEISM 79

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AGE GMRF+LPN+R+++
Sbjct: 80  YINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAGEAGMRFSLPNSRVMV 139

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGG+ GQA+DI  HA++ +K+KRRLNEIYVK+ G+ Y+ +EK L+RD+ MS  +A +
Sbjct: 140 HQPSGGYQGQATDIMIHAEETLKLKRRLNEIYVKHTGQDYDTIEKALERDNFMSPEQAKE 199

Query: 198 WGVVDKVLMSRIDIEEK 214
           +G++D+++ +R+  E++
Sbjct: 200 FGLIDEIVENRVKAEDE 216


>gi|293392545|ref|ZP_06636865.1| ATP-dependent Clp protease proteolytic subunit [Serratia odorifera
           DSM 4582]
 gi|291424947|gb|EFE98156.1| ATP-dependent Clp protease proteolytic subunit [Serratia odorifera
           DSM 4582]
          Length = 207

 Score =  286 bits (733), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 172/208 (82%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D     + LVPMVVEQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--EQDQFAPHMALVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAE+P+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMGS LL+
Sbjct: 59  AQMLFLEAESPEKDIFLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGSFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+  ++ G++ E++
Sbjct: 119 AGTKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKARMNELMAQHTGQSLEQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           ++  +RD  M+A E+ ++G+VD +L  R
Sbjct: 179 DRDTERDRFMTAEESVEYGLVDGILTHR 206


>gi|255261268|ref|ZP_05340610.1| Clp protease [Thalassiobium sp. R2A62]
 gi|255103603|gb|EET46277.1| Clp protease [Thalassiobium sp. R2A62]
          Length = 209

 Score =  286 bits (732), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 127/200 (63%), Positives = 168/200 (84%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
            D  + ++ LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D M+ LI AQLL LEA
Sbjct: 2   NDPVETYMNLVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSQLIVAQLLHLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP KEIS+YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AGEKGMRF
Sbjct: 62  ENPSKEISMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAGEKGMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           +LPN+R+++HQPSGG+ GQA+DI  HA +  K+K RLN IYV++ G+T ++VE  L+RD+
Sbjct: 122 SLPNSRVMVHQPSGGYQGQATDIMIHAAETQKLKDRLNSIYVRHTGQTLKKVEAALERDN 181

Query: 189 IMSASEACDWGVVDKVLMSR 208
            MSA +A DWG++D+++ +R
Sbjct: 182 FMSAEDAKDWGLIDEIVENR 201


>gi|260575566|ref|ZP_05843564.1| Endopeptidase Clp [Rhodobacter sp. SW2]
 gi|259022209|gb|EEW25507.1| Endopeptidase Clp [Rhodobacter sp. SW2]
          Length = 210

 Score =  286 bits (732), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 133/209 (63%), Positives = 172/209 (82%), Gaps = 1/209 (0%)

Query: 9   KDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           +D  D ++  LVPMVVEQT+RGER+YDI+SR+LKERI+F++G + D M+ LICAQLLFLE
Sbjct: 2   RDPIDHYMNTLVPMVVEQTSRGERAYDIFSRMLKERIIFLSGPVHDGMSALICAQLLFLE 61

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP KEIS+YINSPGGVVT+G++IYDTMQ+IKP IST  +GQAASMGSLLL+AG+KGMR
Sbjct: 62  AENPTKEISMYINSPGGVVTSGLSIYDTMQYIKPRISTLVIGQAASMGSLLLTAGQKGMR 121

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPN+R+++HQPSGG+ GQA+DI  HAQ+  K+K RLN IYVK+ G+  E V   L+RD
Sbjct: 122 FSLPNSRVMVHQPSGGYQGQATDIMIHAQETQKLKDRLNGIYVKHTGQPMEAVVAALERD 181

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           + MSA +A  WG++D+++ SR   EE  K
Sbjct: 182 NFMSAEDAKSWGLIDEIVESRGKAEETPK 210


>gi|238791431|ref|ZP_04635069.1| ATP-dependent Clp protease proteolytic subunit [Yersinia intermedia
           ATCC 29909]
 gi|238729047|gb|EEQ20563.1| ATP-dependent Clp protease proteolytic subunit [Yersinia intermedia
           ATCC 29909]
          Length = 194

 Score =  286 bits (732), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 129/193 (66%), Positives = 161/193 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI AQ+LFLEAENP+K+I
Sbjct: 1   MALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLITAQMLFLEAENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+AG KG RF LPN+R+
Sbjct: 61  FLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGAKGKRFCLPNSRV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DIE HA++I+K+K R+NE+   + GK  EE+E+  +RD  +SA EA
Sbjct: 121 MIHQPLGGFQGQATDIEIHAREILKVKSRMNELMALHTGKPLEEIERDTERDRFLSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G+VD V   R
Sbjct: 181 VGYGLVDSVFTRR 193


>gi|300900508|ref|ZP_07118675.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 198-1]
 gi|300924164|ref|ZP_07140156.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 182-1]
 gi|300937054|ref|ZP_07151920.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 21-1]
 gi|300958005|ref|ZP_07170169.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 175-1]
 gi|300988008|ref|ZP_07178488.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 45-1]
 gi|300997374|ref|ZP_07181714.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 200-1]
 gi|301022569|ref|ZP_07186441.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 69-1]
 gi|301049644|ref|ZP_07196593.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 185-1]
 gi|301301588|ref|ZP_07207723.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 124-1]
 gi|301647363|ref|ZP_07247175.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 146-1]
 gi|309787029|ref|ZP_07681641.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shigella
           dysenteriae 1617]
 gi|312964538|ref|ZP_07778794.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli 2362-75]
 gi|312970533|ref|ZP_07784714.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli 1827-70]
 gi|300298581|gb|EFJ54966.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 185-1]
 gi|300304193|gb|EFJ58713.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 200-1]
 gi|300315272|gb|EFJ65056.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 175-1]
 gi|300355989|gb|EFJ71859.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 198-1]
 gi|300397450|gb|EFJ80988.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 69-1]
 gi|300407560|gb|EFJ91098.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 45-1]
 gi|300419617|gb|EFK02928.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 182-1]
 gi|300457885|gb|EFK21378.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 21-1]
 gi|300843085|gb|EFK70845.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 124-1]
 gi|301074508|gb|EFK89314.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 146-1]
 gi|308924607|gb|EFP70102.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shigella
           dysenteriae 1617]
 gi|310337182|gb|EFQ02320.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli 1827-70]
 gi|312290772|gb|EFR18649.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli 2362-75]
 gi|313646936|gb|EFS11393.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shigella
           flexneri 2a str. 2457T]
 gi|315256265|gb|EFU36233.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 85-1]
 gi|315289845|gb|EFU49235.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 110-3]
 gi|315294229|gb|EFU53580.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 153-1]
 gi|315299561|gb|EFU58809.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 16-3]
 gi|315616622|gb|EFU97239.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli 3431]
 gi|323153474|gb|EFZ39728.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli EPECa14]
 gi|323160452|gb|EFZ46400.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli E128010]
 gi|323164238|gb|EFZ50045.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shigella
           sonnei 53G]
 gi|323170523|gb|EFZ56173.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli LT-68]
 gi|323178294|gb|EFZ63872.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli 1180]
 gi|323184732|gb|EFZ70103.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli 1357]
 gi|323191357|gb|EFZ76620.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli RN587/1]
 gi|324010068|gb|EGB79287.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 57-2]
 gi|324010651|gb|EGB79870.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 60-1]
 gi|324016702|gb|EGB85921.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 117-3]
 gi|325498272|gb|EGC96131.1| ATP-dependent Clp protease proteolytic subunit [Escherichia
           fergusonii ECD227]
 gi|327254765|gb|EGE66381.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli STEC_7v]
 gi|332085596|gb|EGI90760.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shigella
           dysenteriae 155-74]
 gi|332094593|gb|EGI99639.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shigella
           boydii 5216-82]
 gi|332098592|gb|EGJ03558.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shigella
           boydii 3594-74]
          Length = 194

 Score =  286 bits (732), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 125/193 (64%), Positives = 165/193 (85%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI AQ+LFLEAENP+K+I
Sbjct: 1   MALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+AG KG RF LPN+R+
Sbjct: 61  YLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++E+  +RD  +SA EA
Sbjct: 121 MIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G+VD +L  R
Sbjct: 181 VEYGLVDSILTHR 193


>gi|254785725|ref|YP_003073154.1| ATP-dependent Clp protease proteolytic subunit [Teredinibacter
           turnerae T7901]
 gi|259585966|sp|C5BTJ0|CLPP_TERTT RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|237684355|gb|ACR11619.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Teredinibacter turnerae T7901]
          Length = 214

 Score =  286 bits (731), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 135/197 (68%), Positives = 159/197 (80%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+VVEQT RGERSYDIYSRLLKER++F+ GQ+EDHMA L+ AQLLFLEAENP K+I L
Sbjct: 18  LVPIVVEQTARGERSYDIYSRLLKERVIFLVGQVEDHMANLVVAQLLFLEAENPDKDIHL 77

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTMQFIKP +ST C+GQA SMGS LLSAG  G RF LPNAR ++
Sbjct: 78  YINSPGGSVTAGMSIYDTMQFIKPDVSTMCIGQACSMGSFLLSAGATGKRFCLPNARTMI 137

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGG  GQASDI  HAQ+I+KI+ RLNEI  K+ GK+ EEV +  +RD+ MSA E+  
Sbjct: 138 HQPSGGAQGQASDIHIHAQEILKIRARLNEIMAKHTGKSVEEVARDTERDNFMSAEESKA 197

Query: 198 WGVVDKVLMSRIDIEEK 214
           +G+VD VL  R+  E K
Sbjct: 198 YGLVDDVLYQRVPEESK 214


>gi|326403118|ref|YP_004283199.1| ATP-dependent Clp protease proteolytic subunit [Acidiphilium
           multivorum AIU301]
 gi|325049979|dbj|BAJ80317.1| ATP-dependent Clp protease proteolytic subunit [Acidiphilium
           multivorum AIU301]
          Length = 209

 Score =  285 bits (730), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 130/198 (65%), Positives = 170/198 (85%), Gaps = 1/198 (0%)

Query: 9   KDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           +D  ++++  LVPMVVEQT RGERSYDI+SRLLKERI+F+TG + D + +LI AQLLFLE
Sbjct: 3   RDPTEIYMNSLVPMVVEQTARGERSYDIFSRLLKERIIFLTGPVYDQVGSLIAAQLLFLE 62

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           +ENP KEI+ YINSPGGVV+AG+AIYDTMQ+IK P+ST C+GQAASMGSLLL+AGEKG R
Sbjct: 63  SENPSKEIAFYINSPGGVVSAGLAIYDTMQYIKSPVSTVCIGQAASMGSLLLAAGEKGKR 122

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FALPN+RI++HQPSGG  GQASDIE  A++I+ ++RRLN+IYV + G++ E +E+ L+RD
Sbjct: 123 FALPNSRIMVHQPSGGAQGQASDIEIQAREILTLRRRLNDIYVTHTGQSLEAIEQALERD 182

Query: 188 HIMSASEACDWGVVDKVL 205
             MSA+EA ++G+VD+V+
Sbjct: 183 RFMSANEAQEFGLVDEVV 200


>gi|115311359|sp|Q2W3H9|CLPP_MAGMM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
          Length = 203

 Score =  285 bits (730), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 128/198 (64%), Positives = 170/198 (85%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQTNRGERSYDIYSRLLKERI+F+TGQ+ D +A+LICAQLLFLE+ENP K+I+ 
Sbjct: 4   LVPMVVEQTNRGERSYDIYSRLLKERIIFLTGQVYDEVASLICAQLLFLESENPSKDIAF 63

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G+AIYDTMQ+I+P +ST C+GQAASMGSLL++AGEKG RF+LPN+RI++
Sbjct: 64  YINSPGGVVTSGLAIYDTMQYIRPKVSTVCIGQAASMGSLLMTAGEKGKRFSLPNSRIMV 123

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGG  GQA+DIE  A++I+ ++ RLN IYV++ G+  + +EK ++RD  M+A EA +
Sbjct: 124 HQPSGGAQGQATDIEIQAREILALRARLNNIYVEHTGQPLDVIEKVMERDKFMTADEAKE 183

Query: 198 WGVVDKVLMSRIDIEEKS 215
           +G++D+V+  R  +E+ S
Sbjct: 184 FGLIDEVVNKRPAVEDDS 201


>gi|3318853|pdb|1TYF|A Chain A, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 gi|3318854|pdb|1TYF|B Chain B, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 gi|3318855|pdb|1TYF|C Chain C, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 gi|3318856|pdb|1TYF|D Chain D, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 gi|3318857|pdb|1TYF|E Chain E, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 gi|3318858|pdb|1TYF|F Chain F, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 gi|3318859|pdb|1TYF|G Chain G, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 gi|3318860|pdb|1TYF|H Chain H, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 gi|3318861|pdb|1TYF|I Chain I, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 gi|3318862|pdb|1TYF|J Chain J, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 gi|3318863|pdb|1TYF|K Chain K, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 gi|3318864|pdb|1TYF|L Chain L, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 gi|3318865|pdb|1TYF|M Chain M, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 gi|3318866|pdb|1TYF|N Chain N, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 gi|93278456|pdb|1YG6|A Chain A, Clpp
 gi|93278457|pdb|1YG6|B Chain B, Clpp
 gi|93278458|pdb|1YG6|C Chain C, Clpp
 gi|93278459|pdb|1YG6|D Chain D, Clpp
 gi|93278460|pdb|1YG6|E Chain E, Clpp
 gi|93278461|pdb|1YG6|F Chain F, Clpp
 gi|93278462|pdb|1YG6|G Chain G, Clpp
 gi|93278463|pdb|1YG6|H Chain H, Clpp
 gi|93278464|pdb|1YG6|I Chain I, Clpp
 gi|93278465|pdb|1YG6|J Chain J, Clpp
 gi|93278466|pdb|1YG6|K Chain K, Clpp
 gi|93278467|pdb|1YG6|L Chain L, Clpp
 gi|93278468|pdb|1YG6|M Chain M, Clpp
 gi|93278469|pdb|1YG6|N Chain N, Clpp
 gi|109157730|pdb|2FZS|A Chain A, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 gi|109157731|pdb|2FZS|B Chain B, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 gi|109157732|pdb|2FZS|C Chain C, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 gi|109157733|pdb|2FZS|D Chain D, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 gi|109157734|pdb|2FZS|E Chain E, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 gi|109157735|pdb|2FZS|F Chain F, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 gi|109157736|pdb|2FZS|G Chain G, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 gi|109157737|pdb|2FZS|H Chain H, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 gi|109157738|pdb|2FZS|I Chain I, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 gi|109157739|pdb|2FZS|J Chain J, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 gi|109157740|pdb|2FZS|K Chain K, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 gi|109157741|pdb|2FZS|L Chain L, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 gi|109157742|pdb|2FZS|M Chain M, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 gi|109157743|pdb|2FZS|N Chain N, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
          Length = 193

 Score =  285 bits (730), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 164/192 (85%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI AQ+LFLEAENP+K+I 
Sbjct: 1   ALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIY 60

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+AG KG RF LPN+R++
Sbjct: 61  LYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVM 120

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++E+  +RD  +SA EA 
Sbjct: 121 IHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAV 180

Query: 197 DWGVVDKVLMSR 208
           ++G+VD +L  R
Sbjct: 181 EYGLVDSILTHR 192


>gi|239995517|ref|ZP_04716041.1| ATP-dependent Clp protease proteolytic subunit [Alteromonas
           macleodii ATCC 27126]
          Length = 209

 Score =  285 bits (729), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 129/199 (64%), Positives = 164/199 (82%)

Query: 13  DVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQ 72
           D    LVPMVVEQT++GERSYDIYSRLLKE ++F+ GQ+EDHMA LI AQ+LFLEAENP+
Sbjct: 7   DPMNALVPMVVEQTSKGERSYDIYSRLLKENVIFLVGQVEDHMANLIVAQMLFLEAENPE 66

Query: 73  KEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPN 132
           K+I LYINSPGG VTAGMAIYDTM+FIKP +ST CMGQAASMG+ LLSAG KG R+ LPN
Sbjct: 67  KDIFLYINSPGGSVTAGMAIYDTMKFIKPDVSTVCMGQAASMGAFLLSAGAKGKRYCLPN 126

Query: 133 ARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSA 192
           +R+++HQP GGF GQASD E HA++I+ IK +LN +   + G+ YE+V +  DRD+ +SA
Sbjct: 127 SRVMIHQPLGGFQGQASDFEIHAKEILSIKEKLNRLMADHTGQDYEKVARDTDRDNFLSA 186

Query: 193 SEACDWGVVDKVLMSRIDI 211
           +EA ++G+VD+VL +R D+
Sbjct: 187 TEAKEYGLVDQVLANRSDV 205


>gi|148259928|ref|YP_001234055.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Acidiphilium
           cryptum JF-5]
 gi|146401609|gb|ABQ30136.1| ATP-dependent Clp protease proteolytic subunit ClpP [Acidiphilium
           cryptum JF-5]
          Length = 211

 Score =  285 bits (729), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 130/198 (65%), Positives = 170/198 (85%), Gaps = 1/198 (0%)

Query: 9   KDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           +D  ++++  LVPMVVEQT RGERSYDI+SRLLKERI+F+TG + D + +LI AQLLFLE
Sbjct: 5   RDPTEIYMNSLVPMVVEQTARGERSYDIFSRLLKERIIFLTGPVYDQVGSLIAAQLLFLE 64

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           +ENP KEI+ YINSPGGVV+AG+AIYDTMQ+IK P+ST C+GQAASMGSLLL+AGEKG R
Sbjct: 65  SENPSKEIAFYINSPGGVVSAGLAIYDTMQYIKSPVSTVCIGQAASMGSLLLAAGEKGKR 124

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FALPN+RI++HQPSGG  GQASDIE  A++I+ ++RRLN+IYV + G++ E +E+ L+RD
Sbjct: 125 FALPNSRIMVHQPSGGAQGQASDIEIQAREILTLRRRLNDIYVTHTGQSLEAIEQALERD 184

Query: 188 HIMSASEACDWGVVDKVL 205
             MSA+EA ++G+VD+V+
Sbjct: 185 RFMSANEAQEFGLVDEVV 202


>gi|294678131|ref|YP_003578746.1| ATP-dependent Clp protease proteolytic subunit ClpP [Rhodobacter
           capsulatus SB 1003]
 gi|294476951|gb|ADE86339.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Rhodobacter
           capsulatus SB 1003]
          Length = 209

 Score =  285 bits (729), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 131/205 (63%), Positives = 171/205 (83%), Gaps = 1/205 (0%)

Query: 9   KDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           KD  D+++  LVPMVVEQT+RGER+YDIYSRLLKERI+F+ G   D M++LICAQLLFLE
Sbjct: 2   KDPVDLYMNTLVPMVVEQTSRGERAYDIYSRLLKERIIFLAGPFHDGMSSLICAQLLFLE 61

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP KEIS+YINSPGGVVT+G+AIYDTMQ+I+P +ST  +GQAASMGS++  AGEKGMR
Sbjct: 62  AENPSKEISMYINSPGGVVTSGLAIYDTMQYIRPKVSTLVIGQAASMGSVIACAGEKGMR 121

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPN+RI++HQPSGGF GQA+DI  HA++  KI++RL EIYV++ G++ EEV + L+RD
Sbjct: 122 FSLPNSRIMVHQPSGGFQGQATDIMIHARETEKIRQRLYEIYVRHTGRSLEEVAEALERD 181

Query: 188 HIMSASEACDWGVVDKVLMSRIDIE 212
             MS  EA +WG +D++L +R  ++
Sbjct: 182 RFMSPEEALEWGHLDEILSARPSLD 206


>gi|332141945|ref|YP_004427683.1| ATP-dependent Clp protease proteolytic subunit [Alteromonas
           macleodii str. 'Deep ecotype']
 gi|327551967|gb|AEA98685.1| ATP-dependent Clp protease proteolytic subunit [Alteromonas
           macleodii str. 'Deep ecotype']
          Length = 209

 Score =  285 bits (729), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 129/199 (64%), Positives = 164/199 (82%)

Query: 13  DVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQ 72
           D    LVPMVVEQT++GERSYDIYSRLLKE ++F+ GQ+EDHMA LI AQ+LFLEAENP+
Sbjct: 7   DPMNALVPMVVEQTSKGERSYDIYSRLLKENVIFLVGQVEDHMANLIVAQMLFLEAENPE 66

Query: 73  KEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPN 132
           K+I LYINSPGG VTAGMAIYDTM+FIKP +ST CMGQAASMG+ LLSAG KG R+ LPN
Sbjct: 67  KDIFLYINSPGGSVTAGMAIYDTMRFIKPDVSTVCMGQAASMGAFLLSAGAKGKRYCLPN 126

Query: 133 ARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSA 192
           +R+++HQP GGF GQASD E HA++I+ IK +LN +   + G+ YE+V +  DRD+ +SA
Sbjct: 127 SRVMIHQPLGGFQGQASDFEIHAKEILSIKEKLNRLLADHTGQDYEKVARDTDRDNFLSA 186

Query: 193 SEACDWGVVDKVLMSRIDI 211
           +EA ++G+VD+VL +R D+
Sbjct: 187 TEAKEYGLVDQVLANRSDV 205


>gi|254428693|ref|ZP_05042400.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Alcanivorax
           sp. DG881]
 gi|196194862|gb|EDX89821.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Alcanivorax
           sp. DG881]
          Length = 244

 Score =  285 bits (728), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 129/193 (66%), Positives = 161/193 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVP+V+EQT RGERS+DIYSRLLKER++F+ GQ+EDHMA LI AQ+LFLE+ENP K+I
Sbjct: 50  LGLVPVVIEQTARGERSFDIYSRLLKERVIFMIGQVEDHMANLIVAQMLFLESENPDKDI 109

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQAASMG+ LL+AG  G RFALPNAR+
Sbjct: 110 HLYINSPGGSVTAGMSIYDTMQFIKPDVSTMCVGQAASMGAFLLTAGATGKRFALPNARV 169

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDIE HA++I+KIK +LN +   + G+  E++EK  DRD+ MSA EA
Sbjct: 170 MIHQPLGGFQGQASDIEIHAKEILKIKGQLNSLLAHHTGQPIEQLEKDTDRDNFMSADEA 229

Query: 196 CDWGVVDKVLMSR 208
            ++G++D VL  R
Sbjct: 230 KEYGIIDAVLSQR 242


>gi|50120087|ref|YP_049254.1| ATP-dependent Clp protease proteolytic subunit [Pectobacterium
           atrosepticum SCRI1043]
 gi|60389567|sp|Q6D827|CLPP_ERWCT RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|49610613|emb|CAG74058.1| ATP-dependent Clp protease proteolytic subunit [Pectobacterium
           atrosepticum SCRI1043]
          Length = 207

 Score =  285 bits (728), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 170/208 (81%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  +++ +   + LVPMVVEQT RGERSYDIYSRLLKERI+F+TGQ+ED+MA L+ 
Sbjct: 1   MSYSG--EQERQAPHMALVPMVVEQTARGERSYDIYSRLLKERIIFLTGQVEDYMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG R  LPN+R+++HQP GGF GQA+DIE HA++I+K+K ++NE+  K+ G+  E +
Sbjct: 119 AGAKGKRICLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKAKMNELMAKHTGQPLEAI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SASEA ++G+VD V  +R
Sbjct: 179 ERDTERDRFLSASEAVEYGLVDSVFTNR 206


>gi|85373054|ref|YP_457116.1| ATP-dependent Clp protease proteolytic subunit [Erythrobacter
           litoralis HTCC2594]
 gi|84786137|gb|ABC62319.1| ATP-dependent Clp protease [Erythrobacter litoralis HTCC2594]
          Length = 234

 Score =  285 bits (728), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 136/213 (63%), Positives = 171/213 (80%), Gaps = 1/213 (0%)

Query: 5   GCAKKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQL 63
           G   + + D   G LVP+VVEQT+RGERS+DI+SRLL+ERIVFVTGQ+ED MA+LI AQL
Sbjct: 13  GTQGQFTRDPLTGALVPVVVEQTSRGERSFDIFSRLLRERIVFVTGQVEDGMASLITAQL 72

Query: 64  LFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGE 123
           LFLE+ENP K IS+YINSPGGVVTAGMAI+DTMQ+IKP +ST CMGQAASMGS LL+AGE
Sbjct: 73  LFLESENPSKPISMYINSPGGVVTAGMAIHDTMQYIKPKVSTVCMGQAASMGSFLLAAGE 132

Query: 124 KGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKT 183
            GMR ALPNARI++HQPSGG  G ASDIE  A++I++I++R+N++YVK  G+   ++EK 
Sbjct: 133 PGMRVALPNARIMVHQPSGGARGMASDIEIQAREILRIRKRMNDLYVKYTGQKLADIEKA 192

Query: 184 LDRDHIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           +DRD  + A EA  +G+VDKV  +R + E   K
Sbjct: 193 MDRDTFLEAEEAMKFGLVDKVFETRPENEGGDK 225


>gi|294083692|ref|YP_003550449.1| protease subunit of ATP-dependent Clp protease [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292663264|gb|ADE38365.1| Protease subunit of ATP-dependent Clp protease [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 216

 Score =  285 bits (728), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 169/200 (84%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           K + D    LVPMVVEQTNRGERSYDI+SRLLKERI+F+ G ++D  A+L+C+QLLFLE+
Sbjct: 8   KSNFDPMANLVPMVVEQTNRGERSYDIFSRLLKERIIFLNGPVDDTTASLVCSQLLFLES 67

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP K+IS+YINSPGG+VT+G+AIYDTM++I+P +ST CMGQAASMGSLLL AG  G R+
Sbjct: 68  ENPTKDISMYINSPGGIVTSGLAIYDTMEYIRPDVSTVCMGQAASMGSLLLMAGAAGKRY 127

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           +LPNARI+ HQPSGGFSGQASDIE HA++I+ +++RLN +YVK+ GKT ++VEK ++RD 
Sbjct: 128 SLPNARIMTHQPSGGFSGQASDIEIHAREILDLRKRLNGMYVKHTGKTLKDVEKIMERDT 187

Query: 189 IMSASEACDWGVVDKVLMSR 208
            M+A +A  +G++D+V+  R
Sbjct: 188 FMTAEDAQKFGLIDEVVEKR 207


>gi|126732556|ref|ZP_01748354.1| Protease subunit of ATP-dependent Clp protease [Sagittula stellata
           E-37]
 gi|126707002|gb|EBA06070.1| Protease subunit of ATP-dependent Clp protease [Sagittula stellata
           E-37]
          Length = 197

 Score =  285 bits (728), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 164/189 (86%)

Query: 21  MVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYIN 80
           MVVEQT+RGER+YDI+SRLLKERIVF+ G + D M++L+ AQLL LEAENP KEIS+YIN
Sbjct: 1   MVVEQTSRGERAYDIFSRLLKERIVFLNGPVHDGMSSLVVAQLLHLEAENPSKEISMYIN 60

Query: 81  SPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQP 140
           SPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AG  GMRF+LPN+RI++HQP
Sbjct: 61  SPGGVVTSGLSIYDTMQYIKPKVSTLVVGQAASMGSLLLTAGAAGMRFSLPNSRIMVHQP 120

Query: 141 SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGV 200
           SGG+ GQA+DI  HA++ +K+KRRLNEIYV++ G+TYE VE  L+RD+ M A +A +WG+
Sbjct: 121 SGGYQGQATDIMIHAEETIKLKRRLNEIYVRHTGQTYEAVEAALERDNFMDAEKAKEWGL 180

Query: 201 VDKVLMSRI 209
           +D+++ SR+
Sbjct: 181 IDEIVTSRV 189


>gi|254467045|ref|ZP_05080456.1| Clp protease [Rhodobacterales bacterium Y4I]
 gi|206687953|gb|EDZ48435.1| Clp protease [Rhodobacterales bacterium Y4I]
          Length = 202

 Score =  285 bits (728), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 165/191 (86%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQT+RGER+YDI+SRLLKERI+FV G + D M++LI AQLL LEAENP KEIS+
Sbjct: 4   LVPMVVEQTSRGERAYDIFSRLLKERIIFVNGPVHDGMSSLIVAQLLHLEAENPSKEISM 63

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AGEKGMRF+LPN+R+++
Sbjct: 64  YINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAGEKGMRFSLPNSRVMV 123

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGGF GQA+DI  HA++ +K+K+RLNEIYVK+ G+ YE V   L+RD+ MS  EA  
Sbjct: 124 HQPSGGFQGQATDIMIHAEETLKLKKRLNEIYVKHTGQDYETVVNALERDNFMSPEEAKA 183

Query: 198 WGVVDKVLMSR 208
           +G++D+++ +R
Sbjct: 184 FGLIDEIVENR 194


>gi|260596809|ref|YP_003209380.1| ATP-dependent Clp protease proteolytic subunit [Cronobacter
           turicensis z3032]
 gi|260215986|emb|CBA28638.1| ATP-dependent Clp protease proteolytic subunit [Cronobacter
           turicensis z3032]
          Length = 214

 Score =  284 bits (727), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 127/202 (62%), Positives = 167/202 (82%), Gaps = 3/202 (1%)

Query: 10  DSEDVF---LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
           D  D F   + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+ED MA LI AQ+LFL
Sbjct: 12  DERDQFAPHMALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDQMANLIVAQMLFL 71

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP+K+I LYINSPGGV+TAGM+IYDTMQFI+P +ST CMGQAASMG+ LL+AG KG 
Sbjct: 72  EAENPEKDIYLYINSPGGVITAGMSIYDTMQFIQPDVSTICMGQAASMGAFLLTAGTKGK 131

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+  ++ G+  E++E+  +R
Sbjct: 132 RFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKARMNELMAQHTGQPLEQIERDTER 191

Query: 187 DHIMSASEACDWGVVDKVLMSR 208
           D  +SA EA ++G+VD ++  R
Sbjct: 192 DRFLSAGEAVEYGLVDSIMTHR 213


>gi|163731525|ref|ZP_02138972.1| Clp protease, putative [Roseobacter litoralis Och 149]
 gi|161394979|gb|EDQ19301.1| Clp protease, putative [Roseobacter litoralis Och 149]
          Length = 208

 Score =  284 bits (727), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 169/200 (84%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           KD  + ++ LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D M++LI AQLL LEA
Sbjct: 2   KDPIETYMNLVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLIVAQLLHLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           +NP KEIS+YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AGE GMRF
Sbjct: 62  DNPAKEISMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAGEAGMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           +LPN+RI++HQPSGG+ GQA+DI  HA +  K+K RLNEIYVK+ G+T ++VE  L+RD+
Sbjct: 122 SLPNSRIMVHQPSGGYQGQATDIMIHAAETQKLKDRLNEIYVKHTGQTLKKVENALERDN 181

Query: 189 IMSASEACDWGVVDKVLMSR 208
            MS  EA D+G++D+++ +R
Sbjct: 182 FMSPEEAKDFGLIDEIVENR 201


>gi|116243127|sp|Q0VQ90|CLPP_ALCBS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
          Length = 205

 Score =  284 bits (727), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 129/193 (66%), Positives = 161/193 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVP+V+EQT RGERS+DIYSRLLKER++F+ GQ+EDHMA LI AQ+LFLE+ENP K+I
Sbjct: 11  LGLVPVVIEQTARGERSFDIYSRLLKERVIFMIGQVEDHMANLIVAQMLFLESENPDKDI 70

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQAASMG+ LL+AG  G RFALPNAR+
Sbjct: 71  HLYINSPGGSVTAGMSIYDTMQFIKPDVSTMCIGQAASMGAFLLTAGAAGKRFALPNARV 130

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDIE HA++I+KIK +LN +   + G+  E++EK  DRD+ MSA EA
Sbjct: 131 MIHQPLGGFQGQASDIEIHAKEILKIKGQLNSLLAHHTGQPIEQLEKDTDRDNFMSADEA 190

Query: 196 CDWGVVDKVLMSR 208
            ++G++D VL  R
Sbjct: 191 KEYGIIDAVLSQR 203


>gi|170751514|ref|YP_001757774.1| endopeptidase Clp [Methylobacterium radiotolerans JCM 2831]
 gi|226706463|sp|B1LW28|CLPP_METRJ RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|170658036|gb|ACB27091.1| Endopeptidase Clp [Methylobacterium radiotolerans JCM 2831]
          Length = 208

 Score =  284 bits (727), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 131/201 (65%), Positives = 171/201 (85%), Gaps = 1/201 (0%)

Query: 9   KDSEDVFL-GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           +D  DV+   LVPMVVEQ++RGER++DIYSRLL+ERI+F+TG +ED+ A+LI AQLLFLE
Sbjct: 2   RDPIDVYNNALVPMVVEQSSRGERAFDIYSRLLRERIIFLTGPVEDYGASLIVAQLLFLE 61

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEIS YINSPGGVVT+G++IYDTMQFI+ P++T C+GQAASMGSLLL+AGE G R
Sbjct: 62  AENPKKEISFYINSPGGVVTSGLSIYDTMQFIRCPVTTLCVGQAASMGSLLLTAGEPGHR 121

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FALPNARI++HQPSGGF GQA+DI  HA++I  +KRRLNEIYVK+ G+ Y+ +   L+RD
Sbjct: 122 FALPNARIMVHQPSGGFQGQATDILIHAREIEALKRRLNEIYVKHTGRDYDTIHTALERD 181

Query: 188 HIMSASEACDWGVVDKVLMSR 208
           + M+A  A ++G++D+V+  R
Sbjct: 182 NFMTADAAKEFGLIDEVIEKR 202


>gi|163851839|ref|YP_001639882.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Methylobacterium extorquens PA1]
 gi|218530631|ref|YP_002421447.1| ATP-dependent Clp protease proteolytic subunit [Methylobacterium
           chloromethanicum CM4]
 gi|240139003|ref|YP_002963478.1| ATP-dependent Clp protease proteolytic subunit (Endopeptidase Clp)
           [Methylobacterium extorquens AM1]
 gi|254561598|ref|YP_003068693.1| ATP-dependent Clp protease proteolytic subunit [Methylobacterium
           extorquens DM4]
 gi|226706461|sp|A9W5F5|CLPP_METEP RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|254763796|sp|B7KNT0|CLPP_METC4 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|163663444|gb|ABY30811.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Methylobacterium extorquens PA1]
 gi|218522934|gb|ACK83519.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Methylobacterium chloromethanicum CM4]
 gi|240008975|gb|ACS40201.1| ATP-dependent Clp protease proteolytic subunit (Endopeptidase Clp)
           [Methylobacterium extorquens AM1]
 gi|254268876|emb|CAX24837.1| ATP-dependent Clp protease proteolytic subunit (Endopeptidase Clp)
           [Methylobacterium extorquens DM4]
          Length = 208

 Score =  284 bits (727), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 131/201 (65%), Positives = 169/201 (84%), Gaps = 1/201 (0%)

Query: 9   KDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           +D  D F   LVPMVVEQ++RGER++DIYSRLL+ERI+F+TG +ED  A+LI AQLLFLE
Sbjct: 2   RDPVDYFHNSLVPMVVEQSSRGERAFDIYSRLLRERIIFLTGPVEDQGASLIVAQLLFLE 61

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEIS YINSPGGVVT+G++IYDTMQFI+ P++T C+GQAASMGSLLL+AGE G R
Sbjct: 62  AENPKKEISFYINSPGGVVTSGLSIYDTMQFIRCPVTTLCVGQAASMGSLLLAAGEAGHR 121

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FALPNARI++HQPSGGF GQA+DI  HA++I  +K+RLNEIYVK+ G+ YE + + L+RD
Sbjct: 122 FALPNARIMVHQPSGGFQGQATDILIHAREIEALKKRLNEIYVKHTGREYETIHQALERD 181

Query: 188 HIMSASEACDWGVVDKVLMSR 208
           + M+A  A ++G++D +L  R
Sbjct: 182 NFMTADAAKEFGLIDDILHKR 202


>gi|304413826|ref|ZP_07395243.1| ATP-dependent serine protease [Candidatus Regiella insecticola
           LSR1]
 gi|304283546|gb|EFL91941.1| ATP-dependent serine protease [Candidatus Regiella insecticola
           LSR1]
          Length = 261

 Score =  284 bits (727), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 125/193 (64%), Positives = 162/193 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGER+YDIYSRLLKER++F+TGQ+EDHMA LI AQ+LFLEAENP K+I
Sbjct: 50  MALVPMVVEQTSRGERAYDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPDKDI 109

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGGV+TAGM+IYDTMQFIKP + T C+GQA SMG+ LL+AG KG RF LPN+R+
Sbjct: 110 SLYINSPGGVITAGMSIYDTMQFIKPDVITLCIGQACSMGAFLLTAGTKGKRFCLPNSRV 169

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG+ GQ SDIE H+++I  +K R+N +  K+ GK  EE+EK  +RD+ +SA E+
Sbjct: 170 MIHQPLGGYQGQVSDIEIHSKEIRNVKNRMNTLMAKHTGKALEEIEKDTERDYFLSAEES 229

Query: 196 CDWGVVDKVLMSR 208
            ++G+VD+VL +R
Sbjct: 230 VNYGLVDQVLCTR 242


>gi|110834071|ref|YP_692930.1| ATP-dependent Clp protease, proteolytic subunitclpp [Alcanivorax
           borkumensis SK2]
 gi|110647182|emb|CAL16658.1| ATP-dependent Clp protease, proteolytic subunitClpP [Alcanivorax
           borkumensis SK2]
          Length = 218

 Score =  284 bits (727), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 129/193 (66%), Positives = 161/193 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVP+V+EQT RGERS+DIYSRLLKER++F+ GQ+EDHMA LI AQ+LFLE+ENP K+I
Sbjct: 24  LGLVPVVIEQTARGERSFDIYSRLLKERVIFMIGQVEDHMANLIVAQMLFLESENPDKDI 83

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQAASMG+ LL+AG  G RFALPNAR+
Sbjct: 84  HLYINSPGGSVTAGMSIYDTMQFIKPDVSTMCIGQAASMGAFLLTAGAAGKRFALPNARV 143

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDIE HA++I+KIK +LN +   + G+  E++EK  DRD+ MSA EA
Sbjct: 144 MIHQPLGGFQGQASDIEIHAKEILKIKGQLNSLLAHHTGQPIEQLEKDTDRDNFMSADEA 203

Query: 196 CDWGVVDKVLMSR 208
            ++G++D VL  R
Sbjct: 204 KEYGIIDAVLSQR 216


>gi|114327971|ref|YP_745128.1| ATP-dependent endopeptidase Clp proteolytic subunit clpP
           [Granulibacter bethesdensis CGDNIH1]
 gi|114316145|gb|ABI62205.1| ATP-dependent endopeptidase clp proteolytic subunit clpP
           [Granulibacter bethesdensis CGDNIH1]
          Length = 248

 Score =  284 bits (727), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 164/191 (85%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQT RGERS+DIYSRLLKERI+F+TG + D ++ LICAQLLFLE+ENPQKEIS 
Sbjct: 47  LVPMVVEQTARGERSFDIYSRLLKERIIFLTGAVYDQVSALICAQLLFLESENPQKEISF 106

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVV+AG+AIYDTMQ+I+ P+ST C+GQAASMGSLLL AGEK  RFALPNAR+++
Sbjct: 107 YINSPGGVVSAGLAIYDTMQYIRSPVSTVCIGQAASMGSLLLCAGEKDKRFALPNARVMV 166

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGG  GQA+DIE  A++I+ +++RLNEIY ++ G++ E +E+ L+RD  MSA EA D
Sbjct: 167 HQPSGGAQGQATDIEIQAREILTLRKRLNEIYNRHTGQSIEAIERKLERDTYMSAEEARD 226

Query: 198 WGVVDKVLMSR 208
           +G+VD+V+  R
Sbjct: 227 FGLVDQVVERR 237


>gi|188581623|ref|YP_001925068.1| ATP-dependent Clp protease proteolytic subunit [Methylobacterium
           populi BJ001]
 gi|226706462|sp|B1Z9C7|CLPP_METPB RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|179345121|gb|ACB80533.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Methylobacterium populi BJ001]
          Length = 208

 Score =  284 bits (727), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 131/201 (65%), Positives = 169/201 (84%), Gaps = 1/201 (0%)

Query: 9   KDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           +D  D F   LVPMVVEQ++RGER++DIYSRLL+ERI+F+TG +ED  A+LI AQLLFLE
Sbjct: 2   RDPVDYFHNSLVPMVVEQSSRGERAFDIYSRLLRERIIFLTGPVEDQGASLIVAQLLFLE 61

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEIS YINSPGGVVT+G++IYDTMQFI+ P++T C+GQAASMGSLLL+AGE G R
Sbjct: 62  AENPKKEISFYINSPGGVVTSGLSIYDTMQFIRCPVTTLCVGQAASMGSLLLAAGEAGHR 121

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FALPNARI++HQPSGGF GQA+DI  HA++I  +K+RLNEIYVK+ G+ YE + + L+RD
Sbjct: 122 FALPNARIMVHQPSGGFQGQATDILIHAREIEALKKRLNEIYVKHTGRDYETIHQALERD 181

Query: 188 HIMSASEACDWGVVDKVLMSR 208
           + M+A  A ++G++D +L  R
Sbjct: 182 NFMTADAAKEFGLIDDILHKR 202


>gi|116243166|sp|Q1GGF6|CLPP_SILST RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
          Length = 210

 Score =  284 bits (727), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 167/191 (87%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D M++LI AQLL LEAENP KEIS+
Sbjct: 12  LVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLIVAQLLHLEAENPSKEISM 71

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AGE GMRF+LPN+R+++
Sbjct: 72  YINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAGEAGMRFSLPNSRVMV 131

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGG+ GQA+DI  HA++ +K+KRRLNEIYVK+ G+ Y+ +EK L+RD+ MS  +A +
Sbjct: 132 HQPSGGYQGQATDIMIHAEETLKLKRRLNEIYVKHTGQDYDTIEKALERDNFMSPEQAKE 191

Query: 198 WGVVDKVLMSR 208
           +G++D+++ +R
Sbjct: 192 FGLIDEIVENR 202


>gi|290474663|ref|YP_003467543.1| clpA-clpP ATP-dependent serine protease proteolytic subunit
           [Xenorhabdus bovienii SS-2004]
 gi|289173976|emb|CBJ80763.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease
           [Xenorhabdus bovienii SS-2004]
          Length = 207

 Score =  284 bits (726), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 169/208 (81%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  K+D     + LVPMVVEQT RGER++DIYSRLLK+RI+F+TG +EDHMA LI 
Sbjct: 1   MSYSG--KQDKYAPNMSLVPMVVEQTARGERAFDIYSRLLKDRIIFLTGPVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I+LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDINLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GGF GQA+DIE HAQ+I+K+K R+NE+  K+ GK  E++
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAQEILKVKARMNELMAKHTGKPLEKI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
            +  +RD  +SA+E+ ++G+VD +   R
Sbjct: 179 VEDTERDRFLSAAESVEYGLVDSIFTQR 206


>gi|99081368|ref|YP_613522.1| ATP-dependent Clp protease proteolytic subunit [Ruegeria sp.
           TM1040]
 gi|99037648|gb|ABF64260.1| ATP-dependent Clp protease proteolytic subunit ClpP [Ruegeria sp.
           TM1040]
          Length = 218

 Score =  284 bits (726), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 167/191 (87%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D M++LI AQLL LEAENP KEIS+
Sbjct: 20  LVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLIVAQLLHLEAENPSKEISM 79

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AGE GMRF+LPN+R+++
Sbjct: 80  YINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAGEAGMRFSLPNSRVMV 139

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGG+ GQA+DI  HA++ +K+KRRLNEIYVK+ G+ Y+ +EK L+RD+ MS  +A +
Sbjct: 140 HQPSGGYQGQATDIMIHAEETLKLKRRLNEIYVKHTGQDYDTIEKALERDNFMSPEQAKE 199

Query: 198 WGVVDKVLMSR 208
           +G++D+++ +R
Sbjct: 200 FGLIDEIVENR 210


>gi|238919011|ref|YP_002932525.1| ATP-dependent Clp protease, proteolytic subunit ClpP, putative
           [Edwardsiella ictaluri 93-146]
 gi|259585951|sp|C5BCJ6|CLPP_EDWI9 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|238868579|gb|ACR68290.1| ATP-dependent Clp protease, proteolytic subunit ClpP, putative
           [Edwardsiella ictaluri 93-146]
          Length = 206

 Score =  284 bits (726), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 161/193 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI AQ+LFLEAENP+K+I
Sbjct: 13  MALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLIVAQMLFLEAENPEKDI 72

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMGS LL+AG +G RF LPN+R+
Sbjct: 73  HLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGSFLLAAGAQGKRFCLPNSRV 132

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DIE HA++I+ IK R+N +  K+ G+  E +E+  +RD  MSA +A
Sbjct: 133 MIHQPLGGFQGQATDIEIHAKEILSIKARMNTLMAKHSGQPIEVIERDTERDRFMSAQDA 192

Query: 196 CDWGVVDKVLMSR 208
            ++G+VD VL  R
Sbjct: 193 VEYGLVDAVLTQR 205


>gi|296536161|ref|ZP_06898289.1| endopeptidase Clp [Roseomonas cervicalis ATCC 49957]
 gi|296263532|gb|EFH10029.1| endopeptidase Clp [Roseomonas cervicalis ATCC 49957]
          Length = 213

 Score =  284 bits (726), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 125/200 (62%), Positives = 171/200 (85%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D  +++  LVPMV+EQT RGER++DIYSRLLKERI+F+TG + D M++LICAQLLFLE+
Sbjct: 4   RDPVELYNNLVPMVIEQTARGERAFDIYSRLLKERIIFLTGPVYDQMSSLICAQLLFLES 63

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP K+I+ YINSPGGVV+AG+A+YDTMQ+I+ P+ST C+G AASMGSLLL+AG KG RF
Sbjct: 64  ENPNKDIAFYINSPGGVVSAGLAMYDTMQYIRAPVSTVCLGMAASMGSLLLTAGAKGKRF 123

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           ALPN+RI++HQPSGG  GQA+DIE  A++I+ +++RLN+IYVK+ G+  EE+E+ L+RD 
Sbjct: 124 ALPNSRIMVHQPSGGAQGQATDIEIQAREILALRKRLNQIYVKHTGQPIEEIERKLERDS 183

Query: 189 IMSASEACDWGVVDKVLMSR 208
            MSA EA ++G++D+V++ R
Sbjct: 184 YMSAEEAKEFGLIDEVVLER 203


>gi|119774361|ref|YP_927101.1| ATP-dependent Clp protease proteolytic subunit [Shewanella
           amazonensis SB2B]
 gi|171704645|sp|A1S4X5|CLPP_SHEAM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|119766861|gb|ABL99431.1| ATP-dependent Clp protease proteolytic subunit ClpP [Shewanella
           amazonensis SB2B]
          Length = 202

 Score =  284 bits (726), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 130/197 (65%), Positives = 161/197 (81%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E VF  LVPMVVEQT +GERSYDIYSRLLKER++F+ GQ+E+HMA LI AQLLFLE+ENP
Sbjct: 6   ESVFNALVPMVVEQTAKGERSYDIYSRLLKERVIFLVGQVEEHMANLIVAQLLFLESENP 65

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            KEI LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQA SMG+ LL+ GEKGMR  LP
Sbjct: 66  DKEIYLYINSPGGSVTAGMAIYDTMQFIKPKVSTVCIGQACSMGAFLLAGGEKGMRHCLP 125

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+R+++HQP GGF GQASDI  HAQ+I+ IK +LN++   + G+  E +E+  DRD+ MS
Sbjct: 126 NSRVMIHQPLGGFQGQASDIAIHAQEILGIKHKLNQMLSHHTGQPMEVIERDTDRDNFMS 185

Query: 192 ASEACDWGVVDKVLMSR 208
           A++A ++G++D VL SR
Sbjct: 186 ATQAVEYGLIDSVLTSR 202


>gi|94676878|ref|YP_588715.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Baumannia
           cicadellinicola str. Hc (Homalodisca coagulata)]
 gi|116243128|sp|Q1LTJ9|CLPP_BAUCH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|94220028|gb|ABF14187.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Baumannia
           cicadellinicola str. Hc (Homalodisca coagulata)]
          Length = 205

 Score =  284 bits (726), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 126/194 (64%), Positives = 166/194 (85%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVE+T RGERSYDI+SRLLKERI+F+TG++ED+MA +I AQ++FLEAENP+K+I
Sbjct: 12  MALVPMVVERTLRGERSYDIFSRLLKERIIFMTGKVEDYMANIIVAQMIFLEAENPEKDI 71

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +T+GM+IYDTMQFIKP +STFCMGQAASMG+ LL+AG KG RF LPNAR+
Sbjct: 72  YLYINSPGGNITSGMSIYDTMQFIKPNVSTFCMGQAASMGAFLLAAGTKGKRFCLPNARM 131

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI+ HA++I+K+K R+NE+  K+ GKT + +E+  +RD  +SA+EA
Sbjct: 132 MIHQPMGGFQGQATDIQIHAKEILKVKNRMNELMAKHIGKTLQVIEQDTERDRFLSANEA 191

Query: 196 CDWGVVDKVLMSRI 209
            D+G+VD +L  RI
Sbjct: 192 VDYGLVDAILSHRI 205


>gi|93278470|pdb|1YG8|A Chain A, The Structure Of A V6a Variant Of Clpp.
 gi|93278471|pdb|1YG8|B Chain B, The Structure Of A V6a Variant Of Clpp.
 gi|93278472|pdb|1YG8|C Chain C, The Structure Of A V6a Variant Of Clpp.
 gi|93278473|pdb|1YG8|D Chain D, The Structure Of A V6a Variant Of Clpp.
 gi|93278474|pdb|1YG8|E Chain E, The Structure Of A V6a Variant Of Clpp.
 gi|93278475|pdb|1YG8|F Chain F, The Structure Of A V6a Variant Of Clpp.
 gi|93278476|pdb|1YG8|G Chain G, The Structure Of A V6a Variant Of Clpp.
 gi|93278477|pdb|1YG8|H Chain H, The Structure Of A V6a Variant Of Clpp.
 gi|93278478|pdb|1YG8|I Chain I, The Structure Of A V6a Variant Of Clpp.
 gi|93278479|pdb|1YG8|J Chain J, The Structure Of A V6a Variant Of Clpp.
 gi|93278480|pdb|1YG8|K Chain K, The Structure Of A V6a Variant Of Clpp.
 gi|93278481|pdb|1YG8|L Chain L, The Structure Of A V6a Variant Of Clpp.
 gi|93278482|pdb|1YG8|M Chain M, The Structure Of A V6a Variant Of Clpp.
 gi|93278483|pdb|1YG8|N Chain N, The Structure Of A V6a Variant Of Clpp.
 gi|93278484|pdb|1YG8|O Chain O, The Structure Of A V6a Variant Of Clpp.
 gi|93278485|pdb|1YG8|P Chain P, The Structure Of A V6a Variant Of Clpp.
 gi|93278486|pdb|1YG8|Q Chain Q, The Structure Of A V6a Variant Of Clpp.
 gi|93278487|pdb|1YG8|R Chain R, The Structure Of A V6a Variant Of Clpp.
 gi|93278488|pdb|1YG8|S Chain S, The Structure Of A V6a Variant Of Clpp.
 gi|93278489|pdb|1YG8|T Chain T, The Structure Of A V6a Variant Of Clpp.
 gi|93278490|pdb|1YG8|U Chain U, The Structure Of A V6a Variant Of Clpp.
 gi|93278491|pdb|1YG8|V Chain V, The Structure Of A V6a Variant Of Clpp.
 gi|93278492|pdb|1YG8|W Chain W, The Structure Of A V6a Variant Of Clpp.
 gi|93278493|pdb|1YG8|X Chain X, The Structure Of A V6a Variant Of Clpp.
 gi|93278494|pdb|1YG8|Y Chain Y, The Structure Of A V6a Variant Of Clpp.
 gi|93278495|pdb|1YG8|Z Chain Z, The Structure Of A V6a Variant Of Clpp.
 gi|93278496|pdb|1YG8|AA Chain a, The Structure Of A V6a Variant Of Clpp.
 gi|93278497|pdb|1YG8|BB Chain b, The Structure Of A V6a Variant Of Clpp
          Length = 193

 Score =  283 bits (725), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 124/192 (64%), Positives = 163/192 (84%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            L PMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI AQ+LFLEAENP+K+I 
Sbjct: 1   ALAPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIY 60

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+AG KG RF LPN+R++
Sbjct: 61  LYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVM 120

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++E+  +RD  +SA EA 
Sbjct: 121 IHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAV 180

Query: 197 DWGVVDKVLMSR 208
           ++G+VD +L  R
Sbjct: 181 EYGLVDSILTHR 192


>gi|260459137|ref|ZP_05807392.1| Endopeptidase Clp [Mesorhizobium opportunistum WSM2075]
 gi|259034691|gb|EEW35947.1| Endopeptidase Clp [Mesorhizobium opportunistum WSM2075]
          Length = 201

 Score =  283 bits (725), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 159/191 (83%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMV+EQ++RGER++DI+SRLL+ERI+F+ G+I D ++ L+CAQLL LE++NP KEISL
Sbjct: 7   LVPMVIEQSSRGERAFDIFSRLLRERIIFINGEINDDISALVCAQLLSLESDNPDKEISL 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G AIYDTMQ+I  P+ST CMG AASMGS LL AG  G R +LPNA ILL
Sbjct: 67  YINSPGGVVTSGFAIYDTMQYISCPVSTVCMGFAASMGSFLLMAGTPGRRISLPNATILL 126

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQASDI+RHA+ IVK KR + E+Y ++CG++YEEVE+TLDRDH M+A EA  
Sbjct: 127 HQPLGGFQGQASDIQRHAERIVKTKRHMAELYAQHCGRSYEEVERTLDRDHFMTAREAQA 186

Query: 198 WGVVDKVLMSR 208
           WG+VD V  +R
Sbjct: 187 WGIVDHVFDTR 197


>gi|198283159|ref|YP_002219480.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218667656|ref|YP_002425388.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198247680|gb|ACH83273.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218519869|gb|ACK80455.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 214

 Score =  283 bits (725), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 160/193 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG VPMVVEQT RGERSYDIYSRLLKER+VF+ GQ+ED MA L+ AQLLFLEAENP K+I
Sbjct: 16  LGYVPMVVEQTGRGERSYDIYSRLLKERVVFLVGQVEDMMANLVVAQLLFLEAENPDKDI 75

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           +LYINSPGG VTAGMAIYDTMQF++P IST C+GQAASMG++LL+AG +G R+ALPNARI
Sbjct: 76  ALYINSPGGSVTAGMAIYDTMQFVRPKISTVCIGQAASMGAVLLAAGAEGKRYALPNARI 135

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           +LHQPSGGF GQA DIE H ++I++I+ RLN+I V + G+  E +E+ LDRD  MSA EA
Sbjct: 136 MLHQPSGGFQGQAHDIEIHTKEILRIRERLNDILVHHTGQGRERIEQDLDRDFFMSAEEA 195

Query: 196 CDWGVVDKVLMSR 208
             + +VD V+  R
Sbjct: 196 QTYHLVDAVISHR 208


>gi|88800033|ref|ZP_01115603.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Reinekea sp.
           MED297]
 gi|88777159|gb|EAR08364.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Reinekea sp.
           MED297]
          Length = 209

 Score =  283 bits (725), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 126/192 (65%), Positives = 164/192 (85%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMVVEQT+RGERS+DIYSRLLKE ++F+ GQ+ED+MA L+ AQLLFLE+ENP K+I 
Sbjct: 18  GLVPMVVEQTSRGERSFDIYSRLLKENVIFLVGQVEDYMANLVVAQLLFLESENPDKDIH 77

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+LLL+ G KG R+ LPN+R++
Sbjct: 78  LYINSPGGSVTAGMAIYDTMQFIKPDVSTMCIGQAASMGALLLTGGAKGKRYCLPNSRMM 137

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG+ GQA+DIE HA++I+++KRRLNEI   + G+  E+VE+  DRD+ M+A +A 
Sbjct: 138 IHQPLGGYQGQATDIEIHAREILEMKRRLNEIMAHHTGRPLEDVERDTDRDNFMTAEQAV 197

Query: 197 DWGVVDKVLMSR 208
           D+G+VD+V+ +R
Sbjct: 198 DYGLVDQVITNR 209


>gi|156935010|ref|YP_001438926.1| hypothetical protein ESA_02861 [Cronobacter sakazakii ATCC BAA-894]
 gi|156533264|gb|ABU78090.1| hypothetical protein ESA_02861 [Cronobacter sakazakii ATCC BAA-894]
          Length = 194

 Score =  283 bits (724), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 164/193 (84%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+ED MA LI AQ+LFLEAENP+K+I
Sbjct: 1   MALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDQMANLIVAQMLFLEAENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFI+P +ST CMGQAASMG+ LL+AG KG RF LPN+R+
Sbjct: 61  YLYINSPGGVITAGMSIYDTMQFIQPDVSTICMGQAASMGAFLLTAGTKGKRFCLPNSRV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG+ GQA+DIE HA++I+K+K R+NE+  ++ G+  E++E+  +RD  +SA EA
Sbjct: 121 MIHQPLGGYQGQATDIEIHAREILKVKARMNELMAQHTGQPLEQIERDTERDRFLSAGEA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G+VD ++  R
Sbjct: 181 VEYGLVDSIMTHR 193


>gi|262277075|ref|ZP_06054868.1| ATP-dependent Clp protease, proteolytic subunit ClpP [alpha
           proteobacterium HIMB114]
 gi|262224178|gb|EEY74637.1| ATP-dependent Clp protease, proteolytic subunit ClpP [alpha
           proteobacterium HIMB114]
          Length = 204

 Score =  283 bits (724), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 131/201 (65%), Positives = 167/201 (83%), Gaps = 1/201 (0%)

Query: 9   KDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           KD  D+++  LVPMV+EQT RGERS+DIYSRLLKERI+F+TG I  ++++L+ AQLLFLE
Sbjct: 2   KDPFDIYMNTLVPMVIEQTPRGERSFDIYSRLLKERIIFLTGPINSYISSLVSAQLLFLE 61

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           +EN  KEI LYINSPGGVVT G+AIYDTMQFIKP +ST C+GQAASMGS LL+AGEKG+R
Sbjct: 62  SENNSKEIYLYINSPGGVVTDGLAIYDTMQFIKPTVSTLCIGQAASMGSFLLAAGEKGLR 121

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
            +LPNARI++HQPS GF GQA+DIE H ++I+  K+RLNEIY K+ G+T E +++ L+RD
Sbjct: 122 MSLPNARIMVHQPSAGFQGQATDIEIHTKEILSTKKRLNEIYSKHTGQTVETIKEALERD 181

Query: 188 HIMSASEACDWGVVDKVLMSR 208
           + MSA EA  +G+VDKV+  R
Sbjct: 182 NFMSAEEAKKFGLVDKVVEKR 202


>gi|126733145|ref|ZP_01748892.1| Clp protease, putative [Roseobacter sp. CCS2]
 gi|126716011|gb|EBA12875.1| Clp protease, putative [Roseobacter sp. CCS2]
          Length = 206

 Score =  283 bits (724), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 125/200 (62%), Positives = 167/200 (83%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D  + ++ LVPMVVEQT RGER+YDI+SRLLKERI+FV G + D M+ LI AQLL LE+
Sbjct: 2   QDPTETYMNLVPMVVEQTARGERAYDIFSRLLKERIIFVNGPVHDGMSQLIVAQLLHLES 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEIS+YINSPGGVVT+G++IYDTMQ+I+P +ST  +GQAASMGSLLL+AG +GMRF
Sbjct: 62  ENPKKEISMYINSPGGVVTSGLSIYDTMQYIRPKVSTLVIGQAASMGSLLLTAGSEGMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           +LPN+R+++HQPSGG+ GQA+DI  HA +  K+K RLNEIYVK+ G T ++VE  L+RD+
Sbjct: 122 SLPNSRVMVHQPSGGYQGQATDIMIHAAETQKLKTRLNEIYVKHTGNTLKKVEAALERDN 181

Query: 189 IMSASEACDWGVVDKVLMSR 208
            MS  EA +WG++D+++ +R
Sbjct: 182 FMSPEEAKEWGLIDEIVENR 201


>gi|254455562|ref|ZP_05068991.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Candidatus
           Pelagibacter sp. HTCC7211]
 gi|207082564|gb|EDZ59990.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Candidatus
           Pelagibacter sp. HTCC7211]
          Length = 203

 Score =  283 bits (723), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 164/191 (85%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQ+N+GER+YDIYSRLLKERI+F+TGQI D++A+L+ AQLLFLEAE+P+KEI L
Sbjct: 12  LVPMVVEQSNKGERAYDIYSRLLKERIIFLTGQINDNVASLVTAQLLFLEAEDPKKEIYL 71

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG+VTAG+ IYDTMQ++KP IST C+GQAASMGS LL+AG KG RF+LPN+R+++
Sbjct: 72  YINSPGGLVTAGLGIYDTMQYVKPDISTLCIGQAASMGSFLLAAGTKGKRFSLPNSRVMV 131

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPS GF GQ +DIE HA ++  +K+RLNEIY K+ GK+ +EV+  L+RD+ M+A  A D
Sbjct: 132 HQPSAGFQGQVTDIEIHANEVSSLKKRLNEIYSKHTGKSVDEVKAALERDNFMTADVAKD 191

Query: 198 WGVVDKVLMSR 208
           +G++D+V+  R
Sbjct: 192 FGLIDEVVEKR 202


>gi|163743918|ref|ZP_02151288.1| Protease subunit of ATP-dependent Clp protease [Phaeobacter
           gallaeciensis 2.10]
 gi|161382763|gb|EDQ07162.1| Protease subunit of ATP-dependent Clp protease [Phaeobacter
           gallaeciensis 2.10]
          Length = 202

 Score =  283 bits (723), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 170/197 (86%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D M++LI AQLL LEAENP KEIS+
Sbjct: 4   LVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLIVAQLLHLEAENPSKEISM 63

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AGE GMRF+LPN+R+++
Sbjct: 64  YINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAGEAGMRFSLPNSRVMV 123

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGGF GQA+DI  HA++ +K+K+RLNEIYVK+ G+ Y+++   L+RD+ MS  EA D
Sbjct: 124 HQPSGGFQGQATDIMIHAEETLKLKKRLNEIYVKHTGQEYDKIVDALERDNFMSPEEAKD 183

Query: 198 WGVVDKVLMSRIDIEEK 214
           +G++D+++ +R  ++++
Sbjct: 184 FGLIDEIVENRSKLDDQ 200


>gi|149911805|ref|ZP_01900408.1| ATP-dependent Clp protease proteolytic subunit [Moritella sp. PE36]
 gi|149805105|gb|EDM65128.1| ATP-dependent Clp protease proteolytic subunit [Moritella sp. PE36]
          Length = 207

 Score =  283 bits (723), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 160/191 (83%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQT +GERSYDIYSRLLK+R++F+TGQ+EDHMA L+ AQLLFLE+ENP K+I L
Sbjct: 16  LVPMVVEQTAKGERSYDIYSRLLKDRVIFLTGQVEDHMANLVVAQLLFLESENPDKDIFL 75

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG V+AGM+IYDTMQFIKP +ST CMG AASMG+ LL+ GEKG R ALPNA+I++
Sbjct: 76  YINSPGGSVSAGMSIYDTMQFIKPNVSTICMGMAASMGAFLLAGGEKGKRHALPNAKIMI 135

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG+ GQASDIE HA +I+K KR+LNEI  ++ G+ Y+ + +  DRD+ M+++EA D
Sbjct: 136 HQPLGGYQGQASDIEIHANEIIKTKRKLNEILAEHTGQEYDRLARDTDRDNFMTSAEAMD 195

Query: 198 WGVVDKVLMSR 208
           +G++D V+  R
Sbjct: 196 YGLIDTVITKR 206


>gi|119898362|ref|YP_933575.1| ATP-dependent Clp protease proteolytic subunit [Azoarcus sp. BH72]
 gi|166201798|sp|A1K783|CLPP_AZOSB RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|119670775|emb|CAL94688.1| Endopeptidase Clp [Azoarcus sp. BH72]
          Length = 212

 Score =  283 bits (723), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 131/199 (65%), Positives = 163/199 (81%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           + V LGL+PMVVEQ+ RGERSYDIYSRLLKER+VF+ G + D  A LI AQLLFLE+ENP
Sbjct: 13  DPVGLGLIPMVVEQSGRGERSYDIYSRLLKERVVFLVGPVNDVTANLIVAQLLFLESENP 72

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            K+I  YINSPGG VTAG+AIYDTMQFIKP +ST C+GQAASMG+ LL+AGEKG RF LP
Sbjct: 73  DKDIYFYINSPGGSVTAGLAIYDTMQFIKPNVSTLCIGQAASMGAFLLAAGEKGKRFCLP 132

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+R+++HQP GGF GQASDIE HA++I+ ++ RLN +  K+ G+T E++EK  DRD+ MS
Sbjct: 133 NSRVMIHQPLGGFQGQASDIEIHAREILYLRERLNGMLAKHTGQTIEQIEKDTDRDNFMS 192

Query: 192 ASEACDWGVVDKVLMSRID 210
           A+ A ++G+VDKVL SR D
Sbjct: 193 ATAAVEYGLVDKVLTSRAD 211


>gi|301598440|pdb|3HLN|A Chain A, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598441|pdb|3HLN|B Chain B, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598442|pdb|3HLN|C Chain C, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598443|pdb|3HLN|D Chain D, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598444|pdb|3HLN|E Chain E, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598445|pdb|3HLN|F Chain F, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598446|pdb|3HLN|G Chain G, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598447|pdb|3HLN|H Chain H, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598448|pdb|3HLN|I Chain I, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598449|pdb|3HLN|J Chain J, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598450|pdb|3HLN|K Chain K, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598451|pdb|3HLN|L Chain L, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598452|pdb|3HLN|M Chain M, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598453|pdb|3HLN|N Chain N, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598454|pdb|3HLN|O Chain O, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598455|pdb|3HLN|P Chain P, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598456|pdb|3HLN|Q Chain Q, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598457|pdb|3HLN|R Chain R, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598458|pdb|3HLN|S Chain S, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598459|pdb|3HLN|T Chain T, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598460|pdb|3HLN|U Chain U, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598461|pdb|3HLN|V Chain V, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598462|pdb|3HLN|W Chain W, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598463|pdb|3HLN|X Chain X, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598464|pdb|3HLN|Y Chain Y, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598465|pdb|3HLN|Z Chain Z, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598466|pdb|3HLN|1 Chain 1, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598467|pdb|3HLN|2 Chain 2, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
          Length = 193

 Score =  282 bits (722), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 124/192 (64%), Positives = 163/192 (84%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI AQ+LFLEAENP+K+I 
Sbjct: 1   ALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIY 60

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+AG KG RF LPN+R++
Sbjct: 61  LYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVM 120

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG+ GQA+DIE H ++I+K+K R+NE+   + G++ E++E+  +RD  +SA EA 
Sbjct: 121 IHQPLGGYQGQATDIEIHCREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAV 180

Query: 197 DWGVVDKVLMSR 208
           ++G+VD +L  R
Sbjct: 181 EYGLVDSILTHR 192


>gi|218510872|ref|ZP_03508750.1| ATP-dependent Clp protease proteolytic subunit [Rhizobium etli
           Brasil 5]
          Length = 153

 Score =  282 bits (722), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 128/153 (83%), Positives = 145/153 (94%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQTNRGERSYDIYSRLLKERI+F+TG +EDHMATL+CAQLLFLEAENP+KEI
Sbjct: 1   MALVPMVVEQTNRGERSYDIYSRLLKERIIFLTGAVEDHMATLVCAQLLFLEAENPKKEI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           +LYINSPGGVVTAGMAIYDTMQFIKP +ST C+GQAASMGSLLL+AG K MRFA PN+RI
Sbjct: 61  ALYINSPGGVVTAGMAIYDTMQFIKPAVSTLCIGQAASMGSLLLAAGHKDMRFATPNSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEI 168
           ++HQPSGGF GQASDIERHA+DI+K+KRRLNE+
Sbjct: 121 MVHQPSGGFQGQASDIERHARDILKMKRRLNEV 153


>gi|296112317|ref|YP_003626255.1| ATP-dependent Clp protease proteolytic subunit ClpP [Moraxella
           catarrhalis RH4]
 gi|295920011|gb|ADG60362.1| ATP-dependent Clp protease proteolytic subunit ClpP [Moraxella
           catarrhalis RH4]
          Length = 217

 Score =  282 bits (722), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 128/192 (66%), Positives = 163/192 (84%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMV+EQ+ RGERS+DI+SRLL+ER++F+TGQ+ED+MA LI AQLLFLEA+NP+K+I 
Sbjct: 22  ALVPMVIEQSGRGERSFDIFSRLLRERVIFLTGQVEDNMANLIVAQLLFLEADNPEKDIH 81

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGVVTAGMAIYDTM FIKP +ST CMGQAASMGS LLSAGEKG R+AL N+R++
Sbjct: 82  LYINSPGGVVTAGMAIYDTMNFIKPHVSTICMGQAASMGSFLLSAGEKGKRYALANSRVM 141

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDIE HA++I+++K +LN +  ++ G+  E++E+  DRDH MSA +A 
Sbjct: 142 IHQPLGGFRGQASDIEIHAREIIELKAKLNRLLAEHTGQPIEKLERDTDRDHFMSAEQAR 201

Query: 197 DWGVVDKVLMSR 208
           D+G+VD VL  R
Sbjct: 202 DYGLVDVVLDKR 213


>gi|126741244|ref|ZP_01756923.1| Protease subunit of ATP-dependent Clp protease [Roseobacter sp.
           SK209-2-6]
 gi|126717649|gb|EBA14372.1| Protease subunit of ATP-dependent Clp protease [Roseobacter sp.
           SK209-2-6]
          Length = 210

 Score =  282 bits (722), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 126/191 (65%), Positives = 166/191 (86%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D M++LI AQLL LEAENP KEIS+
Sbjct: 12  LVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLIVAQLLHLEAENPSKEISM 71

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AGE GMRF+LPN+R+++
Sbjct: 72  YINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAGEAGMRFSLPNSRVMV 131

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGGF GQA+DI  HA++ +K+KRRLNEIYVK+ G+  ++VE  L+RD+ MS  EA +
Sbjct: 132 HQPSGGFQGQATDIMIHAEETLKLKRRLNEIYVKHTGQELDKVEAALERDNFMSPEEAKE 191

Query: 198 WGVVDKVLMSR 208
           +G++D+++ +R
Sbjct: 192 FGLIDEIVENR 202


>gi|256823172|ref|YP_003147135.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Kangiella
           koreensis DSM 16069]
 gi|256796711|gb|ACV27367.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Kangiella
           koreensis DSM 16069]
          Length = 205

 Score =  282 bits (722), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 126/192 (65%), Positives = 160/192 (83%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GL+PMVVEQT+RGERSYDIYSRLLKER++F  GQ+ED+MA  I AQ+LFLE++NP K+I 
Sbjct: 11  GLIPMVVEQTSRGERSYDIYSRLLKERVIFCVGQVEDYMANSIVAQMLFLESDNPDKDIY 70

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGVVTAG++IYDTMQFI+P +ST C+GQAASMG+LLL+ G KG R  LPN+R++
Sbjct: 71  LYINSPGGVVTAGLSIYDTMQFIRPDVSTVCVGQAASMGALLLTGGAKGKRHTLPNSRMM 130

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI  HAQ+I ++K RLN I   +CGKT EEVE+  DRD+ ++A EA 
Sbjct: 131 IHQPLGGFQGQASDIAIHAQEITELKHRLNSIMAHHCGKTVEEVERDTDRDNFLTADEAV 190

Query: 197 DWGVVDKVLMSR 208
           ++G+VD ++ SR
Sbjct: 191 EYGLVDSIISSR 202


>gi|13470920|ref|NP_102489.1| ATP-dependent protease proteolytic subunit ClpP-like protein
           [Mesorhizobium loti MAFF303099]
 gi|18202652|sp|Q98M38|CLPP1_RHILO RecName: Full=ATP-dependent Clp protease proteolytic subunit 1;
           AltName: Full=Endopeptidase Clp 1
 gi|14021663|dbj|BAB48275.1| ATP-dependent protease proteolytic subunit ClpP-like protein
           [Mesorhizobium loti MAFF303099]
          Length = 201

 Score =  282 bits (722), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 159/191 (83%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMV+EQ++RGER++DI+SRLL+ERI+F+ G+I D ++ L+CAQLL LE++NP KEISL
Sbjct: 7   LVPMVIEQSSRGERAFDIFSRLLRERIIFINGEINDDVSALVCAQLLSLESDNPDKEISL 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G AIYDTMQ++  P+ST CMG AASMGS LL AG  G R ALPNA ILL
Sbjct: 67  YINSPGGVVTSGFAIYDTMQYVSCPVSTVCMGFAASMGSFLLMAGTPGRRIALPNATILL 126

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQASDI+RHA+ I K K+R+ E+Y ++CG++YEEVE+TLDRDH M+A EA  
Sbjct: 127 HQPLGGFQGQASDIQRHAERIGKTKQRMAELYAQHCGRSYEEVERTLDRDHFMTAREAQT 186

Query: 198 WGVVDKVLMSR 208
           WG+VD V  +R
Sbjct: 187 WGIVDHVFDTR 197


>gi|110633884|ref|YP_674092.1| ATP-dependent Clp protease proteolytic subunit ClpP [Mesorhizobium
           sp. BNC1]
 gi|116243115|sp|Q11I48|CLPP2_MESSB RecName: Full=ATP-dependent Clp protease proteolytic subunit 2;
           AltName: Full=Endopeptidase Clp 2
 gi|110284868|gb|ABG62927.1| ATP-dependent Clp protease proteolytic subunit ClpP [Chelativorans
           sp. BNC1]
          Length = 208

 Score =  282 bits (722), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 125/193 (64%), Positives = 162/193 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+PMVVEQ+ RGERS+DI+SRLL+ERI+F+ GQ++D+ A L+CAQ+L LEAENP+KEI
Sbjct: 5   MNLIPMVVEQSARGERSFDIFSRLLRERIIFLNGQVDDNSAALVCAQMLHLEAENPKKEI 64

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           + YINSPGGVV++G AIYDTMQFIK P++T C+G AASMGS LL AGE+GMR ALPNA I
Sbjct: 65  AFYINSPGGVVSSGFAIYDTMQFIKCPVATLCLGTAASMGSFLLMAGERGMRVALPNASI 124

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           +LHQP GGF GQASDIERHAQ++++ KRR+  +Y ++CG+  E+VE+TLDRD  M+A +A
Sbjct: 125 ILHQPLGGFQGQASDIERHAQNVMRHKRRMIRLYAEHCGRAEEDVERTLDRDFFMTAEDA 184

Query: 196 CDWGVVDKVLMSR 208
            +WG+VD V   R
Sbjct: 185 REWGLVDHVYRRR 197


>gi|326561827|gb|EGE12162.1| ATP-dependent Clp protease proteolytic subunit ClpP [Moraxella
           catarrhalis 7169]
 gi|326563259|gb|EGE13526.1| ATP-dependent Clp protease proteolytic subunit ClpP [Moraxella
           catarrhalis 46P47B1]
 gi|326563373|gb|EGE13638.1| ATP-dependent Clp protease proteolytic subunit ClpP [Moraxella
           catarrhalis 12P80B1]
 gi|326565911|gb|EGE16072.1| ATP-dependent Clp protease proteolytic subunit ClpP [Moraxella
           catarrhalis 103P14B1]
 gi|326568952|gb|EGE19021.1| ATP-dependent Clp protease proteolytic subunit ClpP [Moraxella
           catarrhalis BC1]
 gi|326569251|gb|EGE19312.1| ATP-dependent Clp protease proteolytic subunit ClpP [Moraxella
           catarrhalis BC7]
 gi|326571926|gb|EGE21931.1| ATP-dependent Clp protease proteolytic subunit ClpP [Moraxella
           catarrhalis BC8]
 gi|326575439|gb|EGE25364.1| ATP-dependent Clp protease proteolytic subunit ClpP [Moraxella
           catarrhalis 101P30B1]
 gi|326576473|gb|EGE26381.1| ATP-dependent Clp protease proteolytic subunit ClpP [Moraxella
           catarrhalis CO72]
 gi|326577944|gb|EGE27808.1| ATP-dependent Clp protease proteolytic subunit ClpP [Moraxella
           catarrhalis O35E]
          Length = 217

 Score =  282 bits (721), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 128/192 (66%), Positives = 163/192 (84%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMV+EQ+ RGERS+DI+SRLL+ER++F+TGQ+ED+MA LI AQLLFLEA+NP+K+I 
Sbjct: 22  ALVPMVIEQSGRGERSFDIFSRLLRERVIFLTGQVEDNMANLIVAQLLFLEADNPEKDIH 81

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGVVTAGMAIYDTM FIKP +ST CMGQAASMGS LLSAGEKG R+AL N+R++
Sbjct: 82  LYINSPGGVVTAGMAIYDTMNFIKPHVSTICMGQAASMGSFLLSAGEKGKRYALANSRVM 141

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDIE HA++I+++K +LN +  ++ G+  E++E+  DRDH MSA +A 
Sbjct: 142 IHQPLGGFRGQASDIEIHAREIIELKAKLNRLLAEHTGQPIEKLERDTDRDHFMSAEQAR 201

Query: 197 DWGVVDKVLMSR 208
           D+G+VD VL  R
Sbjct: 202 DYGLVDVVLDKR 213


>gi|85713354|ref|ZP_01044368.1| Protease subunit of ATP-dependent Clp protease [Idiomarina baltica
           OS145]
 gi|85692821|gb|EAQ30805.1| Protease subunit of ATP-dependent Clp protease [Idiomarina baltica
           OS145]
          Length = 205

 Score =  282 bits (721), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 160/200 (80%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
            D +D    LVPMVVEQT++GERSYDIYSRLLKER++F  GQ+EDHMA LI AQLLFLE+
Sbjct: 3   NDIQDPMAQLVPMVVEQTSKGERSYDIYSRLLKERVIFCCGQVEDHMANLIVAQLLFLES 62

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           +NP K+I LYINSPGGVVTAGMAIYDTM+FIKP +ST CMGQAASMG+ LL+ G +G R+
Sbjct: 63  DNPDKDIYLYINSPGGVVTAGMAIYDTMRFIKPDVSTVCMGQAASMGAFLLAGGAQGKRY 122

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
            LPN+R+++HQP GGF GQASD E HA+ I+ +K RLN +  +N G+ YE+V +  DRDH
Sbjct: 123 CLPNSRVMIHQPLGGFQGQASDFEIHAKQILDLKERLNRMLAENTGQDYEKVARDTDRDH 182

Query: 189 IMSASEACDWGVVDKVLMSR 208
            ++A EA D+G+VD +L  R
Sbjct: 183 FLTAPEAVDYGLVDGILNKR 202


>gi|56460113|ref|YP_155394.1| ATP-dependent Clp protease proteolytic subunit [Idiomarina
           loihiensis L2TR]
 gi|67460202|sp|Q5QXN8|CLPP_IDILO RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|56179123|gb|AAV81845.1| Protease subunit of ATP-dependent Clp protease [Idiomarina
           loihiensis L2TR]
          Length = 206

 Score =  282 bits (721), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 160/199 (80%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           D +D    LVPMVVEQT++GERSYDIYSRLLKER++F  GQ+EDHMA LI AQLLFLE++
Sbjct: 4   DIQDPMAQLVPMVVEQTSKGERSYDIYSRLLKERVIFCCGQVEDHMANLIVAQLLFLESD 63

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP K+I LYINSPGGVVTAGMAIYDTM+FIKP +ST CMGQAASMG+ LL+ G +G R+ 
Sbjct: 64  NPDKDIYLYINSPGGVVTAGMAIYDTMRFIKPDVSTVCMGQAASMGAFLLAGGAQGKRYC 123

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPN+R+++HQP GGF GQASD E HA+ I+ +K RLN +  +N G+ YE+V +  DRDH 
Sbjct: 124 LPNSRVMIHQPLGGFQGQASDFEIHAKQILDLKERLNRMLAENTGQDYEKVARDTDRDHF 183

Query: 190 MSASEACDWGVVDKVLMSR 208
           +SA E+ D+G+VD +L  R
Sbjct: 184 LSAEESIDYGLVDGILRQR 202


>gi|117926916|ref|YP_867533.1| ATP-dependent Clp protease proteolytic subunit ClpP [Magnetococcus
           sp. MC-1]
 gi|254763794|sp|A0LDT4|CLPP_MAGSM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|117610672|gb|ABK46127.1| ATP-dependent Clp protease proteolytic subunit ClpP [Magnetococcus
           sp. MC-1]
          Length = 202

 Score =  282 bits (721), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 125/193 (64%), Positives = 162/193 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVE TNRGER+YDIYSRLLKER+VF+ GQ+E+HMA L+ AQLLFLE+ENP+K+I
Sbjct: 1   MSLVPMVVETTNRGERAYDIYSRLLKERVVFLVGQVEEHMANLVVAQLLFLESENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAGMAIYDTMQFI+P +ST C+GQAASMG++LL+AGE G R  LPNAR+
Sbjct: 61  HLYINSPGGSVTAGMAIYDTMQFIRPSVSTLCIGQAASMGAVLLAAGEAGKRLVLPNARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGFSGQASD E HA++I++I+  LN++   + GK  E+V+   +RD+ +SA+EA
Sbjct: 121 MIHQPLGGFSGQASDFEIHAREILRIRENLNQVLSHHTGKPLEQVQLDTERDNFLSATEA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G+VDKV+  R
Sbjct: 181 VEYGLVDKVISHR 193


>gi|319783748|ref|YP_004143224.1| endopeptidase Clp [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317169636|gb|ADV13174.1| Endopeptidase Clp [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 201

 Score =  282 bits (721), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 158/191 (82%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMV+EQ++RGER++DI+SRLL+ERI+F+ G+I D ++ L+CAQLL LE++NP KEISL
Sbjct: 7   LVPMVIEQSSRGERAFDIFSRLLRERIIFINGEINDDISALVCAQLLSLESDNPDKEISL 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G AIYDTMQ+I  P+ST CMG AASMGS LL AG  G R +LPNA ILL
Sbjct: 67  YINSPGGVVTSGFAIYDTMQYISCPVSTVCMGFAASMGSFLLMAGTPGRRISLPNATILL 126

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQASDI+RHA+ I + KR + E+Y ++CG+TYEEVE+TLDRDH M+A EA  
Sbjct: 127 HQPLGGFQGQASDIQRHAERIGRTKRHMTELYAQHCGRTYEEVERTLDRDHFMTAREAQA 186

Query: 198 WGVVDKVLMSR 208
           WG+VD V  +R
Sbjct: 187 WGIVDHVFDTR 197


>gi|238898003|ref|YP_002923683.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease
           [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
 gi|259585958|sp|C4K4P2|CLPP_HAMD5 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|229465761|gb|ACQ67535.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease
           [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
          Length = 215

 Score =  282 bits (721), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 166/201 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGER+YDIYSR+LKER++F+TGQ+E+HMA LI AQ+LFLEAENP+K+I
Sbjct: 14  MTLVPMVVEQTSRGERAYDIYSRMLKERVIFLTGQVEEHMANLIVAQMLFLEAENPEKDI 73

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFI P +ST C+GQA SMG+ LL+AG K  R+ LPNAR+
Sbjct: 74  YLYINSPGGVITAGMSIYDTMQFITPDVSTICIGQACSMGAFLLAAGAKSKRYCLPNARV 133

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDIE HA++I+K+K+R+N++   +  KT + +EK  +RDH +SA EA
Sbjct: 134 MIHQPLGGFQGQASDIEIHAKEILKVKKRMNDLMAIHTKKTLKIIEKDTERDHFLSAEEA 193

Query: 196 CDWGVVDKVLMSRIDIEEKSK 216
             +G+VD VL  R D++  SK
Sbjct: 194 KKYGLVDCVLTERKDVKNFSK 214


>gi|237653230|ref|YP_002889544.1| ATP-dependent Clp protease proteolytic subunit [Thauera sp. MZ1T]
 gi|237624477|gb|ACR01167.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Thauera sp.
           MZ1T]
          Length = 212

 Score =  281 bits (720), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 132/201 (65%), Positives = 162/201 (80%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           D   V LGLVPMVVEQ+ RGER+YDIYSRLLKER+VF+ G + D  A LI AQLLFLE+E
Sbjct: 11  DWNPVGLGLVPMVVEQSGRGERAYDIYSRLLKERVVFLVGPVNDVTANLIVAQLLFLESE 70

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP K+I  YINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+AGEKG RF 
Sbjct: 71  NPDKDIYFYINSPGGSVTAGMAIYDTMQFIKPNVSTLCIGQAASMGAFLLAAGEKGKRFI 130

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPN+R+++HQP GGF GQASDIE HA++I+ ++ RLN++  K+ G+  E +EK  DRD+ 
Sbjct: 131 LPNSRVMIHQPLGGFQGQASDIEIHAREILYLRSRLNDMLSKHTGQALERIEKDTDRDNF 190

Query: 190 MSASEACDWGVVDKVLMSRID 210
           MSA+ A ++G+VDKVL SR D
Sbjct: 191 MSATAAVEYGLVDKVLTSRDD 211


>gi|67459164|ref|YP_246788.1| ATP-dependent Clp protease proteolytic subunit [Rickettsia felis
           URRWXCal2]
 gi|75536404|sp|Q4ULF0|CLPP_RICFE RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|67004697|gb|AAY61623.1| ATP-dependent Clp protease proteolytic subunit [Rickettsia felis
           URRWXCal2]
          Length = 201

 Score =  281 bits (720), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 164/193 (84%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +  VP+V+EQT+RGER+YDIYSRLLKERI+FV   +EDHMA L+ AQLLFLEAENP+K+I
Sbjct: 1   MSYVPIVIEQTSRGERAYDIYSRLLKERIIFVCSTVEDHMANLVVAQLLFLEAENPKKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGGVVTAG+AIYDTMQ+IKP ++T C+GQA SMGSLLL  GEKGMR++LP++RI
Sbjct: 61  YMYINSPGGVVTAGLAIYDTMQYIKPKVATLCIGQACSMGSLLLCGGEKGMRYSLPHSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG+ GQA+DIE HAQ+ +KIKR LNE+Y K+ G+  + +EK+++RD+ MS  EA
Sbjct: 121 MIHQPSGGYRGQATDIEIHAQETLKIKRLLNELYSKHTGQELKHIEKSMERDNFMSPEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G++D ++ SR
Sbjct: 181 KKFGIIDNIISSR 193


>gi|163736126|ref|ZP_02143545.1| Endopeptidase Clp [Phaeobacter gallaeciensis BS107]
 gi|161389996|gb|EDQ14346.1| ATP-dependent Clp protease proteolytic subunit [Phaeobacter
           gallaeciensis BS107]
          Length = 202

 Score =  281 bits (720), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 124/197 (62%), Positives = 170/197 (86%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D M++LI AQLL LEAENP KEIS+
Sbjct: 4   LVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLIVAQLLHLEAENPSKEISM 63

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AGE GMRF+LPN+R+++
Sbjct: 64  YINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAGEAGMRFSLPNSRVMV 123

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGGF GQA+DI  HA++ +K+K+RLNEIYVK+ G+ Y+++   L+RD+ MS  +A D
Sbjct: 124 HQPSGGFQGQATDIMIHAEETLKLKKRLNEIYVKHTGQEYDKIVDALERDNFMSPEDAKD 183

Query: 198 WGVVDKVLMSRIDIEEK 214
           +G++D+++ +R  ++++
Sbjct: 184 FGLIDEIVENRSKLDDQ 200


>gi|149186485|ref|ZP_01864797.1| ATP-dependent Clp protease [Erythrobacter sp. SD-21]
 gi|148829712|gb|EDL48151.1| ATP-dependent Clp protease [Erythrobacter sp. SD-21]
          Length = 241

 Score =  281 bits (720), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 130/195 (66%), Positives = 165/195 (84%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP VVEQ++RGER++DI+SRLL+ERIVFVTGQ+ED MA+LI AQLLFLE+ENP K IS+
Sbjct: 29  LVPTVVEQSSRGERAFDIFSRLLRERIVFVTGQVEDTMASLIVAQLLFLESENPSKPISM 88

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVTAGMAI+DTMQ+IKP +ST C+GQAASMGS LL+AGE GMR ALPNARI++
Sbjct: 89  YINSPGGVVTAGMAIHDTMQYIKPRVSTVCIGQAASMGSFLLAAGEPGMRIALPNARIMV 148

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGG  G ASDIE  A++I++I++R+N++YV+  GK+  E+EK +DRD  + A EA  
Sbjct: 149 HQPSGGARGMASDIEIQAREILRIRKRMNDLYVQYTGKSLTEIEKAMDRDTFLEAEEAMK 208

Query: 198 WGVVDKVLMSRIDIE 212
           +G+VDKV  +R + E
Sbjct: 209 FGIVDKVFEARPENE 223


>gi|331005198|ref|ZP_08328592.1| ATP-dependent Clp protease proteolytic subunit [gamma
           proteobacterium IMCC1989]
 gi|330420980|gb|EGG95252.1| ATP-dependent Clp protease proteolytic subunit [gamma
           proteobacterium IMCC1989]
          Length = 208

 Score =  281 bits (720), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 159/193 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMVVEQT RGERSYDIYSRLLKER++F+ GQ+EDHMA L+ AQLLFLEAENP K+I 
Sbjct: 14  GLVPMVVEQTARGERSYDIYSRLLKERVIFMVGQVEDHMANLVVAQLLFLEAENPDKDIH 73

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQA SMG+ LL+AG  G RF LPNAR +
Sbjct: 74  LYINSPGGSVTAGMSIYDTMQFIKPDVSTMCIGQACSMGAFLLNAGAPGKRFCLPNARTM 133

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG  GQA+DI   A++I+KI++RLNEI  K+ G+ ++E+ +  +RD  MSA E+ 
Sbjct: 134 IHQPSGGAQGQATDISIQAEEILKIRQRLNEIMAKHSGRDFDEIARDTERDRFMSADESK 193

Query: 197 DWGVVDKVLMSRI 209
           ++G++D VL SRI
Sbjct: 194 EYGLIDDVLTSRI 206


>gi|326386907|ref|ZP_08208521.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Novosphingobium nitrogenifigens DSM 19370]
 gi|326208587|gb|EGD59390.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Novosphingobium nitrogenifigens DSM 19370]
          Length = 231

 Score =  281 bits (720), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 131/205 (63%), Positives = 169/205 (82%), Gaps = 1/205 (0%)

Query: 5   GCAKKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQL 63
           G   K + D   G L+P+VVEQ++RGERS+DIYSRLL+ERI+FVTG+IEDHMA++I AQL
Sbjct: 9   GAQGKFTTDPVTGALIPVVVEQSSRGERSFDIYSRLLRERIIFVTGEIEDHMASVIVAQL 68

Query: 64  LFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGE 123
           LFLE+ENP K+IS+YINSPGGVVTAGMAI+DTM++I+P +ST C+GQA SMGS LL+AGE
Sbjct: 69  LFLESENPSKDISMYINSPGGVVTAGMAIHDTMKYIRPRVSTVCIGQACSMGSFLLAAGE 128

Query: 124 KGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKT 183
            G+R ALPNARI++HQPSGG  G ASDIE  A++I++I+ R+N++YVK  G+  EE+E+ 
Sbjct: 129 PGLRVALPNARIMIHQPSGGARGMASDIEIQAREILRIRTRMNDLYVKYTGRQLEEIERA 188

Query: 184 LDRDHIMSASEACDWGVVDKVLMSR 208
           LDRD  + A EA  +G+VDKV  SR
Sbjct: 189 LDRDTFLEADEALAFGLVDKVFESR 213


>gi|157803694|ref|YP_001492243.1| ATP-dependent Clp protease proteolytic subunit [Rickettsia
           canadensis str. McKiel]
 gi|166214705|sp|A8EYM5|CLPP_RICCK RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|157784957|gb|ABV73458.1| ATP-dependent Clp protease proteolytic subunit [Rickettsia
           canadensis str. McKiel]
          Length = 201

 Score =  281 bits (719), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 125/193 (64%), Positives = 163/193 (84%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +  VP+V+EQT+RGER+YDIYSRLLKERI+FV   +EDHMA LI AQLLFLEAENP+K+I
Sbjct: 1   MSYVPIVIEQTSRGERAYDIYSRLLKERIIFVCSTVEDHMANLIVAQLLFLEAENPKKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGGVVTAG+AIYDTMQ+IKP ++T C+GQA SMGS LL  GEKGMR++LP++RI
Sbjct: 61  YMYINSPGGVVTAGLAIYDTMQYIKPKVATLCIGQACSMGSFLLCGGEKGMRYSLPHSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG+ GQA+DIE HAQ+ +KIKR LNE+Y K+ G+  + +EK+++RD+ MS  EA
Sbjct: 121 MIHQPSGGYQGQATDIEIHAQETLKIKRLLNELYSKHTGQDVKHIEKSMERDNFMSPEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G+VD ++ SR
Sbjct: 181 KKFGIVDNIISSR 193


>gi|56551844|ref|YP_162683.1| ATP-dependent Clp protease proteolytic subunit [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|241761834|ref|ZP_04759920.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Zymomonas
           mobilis subsp. mobilis ATCC 10988]
 gi|260752594|ref|YP_003225487.1| ATP-dependent Clp protease proteolytic subunit [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
 gi|67460187|sp|Q5NNY8|CLPP_ZYMMO RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|56543418|gb|AAV89572.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Zymomonas
           mobilis subsp. mobilis ZM4]
 gi|241373748|gb|EER63308.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Zymomonas
           mobilis subsp. mobilis ATCC 10988]
 gi|258551957|gb|ACV74903.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Zymomonas
           mobilis subsp. mobilis NCIMB 11163]
          Length = 210

 Score =  281 bits (719), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 129/206 (62%), Positives = 168/206 (81%), Gaps = 1/206 (0%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           D  D+   L+PMVVEQ+NRGERS+DIYSRLL+ERI+FVTGQ+EDHMA++ICAQLLFLEAE
Sbjct: 4   DHADIVNALIPMVVEQSNRGERSFDIYSRLLRERIIFVTGQVEDHMASVICAQLLFLEAE 63

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP+K+I LYINSPGGVVTAG+AI+DTMQ+I+P + T C+GQAASMGS LL+AGE GMR A
Sbjct: 64  NPKKDIFLYINSPGGVVTAGLAIHDTMQYIRPKVGTLCIGQAASMGSFLLAAGEPGMRVA 123

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
             N+RI++HQPSGG  G A+DIE  A++I+++++RLN +Y K   +  EE+EK +DRD+ 
Sbjct: 124 TTNSRIMIHQPSGGAQGMAADIEIQAREILRMRKRLNALYAKYTNQPIEEIEKAMDRDNF 183

Query: 190 MSASEACDWGVVDKVLMSR-IDIEEK 214
           + A EA  +G++DKV   R +  EEK
Sbjct: 184 LEADEAKAFGLIDKVFDKRPVASEEK 209


>gi|157964626|ref|YP_001499450.1| ATP-dependent Clp protease proteolytic subunit [Rickettsia
           massiliae MTU5]
 gi|157844402|gb|ABV84903.1| ATP-dependent Clp protease proteolytic subunit [Rickettsia
           massiliae MTU5]
          Length = 216

 Score =  281 bits (719), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 165/197 (83%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E + +  VP+V+E T+RGER+YDIYSRLLKERI+FV   +EDHMA LI AQLLFLEAENP
Sbjct: 12  EKILMSYVPIVIEPTSRGERAYDIYSRLLKERIIFVCSTVEDHMANLIVAQLLFLEAENP 71

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
           +K+I +YINSPGGVVTAG+AIYDTMQ+IKP ++T C+GQA SMGSLLL  GE+GMR++LP
Sbjct: 72  KKDIYIYINSPGGVVTAGLAIYDTMQYIKPKVATLCIGQACSMGSLLLCGGEQGMRYSLP 131

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           ++RI++HQPSGG+ GQA+DIE HAQ+ +KIKR LNE+Y K+ G+  + +EK+++RD+ MS
Sbjct: 132 HSRIMIHQPSGGYKGQATDIEIHAQETLKIKRLLNELYSKHTGQELKHIEKSMERDNFMS 191

Query: 192 ASEACDWGVVDKVLMSR 208
             EA  +G+VD ++ SR
Sbjct: 192 PEEAKKFGLVDNIISSR 208


>gi|229586800|ref|YP_002845301.1| ATP-dependent Clp protease proteolytic subunit [Rickettsia africae
           ESF-5]
 gi|228021850|gb|ACP53558.1| ATP-dependent Clp protease proteolytic subunit [Rickettsia africae
           ESF-5]
          Length = 216

 Score =  281 bits (719), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 126/197 (63%), Positives = 164/197 (83%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E + +  VP+V+E T+RGER+YDIYSRLLKERI+FV   +EDHMA LI AQLLFLEAENP
Sbjct: 12  EKILMSYVPIVIEPTSRGERAYDIYSRLLKERIIFVCSTVEDHMANLIVAQLLFLEAENP 71

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
           +K+I +YINSPGGVVTAG+AIYDTMQ+IKP ++T C+GQA SMGSLLL  GEKGMR++LP
Sbjct: 72  KKDIYMYINSPGGVVTAGLAIYDTMQYIKPKVATLCIGQACSMGSLLLCGGEKGMRYSLP 131

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           ++RI++HQPSGG+ GQA+DIE HAQ+ +KIKR LNE+Y K+  +  + +EK+++RD+ MS
Sbjct: 132 HSRIMIHQPSGGYKGQATDIEIHAQETLKIKRLLNELYSKHTEQELKHIEKSMERDNFMS 191

Query: 192 ASEACDWGVVDKVLMSR 208
             EA  +G+VD +L SR
Sbjct: 192 PEEAKKFGLVDNILSSR 208


>gi|85707624|ref|ZP_01038690.1| ATP-dependent Clp protease [Erythrobacter sp. NAP1]
 gi|85689158|gb|EAQ29161.1| ATP-dependent Clp protease [Erythrobacter sp. NAP1]
          Length = 235

 Score =  281 bits (718), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 129/191 (67%), Positives = 163/191 (85%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP VVEQ++RGER++DI+SRLL+ERIVFVTGQ+ED MA+LI AQLLFLE+ENP K IS+
Sbjct: 27  LVPTVVEQSSRGERAFDIFSRLLRERIVFVTGQVEDTMASLIVAQLLFLESENPSKPISM 86

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVTAGMAI+DTMQ+IKP +ST C+GQAASMGS LL+AGE GMR ALPNARI++
Sbjct: 87  YINSPGGVVTAGMAIHDTMQYIKPRVSTVCIGQAASMGSFLLAAGEPGMRVALPNARIMV 146

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGG  G ASDIE  A++I++I+ R+N++YVK  G++ +E+EK +DRD  + A EA  
Sbjct: 147 HQPSGGARGMASDIEIQAREILRIRSRMNDLYVKYTGQSLDEIEKAMDRDTFLEAEEAMK 206

Query: 198 WGVVDKVLMSR 208
           +G+VDKV  +R
Sbjct: 207 FGLVDKVFETR 217


>gi|89073230|ref|ZP_01159760.1| ATP-dependent Clp protease proteolytic subunit [Photobacterium sp.
           SKA34]
 gi|90579278|ref|ZP_01235088.1| ATP-dependent Clp protease proteolytic subunit [Vibrio angustum
           S14]
 gi|89050940|gb|EAR56404.1| ATP-dependent Clp protease proteolytic subunit [Photobacterium sp.
           SKA34]
 gi|90440111|gb|EAS65292.1| ATP-dependent Clp protease proteolytic subunit [Vibrio angustum
           S14]
          Length = 207

 Score =  281 bits (718), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 128/192 (66%), Positives = 159/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 15  ALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDKDIF 74

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G KG R+ LPN+R++
Sbjct: 75  LYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAKGKRYCLPNSRVM 134

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI+ HAQ+I+ IK+RLN +  ++ G+  E VE+  DRD+ MSA +A 
Sbjct: 135 IHQPLGGFQGQASDIQIHAQEILTIKQRLNGLLAEHTGQPLEVVERDTDRDNFMSAEQAV 194

Query: 197 DWGVVDKVLMSR 208
           ++G+VD VL  R
Sbjct: 195 EYGLVDAVLSQR 206


>gi|254460423|ref|ZP_05073839.1| Clp protease [Rhodobacterales bacterium HTCC2083]
 gi|206677012|gb|EDZ41499.1| Clp protease [Rhodobacteraceae bacterium HTCC2083]
          Length = 210

 Score =  281 bits (718), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 169/201 (84%), Gaps = 1/201 (0%)

Query: 9   KDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            D  D ++  LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D M++LI AQLL LE
Sbjct: 2   NDPIDTYMNTLVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLIVAQLLHLE 61

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP KEIS+YINSPGGVVT+G++IYDTMQ+I+P +ST  +GQAASMGSLLL+AGEK MR
Sbjct: 62  AENPSKEISMYINSPGGVVTSGLSIYDTMQYIRPKVSTLVIGQAASMGSLLLTAGEKDMR 121

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPN+R+++HQPSGG+ GQA+DI  HAQ+  K+K RLNEIYV++ G+T ++VE  L+RD
Sbjct: 122 FSLPNSRVMVHQPSGGYQGQATDIMIHAQETQKLKTRLNEIYVQHTGQTLKKVEAALERD 181

Query: 188 HIMSASEACDWGVVDKVLMSR 208
           + MS  EA ++G++D++L +R
Sbjct: 182 NFMSPEEAKEFGLIDEILQTR 202


>gi|118594831|ref|ZP_01552178.1| Peptidase S14, ClpP [Methylophilales bacterium HTCC2181]
 gi|118440609|gb|EAV47236.1| Peptidase S14, ClpP [Methylophilales bacterium HTCC2181]
          Length = 209

 Score =  281 bits (718), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 164/197 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG +PMVVEQ+ RGERSYDIYSRLLKER+VF+ G ++D  A ++ AQLLFLEAENP K+I
Sbjct: 13  LGYIPMVVEQSGRGERSYDIYSRLLKERVVFLVGPVDDMTANVVVAQLLFLEAENPDKDI 72

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG VTAGMAIYDTMQFIKP IST C+GQAASMG+LLL+AG    RF+LPN+R+
Sbjct: 73  SLYINSPGGSVTAGMAIYDTMQFIKPDISTLCIGQAASMGALLLTAGAAKKRFSLPNSRV 132

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDIE HA++I+ +K +LN+I  ++ G++ E+V K  DRD+ MSA +A
Sbjct: 133 MIHQPLGGFQGQASDIEIHAKEILYLKEKLNKIMAEHSGQSLEKVSKDTDRDNFMSAKDA 192

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G++DKV+ SR D++
Sbjct: 193 MEYGLIDKVISSRSDVK 209


>gi|56478265|ref|YP_159854.1| ATP-dependent Clp protease proteolytic subunit [Aromatoleum
           aromaticum EbN1]
 gi|67460188|sp|Q5P161|CLPP_AZOSE RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|56314308|emb|CAI08953.1| ATP-dependent Clp protease proteolytic subunit [Aromatoleum
           aromaticum EbN1]
          Length = 212

 Score =  281 bits (718), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 163/199 (81%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           + V LGLVPMVVEQ+ RGER+YDIYSRLLKER++F+ G + D  A LI AQLLFLE+ENP
Sbjct: 13  DPVGLGLVPMVVEQSGRGERAYDIYSRLLKERVIFLVGPVNDVTANLIVAQLLFLESENP 72

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            K++  YINSPGG V++GMAIYDTMQFIKP +ST C+GQAASMGS LL+AGEKG RF LP
Sbjct: 73  DKDVYFYINSPGGSVSSGMAIYDTMQFIKPSVSTLCIGQAASMGSFLLAAGEKGKRFCLP 132

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+R+++HQP GGF GQASDIE HA++I+ I+ +LNE+  K+ G+  E++EK  DRD  MS
Sbjct: 133 NSRVMIHQPLGGFQGQASDIEIHAREILGIRAKLNEMLAKHTGQPIEQIEKDTDRDRFMS 192

Query: 192 ASEACDWGVVDKVLMSRID 210
           A++A ++G+VDKVL +R D
Sbjct: 193 AADAVEYGIVDKVLTNRAD 211


>gi|254476195|ref|ZP_05089581.1| Clp protease [Ruegeria sp. R11]
 gi|214030438|gb|EEB71273.1| Clp protease [Ruegeria sp. R11]
          Length = 202

 Score =  280 bits (717), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 124/191 (64%), Positives = 165/191 (86%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D M++LI AQLL LEAENP KEIS+
Sbjct: 4   LVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLIVAQLLHLEAENPSKEISM 63

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AGE GMRF+LPN+R+++
Sbjct: 64  YINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAGEPGMRFSLPNSRVMV 123

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGGF GQA+DI  HA++ +K+K+RLNEIYVK+ G+ Y+ +   L+RD+ MS  EA +
Sbjct: 124 HQPSGGFQGQATDIMIHAEETLKLKKRLNEIYVKHTGQDYDSIVNALERDNFMSPEEAKE 183

Query: 198 WGVVDKVLMSR 208
           +G++D+++ +R
Sbjct: 184 FGLIDEIVENR 194


>gi|241116836|ref|XP_002401631.1| ATP-dependent Clp protease, proteolytic subunit, putative [Ixodes
           scapularis]
 gi|215493175|gb|EEC02816.1| ATP-dependent Clp protease, proteolytic subunit, putative [Ixodes
           scapularis]
          Length = 205

 Score =  280 bits (717), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 164/197 (83%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E + +  VP+V+EQT+RGER+YDIYSRLLKERI+FV   +EDHM  LI AQLLFLEAENP
Sbjct: 1   EKILMSYVPIVIEQTSRGERAYDIYSRLLKERIIFVCSTVEDHMTNLIVAQLLFLEAENP 60

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
           +K+I +YINSPGGV+TAG+AIYDTMQ+IKP ++T C+GQA SMGSLLL  GEKGMR++LP
Sbjct: 61  KKDIYMYINSPGGVITAGLAIYDTMQYIKPKVATLCIGQACSMGSLLLCGGEKGMRYSLP 120

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           ++RI++HQPSGG+ GQA+DIE HAQ+ +KIKR LNE+Y K+  +  + +EK+++RD+ MS
Sbjct: 121 HSRIMIHQPSGGYKGQATDIEIHAQETLKIKRLLNELYSKHTRQELKHIEKSMERDNFMS 180

Query: 192 ASEACDWGVVDKVLMSR 208
             EA  +G++D ++ SR
Sbjct: 181 PEEAKKFGIIDNIISSR 197


>gi|90410782|ref|ZP_01218797.1| ATP-dependent Clp protease proteolytic subunit [Photobacterium
           profundum 3TCK]
 gi|90328413|gb|EAS44711.1| ATP-dependent Clp protease proteolytic subunit [Photobacterium
           profundum 3TCK]
          Length = 207

 Score =  280 bits (717), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 128/192 (66%), Positives = 158/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 15  ALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDKDIF 74

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G KG R+ LPN+R++
Sbjct: 75  LYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAKGKRYCLPNSRVM 134

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI+ HAQ+I+ IK+RLN +  ++ G+  E VE   DRD+ MSA +A 
Sbjct: 135 IHQPLGGFQGQASDIQIHAQEILTIKQRLNNLLAEHTGQPLEIVEGDTDRDNFMSADQAV 194

Query: 197 DWGVVDKVLMSR 208
           ++G+VD VL  R
Sbjct: 195 EYGLVDSVLTQR 206


>gi|332172903|gb|AEE22157.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Glaciecola
           agarilytica 4H-3-7+YE-5]
          Length = 212

 Score =  280 bits (717), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 126/194 (64%), Positives = 159/194 (81%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT +GERSYDIYSRLLKE ++F+ GQ+EDHMA LI AQ+LFLEAENP+K+I 
Sbjct: 11  ALVPMVVEQTAKGERSYDIYSRLLKENVIFMVGQVEDHMANLIVAQMLFLEAENPEKDIF 70

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGMAIYDTM FIKP +ST C+GQAASMG+ LLS G KG R+ LPNAR++
Sbjct: 71  LYINSPGGSVTAGMAIYDTMNFIKPDVSTVCIGQAASMGAFLLSGGTKGKRYCLPNARVM 130

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASD E HA++I+ IK ++N +  ++ G+ YE+V +  DRD+ +SA E+ 
Sbjct: 131 IHQPLGGFQGQASDFEIHAKEILSIKEKMNRLMAEHTGQDYEKVARDTDRDNFLSAQESV 190

Query: 197 DWGVVDKVLMSRID 210
           D+G+VD+VL +R D
Sbjct: 191 DYGLVDQVLANRPD 204


>gi|60389653|sp|Q6LNW0|CLPP_PHOPR RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
          Length = 199

 Score =  280 bits (717), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 128/192 (66%), Positives = 157/192 (81%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 7   ALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDKDIF 66

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G KG R+ LPN+R++
Sbjct: 67  LYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAKGKRYCLPNSRVM 126

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI+ HA++I+ IK RLN +  K+ G+  E VE   DRD+ MSA +A 
Sbjct: 127 IHQPLGGFQGQASDIQIHAKEILTIKHRLNSLLAKHTGQPLEVVEGDTDRDNFMSADQAV 186

Query: 197 DWGVVDKVLMSR 208
           ++G+VD VL  R
Sbjct: 187 EYGLVDSVLTQR 198


>gi|54309798|ref|YP_130818.1| ATP-dependent Clp protease proteolytic subunit [Photobacterium
           profundum SS9]
 gi|46914236|emb|CAG21016.1| putative gi|27363512|ref|NP_759040.1| ATP-dependent Clp protease,
           proteolytic subunit [Vibrio vulnificus CMCP6]
           [Photobacterium profundum SS9]
          Length = 207

 Score =  280 bits (716), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 128/192 (66%), Positives = 157/192 (81%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 15  ALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDKDIF 74

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G KG R+ LPN+R++
Sbjct: 75  LYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAKGKRYCLPNSRVM 134

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI+ HA++I+ IK RLN +  K+ G+  E VE   DRD+ MSA +A 
Sbjct: 135 IHQPLGGFQGQASDIQIHAKEILTIKHRLNSLLAKHTGQPLEVVEGDTDRDNFMSADQAV 194

Query: 197 DWGVVDKVLMSR 208
           ++G+VD VL  R
Sbjct: 195 EYGLVDSVLTQR 206


>gi|15892669|ref|NP_360383.1| ATP-dependent Clp protease proteolytic subunit [Rickettsia conorii
           str. Malish 7]
 gi|15619841|gb|AAL03284.1| ATP-dependent clp protease proteolytic subunit [Rickettsia conorii
           str. Malish 7]
          Length = 216

 Score =  280 bits (716), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 164/197 (83%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E + +  VP+V+E T+RGER+YDIYSRLLKERI+FV   +EDHMA LI AQLLFLEAENP
Sbjct: 12  EKILMSYVPIVIEPTSRGERAYDIYSRLLKERIIFVCSTVEDHMANLIVAQLLFLEAENP 71

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
           +K+I +YINSPGGVVTAG+AIYDTMQ+IKP ++T C+GQA SMGSLLL  GEKGMR++LP
Sbjct: 72  KKDIYMYINSPGGVVTAGLAIYDTMQYIKPKVATLCIGQACSMGSLLLCGGEKGMRYSLP 131

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           ++RI++HQPSGG+ GQA+DIE HAQ+ +KIKR LNE+Y K+  +  + +EK+++RD+ MS
Sbjct: 132 HSRIMIHQPSGGYKGQATDIEIHAQETLKIKRLLNELYSKHTEQELKHIEKSMERDNFMS 191

Query: 192 ASEACDWGVVDKVLMSR 208
             EA  +G+VD ++ SR
Sbjct: 192 PEEAKKFGLVDNIMSSR 208


>gi|165933331|ref|YP_001650120.1| ATP-dependent Clp protease proteolytic subunit [Rickettsia
           rickettsii str. Iowa]
 gi|165908418|gb|ABY72714.1| ATP-dependent endopeptidase clp proteolytic subunit [Rickettsia
           rickettsii str. Iowa]
          Length = 216

 Score =  280 bits (716), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 164/197 (83%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E + +  VP+V+E T+RGER+YDIYSRLLKERI+FV   +EDHMA LI AQLLFLEAENP
Sbjct: 12  EKILMSYVPIVIEPTSRGERAYDIYSRLLKERIIFVCSTVEDHMANLIVAQLLFLEAENP 71

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
           +K+I +YINSPGGVVTAG+AIYDTMQ+IKP ++T C+GQA SMGSLLL  GEKGMR++LP
Sbjct: 72  KKDIYMYINSPGGVVTAGLAIYDTMQYIKPKVATLCIGQACSMGSLLLCGGEKGMRYSLP 131

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           ++RI++HQPSGG+ GQA+DIE HAQ+ +KIKR LNE+Y K+  +  + +EK+++RD+ MS
Sbjct: 132 HSRIMIHQPSGGYKGQATDIEIHAQETLKIKRLLNELYSKHTEQELQHIEKSMERDNFMS 191

Query: 192 ASEACDWGVVDKVLMSR 208
             EA  +G+VD ++ SR
Sbjct: 192 PEEAKKFGLVDNIISSR 208


>gi|269102129|ref|ZP_06154826.1| ATP-dependent Clp protease proteolytic subunit [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268162027|gb|EEZ40523.1| ATP-dependent Clp protease proteolytic subunit [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 207

 Score =  280 bits (716), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 126/192 (65%), Positives = 159/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 15  ALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDKDIY 74

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G KG R+ LPN+R++
Sbjct: 75  LYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAKGKRYCLPNSRVM 134

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI+ HAQ+I+ IK++LN +  ++ G+  E +E+  DRD+ MSA +A 
Sbjct: 135 IHQPLGGFQGQASDIQIHAQEILTIKQKLNNLLAEHTGQPLEVIERDTDRDNFMSADQAV 194

Query: 197 DWGVVDKVLMSR 208
           ++G+VD VL  R
Sbjct: 195 EYGLVDAVLSHR 206


>gi|110680063|ref|YP_683070.1| ATP-dependent Clp protease proteolytic subunit [Roseobacter
           denitrificans OCh 114]
 gi|116243162|sp|Q165F9|CLPP_ROSDO RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|109456179|gb|ABG32384.1| Clp protease, putative [Roseobacter denitrificans OCh 114]
          Length = 208

 Score =  280 bits (716), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 168/200 (84%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           KD  + ++ LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D M++LI AQLL LEA
Sbjct: 2   KDPIETYMNLVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLIVAQLLHLEA 61

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP KEIS+YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AGE GMRF
Sbjct: 62  ENPAKEISMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAGEAGMRF 121

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           +LPN+R+++HQPSGG+ GQA+DI  HA +  K+K RLNEIYVK+ G+T ++V   L+RD+
Sbjct: 122 SLPNSRVMVHQPSGGYQGQATDIMIHAAETQKLKDRLNEIYVKHTGQTMKKVVDALERDN 181

Query: 189 IMSASEACDWGVVDKVLMSR 208
            MS  EA ++G++D+++ +R
Sbjct: 182 FMSPEEAKEFGLIDEIVENR 201


>gi|330446593|ref|ZP_08310245.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328490784|dbj|GAA04742.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 207

 Score =  280 bits (715), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 159/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 15  ALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDKDIF 74

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G KG R+ LPN+R++
Sbjct: 75  LYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAKGKRYCLPNSRVM 134

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI+ HAQ+I+ IK+RLN +  ++ G+  E +E+  DRD+ MSA +A 
Sbjct: 135 IHQPLGGFQGQASDIQIHAQEILTIKQRLNGLLAEHTGQPLEIIERDTDRDNFMSADQAV 194

Query: 197 DWGVVDKVLMSR 208
           ++G+VD VL  R
Sbjct: 195 EYGLVDAVLSKR 206


>gi|116243161|sp|Q1RJH2|CLPP_RICBR RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
          Length = 227

 Score =  280 bits (715), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 164/197 (83%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E   +  VP+V+EQT+RGER+YDIYSRLLKERI+FV G IEDHMA LI AQLLFLEAENP
Sbjct: 19  EKYPMSYVPIVIEQTSRGERAYDIYSRLLKERIIFVCGPIEDHMANLITAQLLFLEAENP 78

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
           +K+I +YINSPGGVVTAG+AIYDTMQ+IKP ++T C+GQA SMGS LL  GEKGMR++LP
Sbjct: 79  EKDIYMYINSPGGVVTAGLAIYDTMQYIKPKVATLCIGQACSMGSFLLCGGEKGMRYSLP 138

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           ++R+++HQPSGG+ GQA+DIE HAQ+ +KIK+ LN +Y K+ G+  + VEK+++RD+ MS
Sbjct: 139 HSRVMIHQPSGGYRGQATDIEIHAQETLKIKKILNSLYSKHTGQDVKHVEKSMERDNFMS 198

Query: 192 ASEACDWGVVDKVLMSR 208
             EA  +G++DK++  R
Sbjct: 199 PEEAKKFGIIDKIITHR 215


>gi|261210563|ref|ZP_05924856.1| ATP-dependent Clp protease proteolytic subunit [Vibrio sp. RC341]
 gi|262404275|ref|ZP_06080830.1| ATP-dependent Clp protease proteolytic subunit [Vibrio sp. RC586]
 gi|260840348|gb|EEX66919.1| ATP-dependent Clp protease proteolytic subunit [Vibrio sp. RC341]
 gi|262349307|gb|EEY98445.1| ATP-dependent Clp protease proteolytic subunit [Vibrio sp. RC586]
          Length = 208

 Score =  280 bits (715), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 126/195 (64%), Positives = 159/195 (81%)

Query: 14  VFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQK 73
           +F  LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP K
Sbjct: 12  IFDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDK 71

Query: 74  EISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNA 133
           +I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G  G R+ LPN+
Sbjct: 72  DIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAPGKRYVLPNS 131

Query: 134 RILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSAS 193
           R+++HQP GGF GQASDI+ HAQ+I+ IK +LN +  ++ G+  E +E+  DRD+ MSA 
Sbjct: 132 RVMIHQPLGGFQGQASDIQIHAQEILTIKNKLNRLLAEHTGQPLEVIERDTDRDNFMSAD 191

Query: 194 EACDWGVVDKVLMSR 208
           +A ++G+VD VL  R
Sbjct: 192 QAVEYGLVDAVLKHR 206


>gi|71083579|ref|YP_266298.1| ATP-dependent Clp protease proteolytic subunit [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|91762000|ref|ZP_01263965.1| ATP-dependent Clp protease proteolytic subunit [Candidatus
           Pelagibacter ubique HTCC1002]
 gi|115311789|sp|Q4FM94|CLPP_PELUB RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|71062692|gb|AAZ21695.1| ATP-dependent Clp protease proteolytic subunit [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|91717802|gb|EAS84452.1| ATP-dependent Clp protease proteolytic subunit [Candidatus
           Pelagibacter ubique HTCC1002]
          Length = 203

 Score =  279 bits (714), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 122/191 (63%), Positives = 167/191 (87%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQ+N+GER+YDIYSRLLKERI+F+ G I D++A+L+ AQLLFLE+E+P+KEI+L
Sbjct: 12  LVPMVVEQSNKGERAYDIYSRLLKERIIFLVGPINDNVASLVTAQLLFLESEDPKKEINL 71

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG+VTAG+ IYDTMQ+IKP +ST C+GQAASMGS LL+AG+KG RF+LPN+RI++
Sbjct: 72  YINSPGGLVTAGLGIYDTMQYIKPDVSTLCIGQAASMGSFLLAAGKKGKRFSLPNSRIMV 131

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPS GF GQA+DIE HA +++ +K+RLNEIY K+ GK+ ++V+K L+RD+ M+   A +
Sbjct: 132 HQPSAGFQGQATDIEIHANEVLALKKRLNEIYSKHTGKSVDDVKKALERDNFMTPDTAKE 191

Query: 198 WGVVDKVLMSR 208
           +G++D+V+ +R
Sbjct: 192 FGLIDEVVENR 202


>gi|91205226|ref|YP_537581.1| ATP-dependent Clp protease proteolytic subunit [Rickettsia bellii
           RML369-C]
 gi|157827437|ref|YP_001496501.1| ATP-dependent Clp protease proteolytic subunit [Rickettsia bellii
           OSU 85-389]
 gi|91068770|gb|ABE04492.1| ATP-dependent Clp protease proteolytic subunit [Rickettsia bellii
           RML369-C]
 gi|157802741|gb|ABV79464.1| ATP-dependent Clp protease proteolytic subunit [Rickettsia bellii
           OSU 85-389]
          Length = 264

 Score =  279 bits (714), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 163/193 (84%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +  VP+V+EQT+RGER+YDIYSRLLKERI+FV G IEDHMA LI AQLLFLEAENP+K+I
Sbjct: 60  MSYVPIVIEQTSRGERAYDIYSRLLKERIIFVCGPIEDHMANLITAQLLFLEAENPEKDI 119

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGGVVTAG+AIYDTMQ+IKP ++T C+GQA SMGS LL  GEKGMR++LP++R+
Sbjct: 120 YMYINSPGGVVTAGLAIYDTMQYIKPKVATLCIGQACSMGSFLLCGGEKGMRYSLPHSRV 179

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG+ GQA+DIE HAQ+ +KIK+ LN +Y K+ G+  + VEK+++RD+ MS  EA
Sbjct: 180 MIHQPSGGYRGQATDIEIHAQETLKIKKILNSLYSKHTGQDVKHVEKSMERDNFMSPEEA 239

Query: 196 CDWGVVDKVLMSR 208
             +G++DK++  R
Sbjct: 240 KKFGIIDKIITHR 252


>gi|153839648|ref|ZP_01992315.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           parahaemolyticus AQ3810]
 gi|260902813|ref|ZP_05911208.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           parahaemolyticus AQ4037]
 gi|149746838|gb|EDM57826.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           parahaemolyticus AQ3810]
 gi|308108649|gb|EFO46189.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           parahaemolyticus AQ4037]
 gi|328473326|gb|EGF44174.1| ATP-dependent Clp protease proteolytic subunit [Vibrio
           parahaemolyticus 10329]
          Length = 208

 Score =  279 bits (714), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 158/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 15  ALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDKDIF 74

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G  G R+ LPN+R++
Sbjct: 75  LYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAAGKRYVLPNSRVM 134

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI+ HAQ+I+ IK++LN +  ++ G+  E +E+  DRD+ MSA +A 
Sbjct: 135 IHQPLGGFQGQASDIQIHAQEILTIKQKLNNLLAEHTGQPLEVIERDTDRDNFMSAEQAV 194

Query: 197 DWGVVDKVLMSR 208
           ++G+VD VL  R
Sbjct: 195 EYGIVDAVLSHR 206


>gi|86137328|ref|ZP_01055905.1| Protease subunit of ATP-dependent Clp protease [Roseobacter sp.
           MED193]
 gi|85825663|gb|EAQ45861.1| Protease subunit of ATP-dependent Clp protease [Roseobacter sp.
           MED193]
          Length = 202

 Score =  279 bits (714), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 164/191 (85%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D M++LI AQLL LEAENP KEIS+
Sbjct: 4   LVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLIVAQLLHLEAENPSKEISM 63

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AGE GMRF+LPN+R+++
Sbjct: 64  YINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAGEAGMRFSLPNSRVMV 123

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGGF GQA+DI  HA++ +K+KRRLNEIYVK+ G+  ++VE  L+RD+ M   EA  
Sbjct: 124 HQPSGGFQGQATDIMIHAEETLKLKRRLNEIYVKHTGQELDKVEAALERDNFMDPEEAKA 183

Query: 198 WGVVDKVLMSR 208
           +G++D+++ +R
Sbjct: 184 FGLIDEIVENR 194


>gi|121727845|ref|ZP_01680912.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           cholerae V52]
 gi|229507982|ref|ZP_04397487.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae BX
           330286]
 gi|229511781|ref|ZP_04401260.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae
           B33]
 gi|229515308|ref|ZP_04404768.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae TMA
           21]
 gi|229518918|ref|ZP_04408361.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae
           RC9]
 gi|229523942|ref|ZP_04413347.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae bv.
           albensis VL426]
 gi|229529052|ref|ZP_04418442.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae
           12129(1)]
 gi|229607528|ref|YP_002878176.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae
           MJ-1236]
 gi|254849010|ref|ZP_05238360.1| ATP-dependent Clp protease [Vibrio cholerae MO10]
 gi|255745319|ref|ZP_05419268.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholera CIRS
           101]
 gi|262156043|ref|ZP_06029163.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae
           INDRE 91/1]
 gi|262167884|ref|ZP_06035584.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae
           RC27]
 gi|297579440|ref|ZP_06941368.1| ATP-dependent Clp protease [Vibrio cholerae RC385]
 gi|298498040|ref|ZP_07007847.1| clp protease [Vibrio cholerae MAK 757]
 gi|121629881|gb|EAX62295.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           cholerae V52]
 gi|229332826|gb|EEN98312.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae
           12129(1)]
 gi|229337523|gb|EEO02540.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae bv.
           albensis VL426]
 gi|229343607|gb|EEO08582.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae
           RC9]
 gi|229348013|gb|EEO12972.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae TMA
           21]
 gi|229351746|gb|EEO16687.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae
           B33]
 gi|229355487|gb|EEO20408.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae BX
           330286]
 gi|229370183|gb|ACQ60606.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae
           MJ-1236]
 gi|254844715|gb|EET23129.1| ATP-dependent Clp protease [Vibrio cholerae MO10]
 gi|255737149|gb|EET92545.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholera CIRS
           101]
 gi|262023611|gb|EEY42312.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae
           RC27]
 gi|262030221|gb|EEY48865.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae
           INDRE 91/1]
 gi|297537034|gb|EFH75867.1| ATP-dependent Clp protease [Vibrio cholerae RC385]
 gi|297542373|gb|EFH78423.1| clp protease [Vibrio cholerae MAK 757]
 gi|327484465|gb|AEA78872.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae
           LMA3894-4]
          Length = 208

 Score =  279 bits (714), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 126/195 (64%), Positives = 159/195 (81%)

Query: 14  VFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQK 73
           +F  LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP K
Sbjct: 12  IFDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDK 71

Query: 74  EISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNA 133
           +I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G  G R+ LPN+
Sbjct: 72  DIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAPGKRYVLPNS 131

Query: 134 RILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSAS 193
           R+++HQP GGF GQASDI+ HAQ+I+ IK +LN +  ++ G+  E +E+  DRD+ MSA 
Sbjct: 132 RVMIHQPLGGFQGQASDIQIHAQEILTIKNKLNRLLAEHTGQPIEVIERDTDRDNFMSAD 191

Query: 194 EACDWGVVDKVLMSR 208
           +A ++G+VD VL  R
Sbjct: 192 QAVEYGLVDAVLKHR 206


>gi|320540337|ref|ZP_08039989.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Serratia symbiotica str. Tucson]
 gi|320029657|gb|EFW11684.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Serratia symbiotica str. Tucson]
          Length = 207

 Score =  279 bits (713), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 128/208 (61%), Positives = 169/208 (81%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D     + LVPMVVEQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDQCAPNMALVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAE+P+K+I LYINSPGGV+TAGM+IYDTM+FIKP +ST CMGQA SMGS LL+
Sbjct: 59  AQMLFLEAESPEKDIFLYINSPGGVITAGMSIYDTMKFIKPDVSTICMGQACSMGSFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG K  RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+  ++ G++  ++
Sbjct: 119 AGAKSKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKARMNELMAEHTGQSLAQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E   +RD  M+A EA ++G+VD +L  R
Sbjct: 179 ECDTERDRFMTADEAVEYGLVDGILTHR 206


>gi|109899441|ref|YP_662696.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Pseudoalteromonas atlantica T6c]
 gi|123064308|sp|Q15R46|CLPP_PSEA6 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|109701722|gb|ABG41642.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Pseudoalteromonas atlantica T6c]
          Length = 212

 Score =  279 bits (713), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 158/194 (81%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT +GERSYDIYSRLLKE ++F+ GQ+EDHMA LI AQ+LFLEAENP+K+I 
Sbjct: 11  ALVPMVVEQTAKGERSYDIYSRLLKENVIFMVGQVEDHMANLIVAQMLFLEAENPEKDIF 70

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGMAIYDTM FIKP +ST C+GQAASMG+ LLS G KG R+ LPNAR++
Sbjct: 71  LYINSPGGSVTAGMAIYDTMNFIKPDVSTVCIGQAASMGAFLLSGGAKGKRYCLPNARVM 130

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASD E HA++I+ IK ++N +   + G+ Y++V +  DRD+ +SA E+ 
Sbjct: 131 IHQPLGGFQGQASDFEIHAKEILSIKEKMNRLMAAHTGQDYDKVARDTDRDNFLSAQESV 190

Query: 197 DWGVVDKVLMSRID 210
           D+G+VD+VL +R D
Sbjct: 191 DYGLVDQVLANRPD 204


>gi|28897691|ref|NP_797296.1| ATP-dependent Clp protease proteolytic subunit [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|260898290|ref|ZP_05906786.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           parahaemolyticus Peru-466]
 gi|308094762|ref|ZP_05891792.2| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           parahaemolyticus AN-5034]
 gi|31340006|sp|Q87R80|CLPP_VIBPA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|28805904|dbj|BAC59180.1| ATP-dependent Clp protease, proteolytic subunit [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|308088425|gb|EFO38120.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           parahaemolyticus Peru-466]
 gi|308093191|gb|EFO42886.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           parahaemolyticus AN-5034]
          Length = 200

 Score =  279 bits (713), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 158/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 7   ALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDKDIF 66

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G  G R+ LPN+R++
Sbjct: 67  LYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAAGKRYVLPNSRVM 126

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI+ HAQ+I+ IK++LN +  ++ G+  E +E+  DRD+ MSA +A 
Sbjct: 127 IHQPLGGFQGQASDIQIHAQEILTIKQKLNNLLAEHTGQPLEVIERDTDRDNFMSAEQAV 186

Query: 197 DWGVVDKVLMSR 208
           ++G+VD VL  R
Sbjct: 187 EYGIVDAVLSHR 198


>gi|262276278|ref|ZP_06054087.1| ATP-dependent Clp protease proteolytic subunit [Grimontia hollisae
           CIP 101886]
 gi|262220086|gb|EEY71402.1| ATP-dependent Clp protease proteolytic subunit [Grimontia hollisae
           CIP 101886]
          Length = 207

 Score =  278 bits (712), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 164/208 (78%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MSF+   K     +   LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ 
Sbjct: 1   MSFQ--EKNGMPSIMDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+I LYINSPGG VTAGM+IYDTMQ+IKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQLLFLESENPDKDIFLYINSPGGSVTAGMSIYDTMQYIKPDVSTVCMGQACSMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
            G KG R+ LPN+R+++HQP GGF GQASDI+ HAQ+I+ IK RLN +  ++ G+  E +
Sbjct: 119 GGAKGKRYCLPNSRVMIHQPLGGFQGQASDIQIHAQEILTIKHRLNTLLAEHTGQPLEVI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  DRD+ M+A +A ++G+VD VL  R
Sbjct: 179 ERDTDRDNFMAAQDAVNYGLVDAVLNKR 206


>gi|260432980|ref|ZP_05786951.1| Clp protease [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416808|gb|EEX10067.1| Clp protease [Silicibacter lacuscaerulensis ITI-1157]
          Length = 210

 Score =  278 bits (712), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 132/204 (64%), Positives = 165/204 (80%), Gaps = 1/204 (0%)

Query: 10  DSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           D  D ++  LVPMVVEQT+RGER+YDI+SRLLKERIVF+ G I D M+ LI AQLL LEA
Sbjct: 3   DPVDTYMNTLVPMVVEQTSRGERAYDIFSRLLKERIVFINGPIHDGMSHLIVAQLLHLEA 62

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEIS+YINSPGGVVT+G+AIYDTMQ+IKP  ST  +GQAASMGS+LL+ GEKGMRF
Sbjct: 63  ENPKKEISIYINSPGGVVTSGLAIYDTMQYIKPKCSTLVIGQAASMGSVLLAGGEKGMRF 122

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           ALPN+RI++HQPSGG+ GQASDI  HA +  K+K RL +IY K+ G++ + +EK LDRD+
Sbjct: 123 ALPNSRIMVHQPSGGYQGQASDIMIHAAETQKLKDRLYDIYAKHTGQSKKTIEKALDRDN 182

Query: 189 IMSASEACDWGVVDKVLMSRIDIE 212
            MS  EA +WG +D+++ SR   E
Sbjct: 183 FMSPEEAKEWGHIDEIVESRTKAE 206


>gi|242279532|ref|YP_002991661.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Desulfovibrio
           salexigens DSM 2638]
 gi|242122426|gb|ACS80122.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Desulfovibrio
           salexigens DSM 2638]
          Length = 202

 Score =  278 bits (712), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 167/198 (84%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           G +P+VVE T R ER+YDIYSRLLK+RI+ ++G++ DH+A++ICAQLLFLE+E+P+KEI 
Sbjct: 3   GTIPIVVETTGRTERAYDIYSRLLKDRIILLSGEVNDHVASVICAQLLFLESEDPEKEIY 62

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           +YINSPGGVVTAGMAIYDTMQ+I  P++T CMGQAASMG+ LLSAGEKG R++LP++RIL
Sbjct: 63  MYINSPGGVVTAGMAIYDTMQYISAPVATLCMGQAASMGAFLLSAGEKGQRYSLPHSRIL 122

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG  GQA+DI+  A++I+++++ LN I  +N G+T EE+EK  DRD+ MSA EA 
Sbjct: 123 IHQPLGGAQGQATDIDIQAREILRLRKSLNSIMAENTGRTVEEIEKDTDRDNFMSAQEAV 182

Query: 197 DWGVVDKVLMSRIDIEEK 214
           ++G++DKVL +R +IE K
Sbjct: 183 EYGLIDKVLENRGNIESK 200


>gi|15641924|ref|NP_231556.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|147674197|ref|YP_001217455.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae
           O395]
 gi|153824129|ref|ZP_01976796.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           cholerae B33]
 gi|153826398|ref|ZP_01979065.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           cholerae MZO-2]
 gi|227082052|ref|YP_002810603.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           cholerae M66-2]
 gi|254286858|ref|ZP_04961810.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           cholerae AM-19226]
 gi|18203199|sp|Q9KQS6|CLPP_VIBCH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|172047646|sp|A5F6X0|CLPP_VIBC3 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|254763808|sp|C3LNM6|CLPP_VIBCM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|9656458|gb|AAF95070.1| ATP-dependent Clp protease, proteolytic subunit [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|126518348|gb|EAZ75571.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           cholerae B33]
 gi|146316080|gb|ABQ20619.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           cholerae O395]
 gi|149739876|gb|EDM54067.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           cholerae MZO-2]
 gi|150423008|gb|EDN14957.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           cholerae AM-19226]
 gi|227009940|gb|ACP06152.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           cholerae M66-2]
 gi|227013820|gb|ACP10030.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           cholerae O395]
          Length = 200

 Score =  278 bits (712), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 126/195 (64%), Positives = 159/195 (81%)

Query: 14  VFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQK 73
           +F  LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP K
Sbjct: 4   IFDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDK 63

Query: 74  EISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNA 133
           +I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G  G R+ LPN+
Sbjct: 64  DIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAPGKRYVLPNS 123

Query: 134 RILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSAS 193
           R+++HQP GGF GQASDI+ HAQ+I+ IK +LN +  ++ G+  E +E+  DRD+ MSA 
Sbjct: 124 RVMIHQPLGGFQGQASDIQIHAQEILTIKNKLNRLLAEHTGQPIEVIERDTDRDNFMSAD 183

Query: 194 EACDWGVVDKVLMSR 208
           +A ++G+VD VL  R
Sbjct: 184 QAVEYGLVDAVLKHR 198


>gi|153835695|ref|ZP_01988362.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           harveyi HY01]
 gi|156973712|ref|YP_001444619.1| ATP-dependent Clp protease proteolytic subunit [Vibrio harveyi ATCC
           BAA-1116]
 gi|269961045|ref|ZP_06175414.1| ATP-dependent Clp protease proteolytic subunit [Vibrio harveyi
           1DA3]
 gi|226706635|sp|A7MV87|CLPP_VIBHB RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|148867676|gb|EDL66952.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           harveyi HY01]
 gi|156525306|gb|ABU70392.1| hypothetical protein VIBHAR_01417 [Vibrio harveyi ATCC BAA-1116]
 gi|269834264|gb|EEZ88354.1| ATP-dependent Clp protease proteolytic subunit [Vibrio harveyi
           1DA3]
          Length = 208

 Score =  278 bits (712), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 158/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 15  ALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDKDIF 74

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G  G R+ LPN+R++
Sbjct: 75  LYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAPGKRYVLPNSRVM 134

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI+ HAQ+I+ IK++LN +  ++ G+  E +E+  DRD+ MSA +A 
Sbjct: 135 IHQPLGGFQGQASDIQIHAQEILTIKQKLNNLLAEHTGQPLEVIERDTDRDNFMSADQAV 194

Query: 197 DWGVVDKVLMSR 208
           ++G+VD VL  R
Sbjct: 195 EYGIVDAVLSHR 206


>gi|27363512|ref|NP_759040.1| ATP-dependent Clp protease proteolytic subunit [Vibrio vulnificus
           CMCP6]
 gi|37679288|ref|NP_933897.1| ATP-dependent Clp protease proteolytic subunit [Vibrio vulnificus
           YJ016]
 gi|320156969|ref|YP_004189348.1| ATP-dependent Clp protease proteolytic subunit [Vibrio vulnificus
           MO6-24/O]
 gi|27359628|gb|AAO08567.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           vulnificus CMCP6]
 gi|37198031|dbj|BAC93868.1| ATP-dependent Clp protease, proteolytic subunit [Vibrio vulnificus
           YJ016]
 gi|319932281|gb|ADV87145.1| ATP-dependent Clp protease proteolytic subunit [Vibrio vulnificus
           MO6-24/O]
          Length = 208

 Score =  278 bits (712), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 158/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 15  ALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDKDIF 74

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G  G R+ LPN+R++
Sbjct: 75  LYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAPGKRYVLPNSRVM 134

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI+ HAQ+I+ IK +LN++  ++ G+  E +E+  DRD+ MSA +A 
Sbjct: 135 IHQPLGGFQGQASDIQIHAQEILTIKTKLNKLLAEHTGQPLEVIERDTDRDNFMSADQAV 194

Query: 197 DWGVVDKVLMSR 208
           ++G+VD VL  R
Sbjct: 195 EYGLVDAVLTHR 206


>gi|84387735|ref|ZP_00990751.1| ATP-dependent Clp protease proteolytic subunit [Vibrio splendidus
           12B01]
 gi|218710174|ref|YP_002417795.1| ATP-dependent Clp protease proteolytic subunit [Vibrio splendidus
           LGP32]
 gi|254763809|sp|B7VI00|CLPP_VIBSL RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|84377418|gb|EAP94285.1| ATP-dependent Clp protease proteolytic subunit [Vibrio splendidus
           12B01]
 gi|218323193|emb|CAV19370.1| ATP-dependent Clp protease proteolytic subunit [Vibrio splendidus
           LGP32]
          Length = 208

 Score =  278 bits (712), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 130/208 (62%), Positives = 164/208 (78%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS++   K     +   LVPMVVEQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA L+ 
Sbjct: 1   MSYQ--EKNTMPSIMDALVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQLLFLESENPDKDIYLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
            G  G R  LPN+R+++HQP GGF GQASDI+ HAQ+I+ IK++LN++  ++ G+  E V
Sbjct: 119 GGTPGKRHVLPNSRVMIHQPLGGFQGQASDIQIHAQEILTIKQKLNKLLAEHTGQPLEVV 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  DRD+ MSA +A ++G+VD VL  R
Sbjct: 179 ERDTDRDNFMSADQAVEYGLVDSVLNHR 206


>gi|91793847|ref|YP_563498.1| ATP-dependent Clp protease proteolytic subunit [Shewanella
           denitrificans OS217]
 gi|123356647|sp|Q12LA1|CLPP_SHEDO RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|91715849|gb|ABE55775.1| ATP-dependent Clp protease proteolytic subunit ClpP [Shewanella
           denitrificans OS217]
          Length = 203

 Score =  278 bits (711), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 161/200 (80%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           K  E V   LVPMVVEQT +GERSYDIYSRLLKER++F+ GQ+E+HMA LI AQLLFLE+
Sbjct: 3   KAPESVLNALVPMVVEQTAKGERSYDIYSRLLKERVIFLVGQVEEHMANLIVAQLLFLES 62

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           E+P K+I LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+ G KG R 
Sbjct: 63  ESPDKDIYLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGAKGKRH 122

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
            LPN+R+++HQP GGF GQASDI  HAQ+I+ IK +LN++  ++ G+  E +E+  DRD+
Sbjct: 123 CLPNSRVMIHQPLGGFQGQASDIAIHAQEILGIKNKLNQMLAEHTGQPLEVIERDTDRDN 182

Query: 189 IMSASEACDWGVVDKVLMSR 208
            MSA++A D+G+VD +L SR
Sbjct: 183 FMSATQAMDYGLVDSLLTSR 202


>gi|157825907|ref|YP_001493627.1| ATP-dependent Clp protease proteolytic subunit [Rickettsia akari
           str. Hartford]
 gi|166214704|sp|A8GNZ4|CLPP_RICAH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|157799865|gb|ABV75119.1| ATP-dependent Clp protease proteolytic subunit [Rickettsia akari
           str. Hartford]
          Length = 201

 Score =  278 bits (711), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 163/193 (84%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +  VP+V+EQT+RGER+YDIYSRLLKERI+FV   +EDHMA LI AQLLFLEAENP+K++
Sbjct: 1   MSYVPIVIEQTSRGERAYDIYSRLLKERIIFVCSTVEDHMANLIVAQLLFLEAENPKKDV 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGGVVTAG+AIYDTMQ+IKP ++T C+GQA SMGSLLL  G +GMR++LP++RI
Sbjct: 61  YMYINSPGGVVTAGLAIYDTMQYIKPKVATLCIGQACSMGSLLLCGGTQGMRYSLPHSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG+ GQA+DIE HAQ+ +KIKR LNE+Y K+ G+  + +EK+++RD+ MS  EA
Sbjct: 121 MIHQPSGGYKGQATDIEIHAQETLKIKRLLNELYSKHTGQELKHIEKSMERDNFMSPEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G++D ++ SR
Sbjct: 181 KKFGIIDNIISSR 193


>gi|31340017|sp|Q8DG26|CLPP_VIBVU RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|60389705|sp|Q7MMG7|CLPP_VIBVY RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
          Length = 200

 Score =  278 bits (711), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 158/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 7   ALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDKDIF 66

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G  G R+ LPN+R++
Sbjct: 67  LYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAPGKRYVLPNSRVM 126

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI+ HAQ+I+ IK +LN++  ++ G+  E +E+  DRD+ MSA +A 
Sbjct: 127 IHQPLGGFQGQASDIQIHAQEILTIKTKLNKLLAEHTGQPLEVIERDTDRDNFMSADQAV 186

Query: 197 DWGVVDKVLMSR 208
           ++G+VD VL  R
Sbjct: 187 EYGLVDAVLTHR 198


>gi|258542726|ref|YP_003188159.1| ATP-dependent Clp protease proteolytic subunit [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256633804|dbj|BAH99779.1| Clp protease proteolytic subunit ClpP [Acetobacter pasteurianus IFO
           3283-01]
 gi|256636863|dbj|BAI02832.1| Clp protease proteolytic subunit ClpP [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639916|dbj|BAI05878.1| Clp protease proteolytic subunit ClpP [Acetobacter pasteurianus IFO
           3283-07]
 gi|256642972|dbj|BAI08927.1| Clp protease proteolytic subunit ClpP [Acetobacter pasteurianus IFO
           3283-22]
 gi|256646027|dbj|BAI11975.1| Clp protease proteolytic subunit ClpP [Acetobacter pasteurianus IFO
           3283-26]
 gi|256649080|dbj|BAI15021.1| Clp protease proteolytic subunit ClpP [Acetobacter pasteurianus IFO
           3283-32]
 gi|256652067|dbj|BAI18001.1| Clp protease proteolytic subunit ClpP [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256655124|dbj|BAI21051.1| Clp protease proteolytic subunit ClpP [Acetobacter pasteurianus IFO
           3283-12]
          Length = 220

 Score =  278 bits (711), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 129/202 (63%), Positives = 169/202 (83%), Gaps = 1/202 (0%)

Query: 5   GCAKKDSEDVFL-GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQL 63
           G   +D  ++F   LVPMVVEQT+RGER++DIYSRLL+ERI+F+TG + D +A+LI AQL
Sbjct: 3   GMRDRDPVEIFSNALVPMVVEQTSRGERAFDIYSRLLQERIIFLTGPVYDQVASLISAQL 62

Query: 64  LFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGE 123
           L+LE+ NP KEIS YINSPGGVV+AG+AIYDTMQ+I+ P+ST C+GQAASMGSLLL+ GE
Sbjct: 63  LYLESVNPNKEISFYINSPGGVVSAGLAIYDTMQYIRSPVSTVCIGQAASMGSLLLAGGE 122

Query: 124 KGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKT 183
           KG RFALPNAR+++HQPSGG  GQASDIE  A++I+ I+++LNEIY ++ G+T EE+E+ 
Sbjct: 123 KGRRFALPNARVMVHQPSGGAQGQASDIEIQAREILIIRQKLNEIYREHTGRTLEEIEQK 182

Query: 184 LDRDHIMSASEACDWGVVDKVL 205
           L+RD  MSA EA  +G+VD+V+
Sbjct: 183 LERDTYMSAQEAQSFGIVDEVI 204


>gi|330994049|ref|ZP_08317979.1| ATP-dependent Clp protease proteolytic subunit 1 [Gluconacetobacter
           sp. SXCC-1]
 gi|329758995|gb|EGG75509.1| ATP-dependent Clp protease proteolytic subunit 1 [Gluconacetobacter
           sp. SXCC-1]
          Length = 213

 Score =  278 bits (711), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 167/198 (84%), Gaps = 1/198 (0%)

Query: 9   KDSEDVFL-GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           +D  ++F   LVPMVVEQT+RGER++DIYSRLL+ERI+F+TG + D +A ++ AQLL+LE
Sbjct: 6   RDPVEIFNNALVPMVVEQTSRGERAFDIYSRLLQERIIFLTGPVYDQVAAVVSAQLLYLE 65

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           + NP KEIS YINSPGGVV+AG+AIYDTMQ+I+ P+ST C+GQAASMGSLLL+ GEKG R
Sbjct: 66  SVNPTKEISFYINSPGGVVSAGLAIYDTMQYIRSPVSTVCIGQAASMGSLLLAGGEKGRR 125

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FALPN+R+++HQPSGG  GQASDIE  AQ+I+ I++RLNEIY ++ G+T EE+E+ L+RD
Sbjct: 126 FALPNSRVMVHQPSGGAQGQASDIEIQAQEILTIRKRLNEIYNEHTGRTLEEIERKLERD 185

Query: 188 HIMSASEACDWGVVDKVL 205
             MSA EA  +G+VD+V+
Sbjct: 186 SYMSAEEAQAFGIVDEVV 203


>gi|302878843|ref|YP_003847407.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Gallionella
           capsiferriformans ES-2]
 gi|302581632|gb|ADL55643.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Gallionella
           capsiferriformans ES-2]
          Length = 202

 Score =  278 bits (711), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 122/194 (62%), Positives = 162/194 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +G++PMVVE + RGER+YDIYSRLLKER+VF+ G++ DH A LI AQ+LFLE+ENP K+I
Sbjct: 9   IGMIPMVVETSGRGERAYDIYSRLLKERVVFLVGEVNDHSANLIVAQMLFLESENPDKDI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
             YINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+AGEKG RFALPN+R+
Sbjct: 69  HFYINSPGGSVTAGMAIYDTMQFIKPAVSTLCIGQAASMGAFLLTAGEKGKRFALPNSRV 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDIE HA++I+ +K++LN++   + G+T E +E+  DRD+ +SA++A
Sbjct: 129 MIHQPLGGFRGQASDIEIHAREILYLKQKLNQMLADHTGQTVEAIERDTDRDNFLSAADA 188

Query: 196 CDWGVVDKVLMSRI 209
             +G+VD+VL  R+
Sbjct: 189 VAYGLVDQVLEKRV 202


>gi|86148885|ref|ZP_01067136.1| ATP-dependent Clp protease proteolytic subunit [Vibrio sp. MED222]
 gi|85833328|gb|EAQ51535.1| ATP-dependent Clp protease proteolytic subunit [Vibrio sp. MED222]
          Length = 198

 Score =  278 bits (710), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 158/191 (82%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA L+ AQLLFLE+ENP K+I L
Sbjct: 6   LVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLVVAQLLFLESENPDKDIYL 65

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G  G R  LPN+R+++
Sbjct: 66  YINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGTPGKRHVLPNSRVMI 125

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQASDI+ HAQ+I+ IK++LN++  ++ G+  E VE+  DRD+ MSA +A +
Sbjct: 126 HQPLGGFQGQASDIQIHAQEILTIKQKLNKLLAEHTGQPLEVVERDTDRDNFMSADQAVE 185

Query: 198 WGVVDKVLMSR 208
           +G+VD VL  R
Sbjct: 186 YGLVDSVLNHR 196


>gi|56695904|ref|YP_166255.1| ATP-dependent Clp protease proteolytic subunit [Ruegeria pomeroyi
           DSS-3]
 gi|67460175|sp|Q5LUQ0|CLPP_SILPO RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|56677641|gb|AAV94307.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Ruegeria
           pomeroyi DSS-3]
          Length = 209

 Score =  278 bits (710), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 131/200 (65%), Positives = 164/200 (82%), Gaps = 1/200 (0%)

Query: 10  DSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           D  D ++  LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G I D M+ LI AQLL LEA
Sbjct: 3   DPVDTYMNTLVPMVVEQTSRGERAYDIFSRLLKERIIFINGPIHDGMSHLIVAQLLHLEA 62

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP KEIS+YINSPGGVVT+G++IYDTMQ+IKP  ST  +GQAASMGS+LL+ GEKGMRF
Sbjct: 63  ENPNKEISIYINSPGGVVTSGLSIYDTMQYIKPKCSTLVIGQAASMGSVLLAGGEKGMRF 122

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           +LPN+RI++HQPSGG+ GQASDI  HA +  K+K RL +IYVK+ G+T + VEK LDRD+
Sbjct: 123 SLPNSRIMVHQPSGGYQGQASDIMIHAAETQKLKDRLYDIYVKHTGQTKKAVEKALDRDN 182

Query: 189 IMSASEACDWGVVDKVLMSR 208
            MS  EA +WG +D+++ SR
Sbjct: 183 FMSPEEAKEWGHIDEIVESR 202


>gi|261253459|ref|ZP_05946032.1| ATP-dependent Clp protease proteolytic subunit [Vibrio orientalis
           CIP 102891]
 gi|260936850|gb|EEX92839.1| ATP-dependent Clp protease proteolytic subunit [Vibrio orientalis
           CIP 102891]
          Length = 208

 Score =  278 bits (710), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 124/192 (64%), Positives = 159/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 15  ALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDKDIF 74

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G  G R+ LPN+R++
Sbjct: 75  LYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAPGKRYVLPNSRVM 134

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI+ HAQ+I+ IK++LN++  ++ G+  E +E+  DRD+ M+A +A 
Sbjct: 135 IHQPLGGFQGQASDIQIHAQEILTIKQKLNKLLAEHTGQPLEVIERDTDRDNFMAADQAV 194

Query: 197 DWGVVDKVLMSR 208
           ++G+VD VL  R
Sbjct: 195 EYGLVDAVLTHR 206


>gi|260776382|ref|ZP_05885277.1| ATP-dependent Clp protease proteolytic subunit [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260607605|gb|EEX33870.1| ATP-dependent Clp protease proteolytic subunit [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 208

 Score =  278 bits (710), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 124/192 (64%), Positives = 159/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 15  ALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDKDIF 74

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G  G R+ LPN+R++
Sbjct: 75  LYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAPGKRYVLPNSRVM 134

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI+ HAQ+I+ IK++LN++  ++ G+  E +E+  DRD+ M+A +A 
Sbjct: 135 IHQPLGGFQGQASDIQIHAQEILTIKQKLNKLLAEHTGQPLEVIERDTDRDNFMAADQAV 194

Query: 197 DWGVVDKVLMSR 208
           ++G+VD VL  R
Sbjct: 195 EYGLVDAVLTHR 206


>gi|91228617|ref|ZP_01262535.1| ATP-dependent Clp protease proteolytic subunit [Vibrio
           alginolyticus 12G01]
 gi|254229904|ref|ZP_04923307.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio sp.
           Ex25]
 gi|262394815|ref|YP_003286669.1| ATP-dependent Clp protease proteolytic subunit [Vibrio sp. Ex25]
 gi|269965580|ref|ZP_06179694.1| ATP-dependent Clp protease proteolytic subunit [Vibrio
           alginolyticus 40B]
 gi|91187849|gb|EAS74163.1| ATP-dependent Clp protease proteolytic subunit [Vibrio
           alginolyticus 12G01]
 gi|151937540|gb|EDN56395.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio sp.
           Ex25]
 gi|262338409|gb|ACY52204.1| ATP-dependent Clp protease proteolytic subunit [Vibrio sp. Ex25]
 gi|269829805|gb|EEZ84040.1| ATP-dependent Clp protease proteolytic subunit [Vibrio
           alginolyticus 40B]
          Length = 208

 Score =  278 bits (710), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 124/192 (64%), Positives = 159/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 15  ALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDKDIF 74

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G  G R+ LPN+R++
Sbjct: 75  LYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAPGKRYVLPNSRVM 134

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI+ HAQ+I+ IK++LN++  ++ G+  E +E+  DRD+ MS+ +A 
Sbjct: 135 IHQPLGGFQGQASDIQIHAQEILTIKQKLNKLLAEHTGQPLEVIERDTDRDNFMSSEQAV 194

Query: 197 DWGVVDKVLMSR 208
           ++G+VD VL  R
Sbjct: 195 EYGIVDAVLSHR 206


>gi|258621302|ref|ZP_05716336.1| ATP-dependent Clp protease proteolytic subunit [Vibrio mimicus
           VM573]
 gi|258625374|ref|ZP_05720271.1| ATP-dependent Clp protease proteolytic subunit [Vibrio mimicus
           VM603]
 gi|262166052|ref|ZP_06033789.1| ATP-dependent Clp protease proteolytic subunit [Vibrio mimicus
           VM223]
 gi|262171083|ref|ZP_06038761.1| ATP-dependent Clp protease proteolytic subunit [Vibrio mimicus
           MB-451]
 gi|258582365|gb|EEW07217.1| ATP-dependent Clp protease proteolytic subunit [Vibrio mimicus
           VM603]
 gi|258586690|gb|EEW11405.1| ATP-dependent Clp protease proteolytic subunit [Vibrio mimicus
           VM573]
 gi|261892159|gb|EEY38145.1| ATP-dependent Clp protease proteolytic subunit [Vibrio mimicus
           MB-451]
 gi|262025768|gb|EEY44436.1| ATP-dependent Clp protease proteolytic subunit [Vibrio mimicus
           VM223]
          Length = 208

 Score =  278 bits (710), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 159/195 (81%)

Query: 14  VFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQK 73
           +F  LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP K
Sbjct: 12  IFDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDK 71

Query: 74  EISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNA 133
           +I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G  G R+ LPN+
Sbjct: 72  DIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAPGKRYVLPNS 131

Query: 134 RILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSAS 193
           R+++HQP GGF GQASDI+ HA++I+ IK +LN +  ++ G+  E +E+  DRD+ MSA 
Sbjct: 132 RVMIHQPLGGFQGQASDIQIHAKEILTIKNKLNRLLAEHTGQPLEVIERDTDRDNFMSAD 191

Query: 194 EACDWGVVDKVLMSR 208
           +A ++G+VD VL  R
Sbjct: 192 QAVEYGLVDAVLKHR 206


>gi|296116539|ref|ZP_06835149.1| ATP-dependent Clp protease proteolytic subunit [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295976751|gb|EFG83519.1| ATP-dependent Clp protease proteolytic subunit [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 211

 Score =  277 bits (709), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 124/189 (65%), Positives = 161/189 (85%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT+RGER++DIYSRLL+ERI+F+TG + D ++ ++ AQLL+LE+ NP KEIS
Sbjct: 13  ALVPMVVEQTSRGERAFDIYSRLLQERIIFLTGPVYDQVSAVVSAQLLYLESVNPTKEIS 72

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
            YINSPGGVV+AG+AIYDTMQ+I+ P+ST C+GQAASMGSLLL+ GEKG RFALPN+R++
Sbjct: 73  FYINSPGGVVSAGLAIYDTMQYIRSPVSTVCIGQAASMGSLLLAGGEKGRRFALPNSRVM 132

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG  GQASDIE  A +I+ I++RLNEIY  + G+T EE+E+ L+RD  MSA EAC
Sbjct: 133 VHQPSGGAQGQASDIEIQATEILTIRKRLNEIYENHTGRTLEEIERKLERDSYMSAEEAC 192

Query: 197 DWGVVDKVL 205
            +G+VD+V+
Sbjct: 193 AFGIVDEVV 201


>gi|224824981|ref|ZP_03698087.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Lutiella
           nitroferrum 2002]
 gi|224602652|gb|EEG08829.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Lutiella
           nitroferrum 2002]
          Length = 207

 Score =  277 bits (709), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 126/197 (63%), Positives = 160/197 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVPMVVEQ+ RGER+YDIYSRLLKERIVF+ G + D  A L+ AQ+LFLE+ENP K+I
Sbjct: 10  LGLVPMVVEQSGRGERAYDIYSRLLKERIVFLVGPVTDESANLVVAQMLFLESENPDKDI 69

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
             YINSPGG V+AGM+I+DTM FIKP +ST C+GQAASMG+ LLSAG KG RFALPN+RI
Sbjct: 70  YFYINSPGGSVSAGMSIFDTMNFIKPDVSTLCIGQAASMGAFLLSAGAKGKRFALPNSRI 129

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASD E HA++I+ +KRRLNE+   + G++ EE+E+  DRD+ MS+ EA
Sbjct: 130 MIHQPLGGFQGQASDFEIHAKNILYMKRRLNELLALHTGRSIEEIERDTDRDNFMSSEEA 189

Query: 196 CDWGVVDKVLMSRIDIE 212
             +G++DK+L SR D +
Sbjct: 190 LAYGLIDKMLQSRRDAQ 206


>gi|114048055|ref|YP_738605.1| ATP-dependent Clp protease proteolytic subunit [Shewanella sp.
           MR-7]
 gi|123326387|sp|Q0HTK7|CLPP_SHESR RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|113889497|gb|ABI43548.1| ATP-dependent Clp protease proteolytic subunit ClpP [Shewanella sp.
           MR-7]
          Length = 202

 Score =  277 bits (709), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 162/199 (81%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           ++ D+   LVPMV+EQT +GERS+DIYSRLLKERI+F+ GQ+E+HMA LI AQLLFLE+E
Sbjct: 3   NASDIQSALVPMVIEQTAKGERSFDIYSRLLKERIIFLVGQVEEHMANLIVAQLLFLESE 62

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           +P K+I LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+ GEKG RF 
Sbjct: 63  SPDKDIFLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGEKGKRFC 122

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPN+R+++HQP GGF GQASDI  HAQ+I+ IK +LN +  ++ G+  E +E+  DRD+ 
Sbjct: 123 LPNSRVMIHQPLGGFQGQASDIAIHAQEILGIKHKLNLMLAEHTGQPLEVIERDTDRDNF 182

Query: 190 MSASEACDWGVVDKVLMSR 208
           MSA++A D+G+VD V+  R
Sbjct: 183 MSATQAVDYGLVDAVMTKR 201


>gi|239948026|ref|ZP_04699779.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Rickettsia
           endosymbiont of Ixodes scapularis]
 gi|239922302|gb|EER22326.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Rickettsia
           endosymbiont of Ixodes scapularis]
          Length = 201

 Score =  277 bits (709), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 162/193 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +  VP+V+EQT+RGER+YDIYSRLLKERI+FV   +EDHM  LI AQLLFLEAENP+K+I
Sbjct: 1   MSYVPIVIEQTSRGERAYDIYSRLLKERIIFVCSTVEDHMTNLIVAQLLFLEAENPKKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGGV+TAG+AIYDTMQ+IKP ++T C+GQA SMGSLLL  GEKGMR++LP++RI
Sbjct: 61  YMYINSPGGVITAGLAIYDTMQYIKPKVATLCIGQACSMGSLLLCGGEKGMRYSLPHSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG+ GQA+DIE HAQ+ +KIKR LNE+Y K+  +  + +EK+++RD+ MS  EA
Sbjct: 121 MIHQPSGGYKGQATDIEIHAQETLKIKRLLNELYSKHTRQELKHIEKSMERDNFMSPEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G++D ++ SR
Sbjct: 181 KKFGIIDNIISSR 193


>gi|323495056|ref|ZP_08100145.1| ATP-dependent Clp protease proteolytic subunit [Vibrio brasiliensis
           LMG 20546]
 gi|323310713|gb|EGA63888.1| ATP-dependent Clp protease proteolytic subunit [Vibrio brasiliensis
           LMG 20546]
          Length = 208

 Score =  277 bits (709), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 126/192 (65%), Positives = 158/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 15  ALVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLVVAQLLFLESENPDKDIF 74

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G  G R  LPN+R++
Sbjct: 75  LYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAPGKRHVLPNSRVM 134

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI+ HAQ+I+ IK++LN++  ++ G+  E +E+  DRD+ MSA +A 
Sbjct: 135 IHQPLGGFQGQASDIQIHAQEILTIKQKLNKLLAEHTGQPLEVIERDTDRDNFMSADQAV 194

Query: 197 DWGVVDKVLMSR 208
           ++G+VD VL  R
Sbjct: 195 EYGLVDSVLNHR 206


>gi|209694398|ref|YP_002262326.1| ATP-dependent Clp protease proteolytic subunit [Aliivibrio
           salmonicida LFI1238]
 gi|226706438|sp|B6EHK3|CLPP_ALISL RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|208008349|emb|CAQ78503.1| ATP-dependent Clp protease proteolytic subunit [Aliivibrio
           salmonicida LFI1238]
          Length = 207

 Score =  277 bits (709), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 157/192 (81%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 15  ALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDKDIF 74

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G  G R+ LPN+R++
Sbjct: 75  LYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAPGKRYVLPNSRVM 134

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI+ HAQ+I+ IK++LN +  ++ G+  E +EK  DRD+ M+A +A 
Sbjct: 135 IHQPLGGFQGQASDIQIHAQEILTIKKKLNTLLAEHTGQPLEVIEKDTDRDNFMAADDAV 194

Query: 197 DWGVVDKVLMSR 208
            +G+VD VL  R
Sbjct: 195 KYGLVDAVLNKR 206


>gi|59711403|ref|YP_204179.1| ATP-dependent Clp protease proteolytic subunit [Vibrio fischeri
           ES114]
 gi|197335304|ref|YP_002155557.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           fischeri MJ11]
 gi|67460143|sp|Q5E6Q5|CLPP_VIBF1 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|226706555|sp|B5FBZ8|CLPP_VIBFM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|59479504|gb|AAW85291.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Vibrio fischeri ES114]
 gi|197316794|gb|ACH66241.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           fischeri MJ11]
          Length = 207

 Score =  277 bits (709), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 157/192 (81%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 15  ALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDKDIF 74

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G  G R+ LPN+R++
Sbjct: 75  LYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAPGKRYVLPNSRVM 134

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI+ HAQ+I+ IK++LN +  ++ G+  E +E+  DRD+ MSA +A 
Sbjct: 135 IHQPLGGFQGQASDIQIHAQEILTIKKKLNTLLAEHTGQPLEVIEQDTDRDNFMSADDAV 194

Query: 197 DWGVVDKVLMSR 208
            +G+VD VL  R
Sbjct: 195 KYGLVDAVLNKR 206


>gi|323498276|ref|ZP_08103278.1| ATP-dependent Clp protease proteolytic subunit [Vibrio sinaloensis
           DSM 21326]
 gi|323316704|gb|EGA69713.1| ATP-dependent Clp protease proteolytic subunit [Vibrio sinaloensis
           DSM 21326]
          Length = 208

 Score =  277 bits (709), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 124/192 (64%), Positives = 159/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 15  ALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDKDIF 74

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G  G R+ LPN+R++
Sbjct: 75  LYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAPGKRYVLPNSRVM 134

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI+ HAQ+I+ IK++LN++  ++ G+  E +E+  DRD+ M+A +A 
Sbjct: 135 IHQPLGGFQGQASDIQIHAQEILTIKQKLNKLLAEHTGQPLEVIERDTDRDNFMAADQAV 194

Query: 197 DWGVVDKVLMSR 208
           ++G+VD VL  R
Sbjct: 195 EYGLVDAVLSHR 206


>gi|238650581|ref|YP_002916433.1| ATP-dependent Clp protease proteolytic subunit [Rickettsia
           peacockii str. Rustic]
 gi|259585964|sp|C4K1D4|CLPP_RICPU RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|238624679|gb|ACR47385.1| ATP-dependent Clp protease proteolytic subunit [Rickettsia
           peacockii str. Rustic]
          Length = 201

 Score =  277 bits (709), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 125/193 (64%), Positives = 162/193 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +  VP+VVE T+RGER+YDIYSRLLKERI+FV   +EDHMA LI AQLLFLEAENP+K+I
Sbjct: 1   MSYVPIVVEPTSRGERAYDIYSRLLKERIIFVCSTVEDHMANLIVAQLLFLEAENPKKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGGVVTAG+AIYDTMQ+IKP ++T C+GQA SMGSLLL  GEKGMR++LP++RI
Sbjct: 61  YMYINSPGGVVTAGLAIYDTMQYIKPKVATLCIGQACSMGSLLLCGGEKGMRYSLPHSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG+ GQA+DIE HAQ+ +KIKR LNE+Y K+  +  + +EK+++RD+ MS  EA
Sbjct: 121 MIHQPSGGYKGQATDIEIHAQETLKIKRLLNELYSKHTEQELKHIEKSMERDNFMSPEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G+VD ++ SR
Sbjct: 181 KKFGLVDNIMSSR 193


>gi|254507754|ref|ZP_05119885.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           parahaemolyticus 16]
 gi|219549279|gb|EED26273.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           parahaemolyticus 16]
          Length = 208

 Score =  277 bits (709), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 124/192 (64%), Positives = 159/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 15  ALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDKDIF 74

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G  G R+ LPN+R++
Sbjct: 75  LYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAPGKRYVLPNSRVM 134

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI+ HAQ+I+ IK++LN++  ++ G+  E +E+  DRD+ M+A +A 
Sbjct: 135 IHQPLGGFQGQASDIQIHAQEILTIKQKLNKLLAEHTGQPLEVIERDTDRDNFMAAEQAV 194

Query: 197 DWGVVDKVLMSR 208
           ++G+VD VL  R
Sbjct: 195 EYGLVDAVLSHR 206


>gi|88860444|ref|ZP_01135082.1| ATP-dependent Clp protease proteolytic subunit [Pseudoalteromonas
           tunicata D2]
 gi|88817642|gb|EAR27459.1| ATP-dependent Clp protease proteolytic subunit [Pseudoalteromonas
           tunicata D2]
          Length = 205

 Score =  277 bits (708), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 157/196 (80%)

Query: 13  DVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQ 72
           D    LVPMVVEQT +GERSYDIYSRLLKER++F+TGQ+EDHMA LI AQLLFLE+ENP+
Sbjct: 7   DPLNALVPMVVEQTAKGERSYDIYSRLLKERVIFLTGQVEDHMANLIVAQLLFLESENPE 66

Query: 73  KEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPN 132
           K+I +YINSPGG VTAGMAIYDTM FIKP +ST CMGQAASMG+ LLS G KG RF LPN
Sbjct: 67  KDIFIYINSPGGSVTAGMAIYDTMNFIKPNVSTVCMGQAASMGAFLLSGGTKGKRFCLPN 126

Query: 133 ARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSA 192
           +R+++HQP GGF GQASD E HA++I+ IK +LN +  ++ G+  E + +  DRD+ MS 
Sbjct: 127 SRVMIHQPLGGFQGQASDFEIHAREILSIKDKLNRLLAEHTGQPIEVISRDTDRDNFMSG 186

Query: 193 SEACDWGVVDKVLMSR 208
           ++A ++G+VD VL  R
Sbjct: 187 AQAVEYGIVDAVLTQR 202


>gi|329114674|ref|ZP_08243433.1| ATP-dependent Clp protease proteolytic subunit 1 [Acetobacter
           pomorum DM001]
 gi|326696154|gb|EGE47836.1| ATP-dependent Clp protease proteolytic subunit 1 [Acetobacter
           pomorum DM001]
          Length = 237

 Score =  277 bits (708), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 129/202 (63%), Positives = 169/202 (83%), Gaps = 1/202 (0%)

Query: 5   GCAKKDSEDVFL-GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQL 63
           G   +D  ++F   LVPMVVEQT+RGER++DIYSRLL+ERI+F+TG + D +A+LI AQL
Sbjct: 20  GMRDRDPVEIFSNALVPMVVEQTSRGERAFDIYSRLLQERIIFLTGPVYDQVASLISAQL 79

Query: 64  LFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGE 123
           L+LE+ NP KEIS YINSPGGVV+AG+AIYDTMQ+I+ P+ST C+GQAASMGSLLL+ GE
Sbjct: 80  LYLESVNPNKEISFYINSPGGVVSAGLAIYDTMQYIRSPVSTVCIGQAASMGSLLLAGGE 139

Query: 124 KGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKT 183
           KG RFALPNAR+++HQPSGG  GQASDIE  A++I+ I+++LNEIY ++ G+T EE+E+ 
Sbjct: 140 KGRRFALPNARVMVHQPSGGAQGQASDIEIQAREILIIRQKLNEIYREHTGRTLEEIEQK 199

Query: 184 LDRDHIMSASEACDWGVVDKVL 205
           L+RD  MSA EA  +G+VD+V+
Sbjct: 200 LERDTYMSAHEAQSFGIVDEVI 221


>gi|90021255|ref|YP_527082.1| ATP-dependent Clp protease proteolytic subunit [Saccharophagus
           degradans 2-40]
 gi|116243165|sp|Q21KA9|CLPP_SACD2 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|89950855|gb|ABD80870.1| ATP-dependent Clp protease proteolytic subunit ClpP [Saccharophagus
           degradans 2-40]
          Length = 212

 Score =  277 bits (708), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 126/192 (65%), Positives = 156/192 (81%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQT RGERSYDIYSRLLKER++F+ GQ+EDHMA L+ AQ+LFLEAENP K+I L
Sbjct: 18  LVPMVVEQTARGERSYDIYSRLLKERVIFLVGQVEDHMANLVVAQMLFLEAENPDKDIHL 77

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAG++IYDTMQFIKP +ST C+GQA SMG+ LL+AG KG RF LPNAR ++
Sbjct: 78  YINSPGGSVTAGLSIYDTMQFIKPDVSTMCIGQACSMGAFLLTAGAKGKRFCLPNARTMI 137

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGG  GQASDI   AQ+I+K++ RLNEI   + G+  EE+ +  +RD  MSA E+ +
Sbjct: 138 HQPSGGAQGQASDIHIQAQEILKLRERLNEIMAGHTGRGVEEIARDTERDRFMSAHESVE 197

Query: 198 WGVVDKVLMSRI 209
           +G++DKVL  R+
Sbjct: 198 YGLIDKVLERRV 209


>gi|269138347|ref|YP_003295047.1| protease subunit of ATP-dependent Clp protease [Edwardsiella tarda
           EIB202]
 gi|267984007|gb|ACY83836.1| protease subunit of ATP-dependent Clp protease [Edwardsiella tarda
           EIB202]
 gi|304558379|gb|ADM41043.1| ATP-dependent Clp protease proteolytic subunit [Edwardsiella tarda
           FL6-60]
          Length = 189

 Score =  277 bits (708), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 157/188 (83%)

Query: 21  MVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYIN 80
           MVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI AQ+LFLEAENP+K+I LYIN
Sbjct: 1   MVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLIVAQMLFLEAENPEKDIHLYIN 60

Query: 81  SPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQP 140
           SPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMGS LL+AG +G RF LPN+R+++HQP
Sbjct: 61  SPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGSFLLAAGAQGKRFCLPNSRVMIHQP 120

Query: 141 SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGV 200
            GGF GQA+DIE HA++I+ IK R+N +  K+ G+  E +E+  +RD  MSA +A ++G+
Sbjct: 121 LGGFQGQATDIEIHAKEILSIKARMNTLMAKHSGQPIEVIERDTERDRFMSAQDAVEYGL 180

Query: 201 VDKVLMSR 208
           VD VL  R
Sbjct: 181 VDAVLTQR 188


>gi|289207758|ref|YP_003459824.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Thioalkalivibrio sp. K90mix]
 gi|288943389|gb|ADC71088.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Thioalkalivibrio sp. K90mix]
          Length = 224

 Score =  277 bits (708), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 159/193 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           L LVPMVVEQT RGER+YDIYSRLLK+R++F  G +ED+MA +I AQLLFLE+ENP KEI
Sbjct: 16  LNLVPMVVEQTARGERAYDIYSRLLKDRVIFCVGPVEDYMANVIVAQLLFLESENPDKEI 75

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG++LL+ G  G R++LP++R+
Sbjct: 76  SLYINSPGGAVTAGMAIYDTMQFIKPQVSTLCVGQAASMGAVLLAGGAPGKRYSLPHSRV 135

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI+ HA++I+KI+  LN +   + G+T E+VE+  DRD  M+A EA
Sbjct: 136 MIHQPLGGFQGQASDIDIHAREILKIREELNRVLAHHTGQTVEQVEQDTDRDRFMTAVEA 195

Query: 196 CDWGVVDKVLMSR 208
            D+G+VD VL SR
Sbjct: 196 KDYGLVDNVLSSR 208


>gi|84515416|ref|ZP_01002778.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Loktanella
           vestfoldensis SKA53]
 gi|84510699|gb|EAQ07154.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Loktanella
           vestfoldensis SKA53]
          Length = 198

 Score =  277 bits (708), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 163/193 (84%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT RGER+YDI+SRLLKERI+F+ G + D M+ L+ AQLL LE+ENP+KEI
Sbjct: 1   MNLVPMVVEQTARGERAYDIFSRLLKERIIFLNGPVHDGMSQLVVAQLLHLESENPKKEI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S+YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AG  GMRF+LPN+R+
Sbjct: 61  SMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAGHPGMRFSLPNSRV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG+ GQA+DI  HA +  K+K RLNEIYVK+ G+  ++VE  L+RD+ MS  EA
Sbjct: 121 MVHQPSGGYQGQATDIMIHAAETQKLKTRLNEIYVKHTGQPLKKVETALERDNFMSPEEA 180

Query: 196 CDWGVVDKVLMSR 208
            +WG++D+++++R
Sbjct: 181 KEWGLIDEIVVNR 193


>gi|146337660|ref|YP_001202708.1| ATP-dependent Clp protease proteolytic subunit [Bradyrhizobium sp.
           ORS278]
 gi|146190466|emb|CAL74465.1| ATP-dependent Clp protease proteolytic subunit (Endopeptidase Clp)
           [Bradyrhizobium sp. ORS278]
          Length = 205

 Score =  277 bits (708), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 122/191 (63%), Positives = 159/191 (83%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMV+EQ++RGERS+DIYSRLL+ERIVF+ G++ D ++ L+CAQLLFLEAENP++ I L
Sbjct: 7   LVPMVIEQSSRGERSFDIYSRLLRERIVFLNGEVNDTVSALVCAQLLFLEAENPKRPIHL 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G+A+YDTMQF+K P+ T CMG A SMGS LL AGE G R ALPNA + +
Sbjct: 67  YINSPGGVVTSGLAMYDTMQFVKAPVHTLCMGTARSMGSFLLMAGEPGERTALPNASLHV 126

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQASDI  HA+++ + KRR+  +Y ++CG++YE+VE+TLDRDH M+A EA D
Sbjct: 127 HQPLGGFQGQASDIMIHAREMEQTKRRMIRLYAEHCGRSYEDVERTLDRDHFMTADEAQD 186

Query: 198 WGVVDKVLMSR 208
           WG++D+V+  R
Sbjct: 187 WGLIDRVVKQR 197


>gi|190573022|ref|YP_001970867.1| ATP-dependent Clp protease proteolytic subunit [Stenotrophomonas
           maltophilia K279a]
 gi|194364614|ref|YP_002027224.1| ATP-dependent Clp protease proteolytic subunit [Stenotrophomonas
           maltophilia R551-3]
 gi|226706475|sp|B2FQR2|CLPP_STRMK RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|190010944|emb|CAQ44553.1| ATP-dependent clp protease proteolytic subunit [Stenotrophomonas
           maltophilia K279a]
 gi|194347418|gb|ACF50541.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Stenotrophomonas maltophilia R551-3]
          Length = 208

 Score =  277 bits (708), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 124/201 (61%), Positives = 167/201 (83%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           D+    L LVPMVVEQT+RGER+YDIYSRLLKER++F+ G I+DHMA ++ AQLLFLE+E
Sbjct: 2   DNRTKALNLVPMVVEQTSRGERAYDIYSRLLKERLIFLVGPIDDHMANVVVAQLLFLESE 61

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP+K+I++YINSPGGVVTAGMAIYDTMQ+IKP +ST C+GQAASMG+LLL+AGE G R+A
Sbjct: 62  NPEKDINIYINSPGGVVTAGMAIYDTMQYIKPNVSTTCIGQAASMGALLLAAGEAGKRYA 121

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPN+R+++HQP GG+ GQA+DI+ HA++I+ ++ RLNE+  K+ G++ E + +  +RD+ 
Sbjct: 122 LPNSRVMIHQPLGGYQGQATDIDIHAREILTLRSRLNEVLAKHTGQSLETIARDTERDNF 181

Query: 190 MSASEACDWGVVDKVLMSRID 210
            SA EA  +G+VD+VL  R D
Sbjct: 182 KSAFEAQAYGLVDQVLERRPD 202


>gi|15604378|ref|NP_220894.1| ATP-dependent Clp protease proteolytic subunit [Rickettsia
           prowazekii str. Madrid E]
 gi|6225160|sp|Q9ZD29|CLPP_RICPR RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|3861070|emb|CAA14970.1| ATP-DEPENDENT CLP PROTEASE PROTEOLYTIC SUBUNIT (clpP) [Rickettsia
           prowazekii]
 gi|292572133|gb|ADE30048.1| ATP-dependent Clp protease proteolytic subunit [Rickettsia
           prowazekii Rp22]
          Length = 201

 Score =  276 bits (707), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 163/193 (84%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +  VP+V+EQT+RGER+YDIYSRLLKERI+FV   +EDHMA LI AQLLFLEAENP+K+I
Sbjct: 1   MSYVPVVIEQTSRGERAYDIYSRLLKERIIFVCSTVEDHMANLIVAQLLFLEAENPKKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGGVVTAG+AIYDTMQFIKP ++T C+GQA SMGSLLL  GE GMR++LP++RI
Sbjct: 61  YMYINSPGGVVTAGLAIYDTMQFIKPKVATLCIGQACSMGSLLLCGGEHGMRYSLPHSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG+ GQA+DIE HA++ +KIKR LNE+Y K+  +  + +EK+++RD+ MS+ EA
Sbjct: 121 MIHQPSGGYKGQATDIEIHARETLKIKRLLNELYSKHTKQELKYIEKSMERDNFMSSEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G+VD ++ SR
Sbjct: 181 KKFGLVDNIISSR 193


>gi|157828616|ref|YP_001494858.1| ATP-dependent Clp protease proteolytic subunit [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|166214706|sp|A8GSH5|CLPP_RICRS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|157801097|gb|ABV76350.1| ATP-dependent Clp protease proteolytic subunit [Rickettsia
           rickettsii str. 'Sheila Smith']
          Length = 201

 Score =  276 bits (707), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 162/193 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +  VP+V+E T+RGER+YDIYSRLLKERI+FV   +EDHMA LI AQLLFLEAENP+K+I
Sbjct: 1   MSYVPIVIEPTSRGERAYDIYSRLLKERIIFVCSTVEDHMANLIVAQLLFLEAENPKKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGGVVTAG+AIYDTMQ+IKP ++T C+GQA SMGSLLL  GEKGMR++LP++RI
Sbjct: 61  YMYINSPGGVVTAGLAIYDTMQYIKPKVATLCIGQACSMGSLLLCGGEKGMRYSLPHSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG+ GQA+DIE HAQ+ +KIKR LNE+Y K+  +  + +EK+++RD+ MS  EA
Sbjct: 121 MIHQPSGGYKGQATDIEIHAQETLKIKRLLNELYSKHTEQELQHIEKSMERDNFMSPEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G+VD ++ SR
Sbjct: 181 KKFGLVDNIISSR 193


>gi|194595677|gb|ACF77120.1| ATP-dependent Clp protease proteolytic subunit [Azospirillum
           brasilense]
          Length = 210

 Score =  276 bits (707), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 164/199 (82%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           D E     LVPMV+EQTNRGER+YDIYSRLLKERI+F+ G + D +A+LIC+QLLFLE+E
Sbjct: 3   DFEPKMNALVPMVIEQTNRGERAYDIYSRLLKERIIFLIGGVNDAVASLICSQLLFLESE 62

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP K+I+LYINSPGG V+AG+AIYDTMQ+I+P +ST CMGQAASMGSLLL+AG  G RF+
Sbjct: 63  NPSKDIALYINSPGGYVSAGLAIYDTMQYIRPQVSTVCMGQAASMGSLLLAAGAPGKRFS 122

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPN+RI++HQPSGG  GQASDIE  AQ+I+K++ RLN+IYVK+ G++ + +E  ++RD  
Sbjct: 123 LPNSRIMIHQPSGGAQGQASDIEIQAQEILKLRSRLNDIYVKHTGQSLDTIEAAMERDKF 182

Query: 190 MSASEACDWGVVDKVLMSR 208
           MS  EA  +G++D+V+  R
Sbjct: 183 MSPEEAKAFGLIDEVVEKR 201


>gi|119713091|gb|ABL97160.1| ATP-dependent Clp protease proteolytic subunit [uncultured marine
           bacterium EB0_49D07]
          Length = 204

 Score =  276 bits (707), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 168/197 (85%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E +  GLVPMVVEQT RGER++DIYSRLLKERI+F+TG I+D+++ L+ AQLLFLE+ENP
Sbjct: 2   ETINSGLVPMVVEQTPRGERAFDIYSRLLKERIIFLTGPIDDYISNLVVAQLLFLESENP 61

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
           +K+IS+YINSPGGV+T+G+AIYDTMQFI P +ST C+GQAASMGSLLL+ G +G RFAL 
Sbjct: 62  EKDISIYINSPGGVITSGLAIYDTMQFIAPEVSTLCIGQAASMGSLLLAGGAEGKRFALT 121

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+RI++HQP GGFSGQASD E HA++++ +K+++NEI  K+ GKT ++VE+  DRD+ ++
Sbjct: 122 NSRIMIHQPLGGFSGQASDFEIHAKEMLLVKQKVNEILSKHTGKTLKKVEQDTDRDNFLN 181

Query: 192 ASEACDWGVVDKVLMSR 208
           A+EA  +G++D++L  R
Sbjct: 182 ATEAVTYGIIDEILEKR 198


>gi|24373360|ref|NP_717403.1| ATP-dependent Clp protease proteolytic subunit [Shewanella
           oneidensis MR-1]
 gi|60389791|sp|Q8EG19|CLPP_SHEON RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|24347620|gb|AAN54847.1|AE015623_9 ATP-dependent Clp protease, proteolytic subunit [Shewanella
           oneidensis MR-1]
          Length = 202

 Score =  276 bits (707), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 125/199 (62%), Positives = 162/199 (81%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           ++ D+   LVPMV+EQT +GERS+DIYSRLLKERI+F+ GQ+E+HMA LI AQLLFLE+E
Sbjct: 3   NASDIQSALVPMVIEQTAKGERSFDIYSRLLKERIIFLVGQVEEHMANLIVAQLLFLESE 62

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           +P K+I LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+ GEKG RF 
Sbjct: 63  SPDKDIFLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGEKGKRFC 122

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPN+R+++HQP GGF GQASDI  HAQ+I+ IK +LN++   + G+  E +E+  DRD+ 
Sbjct: 123 LPNSRVMIHQPLGGFQGQASDIAIHAQEILGIKNKLNQMLADHTGQPLEVIERDTDRDNF 182

Query: 190 MSASEACDWGVVDKVLMSR 208
           MSA++A ++G+VD V+  R
Sbjct: 183 MSATQAVEYGLVDAVMTKR 201


>gi|170727453|ref|YP_001761479.1| ATP-dependent Clp protease proteolytic subunit [Shewanella woodyi
           ATCC 51908]
 gi|226706474|sp|B1KLT7|CLPP_SHEWM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|169812800|gb|ACA87384.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shewanella
           woodyi ATCC 51908]
          Length = 203

 Score =  276 bits (707), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 157/197 (79%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E V   LVPMVVEQT +GERSYDIYSRLLKER++F+ GQ+E+HMA LI AQLLFLE+ENP
Sbjct: 6   ESVLNALVPMVVEQTAKGERSYDIYSRLLKERVIFLVGQVEEHMANLIVAQLLFLESENP 65

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            +EISLYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+ G KG R  LP
Sbjct: 66  DQEISLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGAKGKRHCLP 125

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+R+++HQP GGF GQASD   HAQ+I+ IK +LN I  ++ G+  E +E+  DRD+ MS
Sbjct: 126 NSRVMIHQPLGGFQGQASDFAIHAQEILGIKNKLNNILAEHTGQPLEVIERDTDRDNFMS 185

Query: 192 ASEACDWGVVDKVLMSR 208
           A++A ++G+VD V   R
Sbjct: 186 AAQAAEYGLVDSVFEQR 202


>gi|241203529|ref|YP_002974625.1| ATP-dependent Clp protease proteolytic subunit [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240857419|gb|ACS55086.1| Endopeptidase Clp [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 203

 Score =  276 bits (707), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 161/193 (83%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMV+EQ++RGERS+DIYSRLL+ERI+F+ G++ D ++ L+CAQLLFLEAENP+K I+L
Sbjct: 7   LVPMVIEQSSRGERSFDIYSRLLRERIIFLNGEVNDTVSALVCAQLLFLEAENPKKPINL 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G+A+YDTM+FI+ P+ T CMG A SMGS LL AGE G R ALPNA IL+
Sbjct: 67  YINSPGGVVTSGLAMYDTMRFIRAPVHTLCMGTARSMGSFLLMAGEAGGRAALPNASILI 126

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGGF GQASD+  HA++I+K K+R+  +Y ++CG++YE+ E+ +DRD  M+A EA +
Sbjct: 127 HQPSGGFQGQASDMMIHAEEILKTKQRMTRLYAEHCGRSYEDFERGMDRDRFMTAEEALE 186

Query: 198 WGVVDKVLMSRID 210
           WG++D++L  R D
Sbjct: 187 WGLIDRILTVRED 199


>gi|153829246|ref|ZP_01981913.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           cholerae 623-39]
 gi|148875284|gb|EDL73419.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           cholerae 623-39]
          Length = 200

 Score =  276 bits (707), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 158/195 (81%)

Query: 14  VFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQK 73
           +F   VPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP K
Sbjct: 4   IFDAXVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDK 63

Query: 74  EISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNA 133
           +I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G  G R+ LPN+
Sbjct: 64  DIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAPGKRYVLPNS 123

Query: 134 RILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSAS 193
           R+++HQP GGF GQASDI+ HAQ+I+ IK +LN +  ++ G+  E +E+  DRD+ MSA 
Sbjct: 124 RVMIHQPLGGFQGQASDIQIHAQEILTIKNKLNRLLAEHTGQPIEVIERDTDRDNFMSAD 183

Query: 194 EACDWGVVDKVLMSR 208
           +A ++G+VD VL  R
Sbjct: 184 QAVEYGLVDAVLKHR 198


>gi|42520204|ref|NP_966119.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Wolbachia
           endosymbiont of Drosophila melanogaster]
 gi|60389690|sp|Q73I59|CLPP_WOLPM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|42409942|gb|AAS14053.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Wolbachia
           endosymbiont of Drosophila melanogaster]
          Length = 208

 Score =  276 bits (707), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 122/197 (61%), Positives = 167/197 (84%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P+VVEQT+RGER+YDIYSRL+KERI+FVTG IED+MA++I AQLLFLE+ENP K+I
Sbjct: 1   MTLIPIVVEQTSRGERAYDIYSRLVKERIIFVTGPIEDNMASVIVAQLLFLESENPNKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGGVVTAG++IYDTMQ+I P +ST C+GQAASMGSLLL+AG KG R++LP++RI
Sbjct: 61  CMYINSPGGVVTAGLSIYDTMQYINPDVSTLCIGQAASMGSLLLAAGTKGKRYSLPHSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG+ GQA+DIE HA +I+++K++LN+IY K+ G + +++E  ++RD  M   EA
Sbjct: 121 MIHQPSGGYHGQATDIEIHANEILRVKKKLNQIYEKHTGNSLKKIEGMMERDKFMDPEEA 180

Query: 196 CDWGVVDKVLMSRIDIE 212
              G++D+V+  R DIE
Sbjct: 181 RKIGLIDRVIAERTDIE 197


>gi|34581620|ref|ZP_00143100.1| ATP-dependent clp protease proteolytic subunit [Rickettsia sibirica
           246]
 gi|20137864|sp|Q92HM5|CLPP_RICCN RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|28263005|gb|EAA26509.1| ATP-dependent clp protease proteolytic subunit [Rickettsia sibirica
           246]
          Length = 201

 Score =  276 bits (707), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 162/193 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +  VP+V+E T+RGER+YDIYSRLLKERI+FV   +EDHMA LI AQLLFLEAENP+K+I
Sbjct: 1   MSYVPIVIEPTSRGERAYDIYSRLLKERIIFVCSTVEDHMANLIVAQLLFLEAENPKKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGGVVTAG+AIYDTMQ+IKP ++T C+GQA SMGSLLL  GEKGMR++LP++RI
Sbjct: 61  YMYINSPGGVVTAGLAIYDTMQYIKPKVATLCIGQACSMGSLLLCGGEKGMRYSLPHSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG+ GQA+DIE HAQ+ +KIKR LNE+Y K+  +  + +EK+++RD+ MS  EA
Sbjct: 121 MIHQPSGGYKGQATDIEIHAQETLKIKRLLNELYSKHTEQELKHIEKSMERDNFMSPEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G+VD ++ SR
Sbjct: 181 KKFGLVDNIMSSR 193


>gi|226939792|ref|YP_002794865.1| Protease subunit of ATP-dependent Clp protease [Laribacter
           hongkongensis HLHK9]
 gi|254763792|sp|C1D539|CLPP_LARHH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|226714718|gb|ACO73856.1| Protease subunit of ATP-dependent Clp protease [Laribacter
           hongkongensis HLHK9]
          Length = 212

 Score =  276 bits (707), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 123/193 (63%), Positives = 161/193 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVPMVVEQ+ RGER+YDIYSRLLKERIVF+ G + D  A L+ AQ+LFLE+ENP K+I
Sbjct: 17  LGLVPMVVEQSGRGERAYDIYSRLLKERIVFMVGPVTDETANLVVAQMLFLESENPDKDI 76

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAG++IYDTM FIKP +ST C+GQAASMG+ LLSAG KG RFALPN+R+
Sbjct: 77  HLYINSPGGSVTAGLSIYDTMNFIKPSVSTLCIGQAASMGAFLLSAGAKGKRFALPNSRV 136

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASD E HA++I+ +KR+LNE+   +CG+  E++E+  DRD+ M+A++A
Sbjct: 137 MIHQPLGGFQGQASDFEIHAREILTLKRKLNELMAAHCGRPLEDLERDTDRDNFMNAAQA 196

Query: 196 CDWGVVDKVLMSR 208
            ++G++D+VL +R
Sbjct: 197 LEYGLIDQVLENR 209


>gi|312882507|ref|ZP_07742248.1| ATP-dependent Clp protease proteolytic subunit [Vibrio
           caribbenthicus ATCC BAA-2122]
 gi|309369907|gb|EFP97418.1| ATP-dependent Clp protease proteolytic subunit [Vibrio
           caribbenthicus ATCC BAA-2122]
          Length = 208

 Score =  276 bits (707), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 158/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 15  ALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDKDIF 74

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G  G R+ LPN+R++
Sbjct: 75  LYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAPGKRYVLPNSRVM 134

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI+ HAQ+I+ IK++LN +  ++ G+  + +E+  DRD+ MSA +A 
Sbjct: 135 IHQPLGGFQGQASDIQIHAQEILTIKKKLNTLLAEHTGQPLDVIERDTDRDNFMSADQAV 194

Query: 197 DWGVVDKVLMSR 208
           ++G+VD +L  R
Sbjct: 195 EYGLVDSMLTHR 206


>gi|120599414|ref|YP_963988.1| ATP-dependent Clp protease proteolytic subunit [Shewanella sp.
           W3-18-1]
 gi|146292590|ref|YP_001183014.1| ATP-dependent Clp protease proteolytic subunit [Shewanella
           putrefaciens CN-32]
 gi|166214710|sp|A4Y5I2|CLPP_SHEPC RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166214712|sp|A1RL89|CLPP_SHESW RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|120559507|gb|ABM25434.1| ATP-dependent Clp protease proteolytic subunit ClpP [Shewanella sp.
           W3-18-1]
 gi|145564280|gb|ABP75215.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shewanella
           putrefaciens CN-32]
 gi|319425892|gb|ADV53966.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shewanella
           putrefaciens 200]
          Length = 202

 Score =  276 bits (707), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 162/199 (81%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           ++ D+   LVPMV+EQT +GERSYDIYSRLLKERI+F+ GQ+E+HMA LI AQLLFLE+E
Sbjct: 3   NASDIQNALVPMVIEQTAKGERSYDIYSRLLKERIIFLVGQVEEHMANLIVAQLLFLESE 62

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           +P K+I LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+ GEKG RF 
Sbjct: 63  SPDKDIFLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGEKGKRFC 122

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPN+R+++HQP GGF GQASDI  HAQ+I+ IK +LN +  ++ G+  E +E+  DRD+ 
Sbjct: 123 LPNSRVMIHQPLGGFQGQASDIAIHAQEILGIKHKLNLMLAEHTGQPLEVIERDTDRDNF 182

Query: 190 MSASEACDWGVVDKVLMSR 208
           MSA++A ++G+VD V+  R
Sbjct: 183 MSATQAVEYGLVDSVMTKR 201


>gi|218672149|ref|ZP_03521818.1| ATP-dependent Clp protease proteolytic subunit [Rhizobium etli
           GR56]
          Length = 203

 Score =  276 bits (706), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 120/195 (61%), Positives = 162/195 (83%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMV+EQ++RGERS+DIYSRLL+ERI+F+ G++ D ++ L+CAQLLFLEAENP+K I+L
Sbjct: 7   LVPMVIEQSSRGERSFDIYSRLLRERIIFLNGEVNDTVSALVCAQLLFLEAENPKKPINL 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G+A+YDTM+FI+ P+ T CMG A SMGS LL AGE G R ALPNA IL+
Sbjct: 67  YINSPGGVVTSGLAMYDTMRFIRAPVHTLCMGTARSMGSFLLMAGEAGERAALPNASILI 126

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGGF GQASD+  HA++I+K K+R+  +Y ++CG++YE+ E+ +DRD  M+A EA +
Sbjct: 127 HQPSGGFQGQASDMLIHAEEILKTKQRMTRLYAEHCGRSYEDFERGMDRDRFMTAEEALE 186

Query: 198 WGVVDKVLMSRIDIE 212
           WG++D++L  R D +
Sbjct: 187 WGLIDRILKVREDTD 201


>gi|332038369|gb|EGI74814.1| ATP-dependent Clp protease proteolytic subunit [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 205

 Score =  276 bits (706), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 127/196 (64%), Positives = 158/196 (80%)

Query: 13  DVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQ 72
           D    LVPMVVEQT +GERSYDIYSRLLKERI+F+TGQ+ED+MA LI AQ+LFLE+ENP 
Sbjct: 7   DPLNALVPMVVEQTPKGERSYDIYSRLLKERIIFLTGQVEDNMANLILAQMLFLESENPD 66

Query: 73  KEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPN 132
           K+I LYINSPGG VTAGMAIYDTM FIKP +ST C+GQAASMG+ LL+AG KG RF LPN
Sbjct: 67  KDIFLYINSPGGSVTAGMAIYDTMNFIKPDVSTICVGQAASMGAFLLTAGAKGKRFCLPN 126

Query: 133 ARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSA 192
           +R+++HQP GGF GQASD E HA++I+ IK +LN +  ++ G+  + + K  DRD+ MSA
Sbjct: 127 SRVMIHQPLGGFQGQASDFEIHAKEILSIKDKLNRLMAEHTGQPLDIISKDTDRDNFMSA 186

Query: 193 SEACDWGVVDKVLMSR 208
           S+A D+G+VD V  +R
Sbjct: 187 SQAVDYGLVDSVFTNR 202


>gi|237807855|ref|YP_002892295.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Tolumonas
           auensis DSM 9187]
 gi|237500116|gb|ACQ92709.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Tolumonas
           auensis DSM 9187]
          Length = 207

 Score =  276 bits (706), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 126/191 (65%), Positives = 157/191 (82%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+VVEQT RGERSYDIYSRLLKER++F+TGQ+ED MA LI AQLLFLE+ENP K+I +
Sbjct: 16  LVPIVVEQTARGERSYDIYSRLLKERVIFLTGQVEDQMANLIVAQLLFLESENPDKDIYI 75

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGMAIYDT++FIKP +ST CMGQA SMG+ LLSAG KG RF LP+AR+++
Sbjct: 76  YINSPGGSVTAGMAIYDTLKFIKPDVSTVCMGQACSMGAFLLSAGTKGKRFCLPSARVMI 135

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQASDI+ HA +I+KIK RLN +  ++ G+  E +E+  DRD+ MSA +A +
Sbjct: 136 HQPLGGFQGQASDIQIHAMEILKIKERLNNLLAEHTGQPLERIERDTDRDNFMSADQAVE 195

Query: 198 WGVVDKVLMSR 208
           +G+VD +L  R
Sbjct: 196 YGLVDAILKKR 206


>gi|134094958|ref|YP_001100033.1| ATP-dependent Clp protease proteolytic subunit [Herminiimonas
           arsenicoxydans]
 gi|133738861|emb|CAL61908.1| ATP-dependent Clp protease proteolytic subunit (Endopeptidase Clp)
           [Herminiimonas arsenicoxydans]
          Length = 209

 Score =  276 bits (706), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 124/194 (63%), Positives = 157/194 (80%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
            LG+VPMV+EQ+ RGER+YDIYSRLLKER++F+ G + DH A LI AQLLFLE+ENP K+
Sbjct: 15  MLGMVPMVIEQSGRGERAYDIYSRLLKERVIFLVGPVNDHAANLIVAQLLFLESENPDKD 74

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           ISLYINSPGG V+AGMAI+DTMQFIKP +ST C G AASMG+ LL+AGEKG RF+LPN+R
Sbjct: 75  ISLYINSPGGSVSAGMAIFDTMQFIKPNVSTLCTGLAASMGAFLLAAGEKGKRFSLPNSR 134

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           I++HQP GG  GQASDIE  A++I+ ++ RLN+I     GKT EE+ +  DRD+ MSA  
Sbjct: 135 IMIHQPLGGAQGQASDIEIQAREILYLRERLNQILADRTGKTLEEISRDTDRDNFMSADA 194

Query: 195 ACDWGVVDKVLMSR 208
           A ++G++DKVL +R
Sbjct: 195 AVEYGMIDKVLTTR 208


>gi|116062109|dbj|BAF34687.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           protease [Aeromonas veronii]
          Length = 207

 Score =  276 bits (706), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 126/192 (65%), Positives = 155/192 (80%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            L+PMVVEQT +GERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP ++IS
Sbjct: 15  ALIPMVVEQTAKGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDQDIS 74

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           +YINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G KG RF LPNAR++
Sbjct: 75  IYINSPGGAVTAGMSIYDTMQFIKPDVSTVCMGQACSMGAFLLAGGAKGKRFCLPNARVM 134

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI+ HAQ+I+KIK  LNE    + G+    +E+  DRD+ MSA +A 
Sbjct: 135 IHQPLGGFQGQASDIQIHAQEILKIKNTLNERLAFHTGQDMATIERDTDRDNFMSAEQAV 194

Query: 197 DWGVVDKVLMSR 208
            +G+VD VL  R
Sbjct: 195 AYGLVDGVLSQR 206


>gi|260773194|ref|ZP_05882110.1| ATP-dependent Clp protease proteolytic subunit [Vibrio
           metschnikovii CIP 69.14]
 gi|260612333|gb|EEX37536.1| ATP-dependent Clp protease proteolytic subunit [Vibrio
           metschnikovii CIP 69.14]
          Length = 208

 Score =  276 bits (706), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 122/192 (63%), Positives = 157/192 (81%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT+RGERSYDIYSRLLK+R++F+TGQ+EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 15  ALVPMVVEQTSRGERSYDIYSRLLKDRVIFLTGQVEDHMANLVVAQLLFLESENPDKDIF 74

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQA SMG+ LL+ G  G R+ LPN+R++
Sbjct: 75  LYINSPGGSVTAGMSIYDTMQFIKPNVSTLCVGQACSMGAFLLAGGAPGKRYVLPNSRVM 134

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI+ HAQ+I+ IK +LN +  ++ G+  + +E+  DRD+ MSA +A 
Sbjct: 135 IHQPLGGFQGQASDIQIHAQEILSIKNKLNTLLAEHTGQPLDVIERDTDRDNFMSAQQAV 194

Query: 197 DWGVVDKVLMSR 208
           D+G+VD +L  R
Sbjct: 195 DYGIVDAILTHR 206


>gi|58696873|ref|ZP_00372388.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Wolbachia
           endosymbiont of Drosophila simulans]
 gi|58699505|ref|ZP_00374232.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|225630255|ref|YP_002727046.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Wolbachia sp.
           wRi]
 gi|254763810|sp|C0R2W3|CLPP_WOLWR RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|58533978|gb|EAL58250.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|58536916|gb|EAL60096.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Wolbachia
           endosymbiont of Drosophila simulans]
 gi|225592236|gb|ACN95255.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Wolbachia sp.
           wRi]
          Length = 208

 Score =  276 bits (706), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 122/197 (61%), Positives = 167/197 (84%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P+VVEQT+RGER+YDIYSRL+KERI+FVTG IED+MA++I AQLLFLE+ENP K+I
Sbjct: 1   MTLIPIVVEQTSRGERAYDIYSRLVKERIIFVTGPIEDNMASVIVAQLLFLESENPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGGVVTAG++IYDTMQ+I P +ST C+GQAASMGSLLL+AG KG R++LP++RI
Sbjct: 61  CMYINSPGGVVTAGLSIYDTMQYINPDVSTLCIGQAASMGSLLLAAGTKGKRYSLPHSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG+ GQA+DIE HA +I+++K++LN+IY K+ G + +++E  ++RD  M   EA
Sbjct: 121 MIHQPSGGYHGQATDIEIHANEILRVKKKLNQIYEKHTGNSLKKIEGMMERDKFMDPEEA 180

Query: 196 CDWGVVDKVLMSRIDIE 212
              G++D+V+  R DIE
Sbjct: 181 RKIGLIDRVIAERTDIE 197


>gi|229591362|ref|YP_002873481.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           fluorescens SBW25]
 gi|259585962|sp|C3JYK0|CLPP_PSEFS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|229363228|emb|CAY50311.1| ATP-dependent Clp protease proteolytic subunit ClpP [Pseudomonas
           fluorescens SBW25]
          Length = 211

 Score =  276 bits (705), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 126/192 (65%), Positives = 158/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMVVEQ+ RGER+YDIYSRLLKER++F+ G +ED+MA LICAQLLFLEAENP K+I 
Sbjct: 18  GLVPMVVEQSARGERAYDIYSRLLKERVIFLVGPVEDYMANLICAQLLFLEAENPDKDIH 77

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQA SMG+ LL+AG +G RF LPN+R++
Sbjct: 78  LYINSPGGSVTAGMSIYDTMQFIKPNVSTTCIGQACSMGAFLLTAGAEGKRFCLPNSRVM 137

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDIE HA++I+ I+ RLN +  K+ G T EE+E+  +RD+ MSA  A 
Sbjct: 138 IHQPLGGFQGQASDIEIHAKEILFIRERLNTLMAKHSGHTLEEIERDTNRDNFMSAEAAR 197

Query: 197 DWGVVDKVLMSR 208
           D+G++D V+  R
Sbjct: 198 DYGLIDAVIDKR 209


>gi|152980689|ref|YP_001353221.1| protease subunit of ATP-dependent Clp proteases [Janthinobacterium
           sp. Marseille]
 gi|226706516|sp|A6SY74|CLPP_JANMA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|151280766|gb|ABR89176.1| protease subunit of ATP-dependent Clp proteases [Janthinobacterium
           sp. Marseille]
          Length = 210

 Score =  276 bits (705), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 126/194 (64%), Positives = 156/194 (80%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
            LG+VPMV+EQ+ RGER+YDIYSRLLKERI+F+ G + D MA LI AQLLFLE+ENP K+
Sbjct: 16  MLGMVPMVIEQSGRGERAYDIYSRLLKERIIFLVGPVNDQMANLIVAQLLFLESENPDKD 75

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           ISLYINSPGG V+AGMAIYDTMQFIKP +ST C G AASMG+ LL+AGEKG RF+LPN+R
Sbjct: 76  ISLYINSPGGSVSAGMAIYDTMQFIKPNVSTLCTGLAASMGAFLLAAGEKGKRFSLPNSR 135

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           I++HQP GG  GQASDIE  A++I+ ++ RLN I  +  GK+ EE+ K  DRD+ MSA  
Sbjct: 136 IMIHQPLGGAQGQASDIEIQAREILYLRERLNAILAERTGKSVEEIAKDTDRDNFMSADA 195

Query: 195 ACDWGVVDKVLMSR 208
           A  +G++DKVL +R
Sbjct: 196 AVTYGMIDKVLATR 209


>gi|71907348|ref|YP_284935.1| ATP-dependent Clp protease proteolytic subunit ClpP [Dechloromonas
           aromatica RCB]
 gi|110816458|sp|Q47FB6|CLPP_DECAR RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|71846969|gb|AAZ46465.1| ATP-dependent Clp protease proteolytic subunit ClpP [Dechloromonas
           aromatica RCB]
          Length = 209

 Score =  276 bits (705), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 125/193 (64%), Positives = 157/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVPMVVEQ+ RGER+YDIYSRLLKER++F+ G + D  A L+ AQLLFLEAENP K+I
Sbjct: 14  LGLVPMVVEQSGRGERAYDIYSRLLKERVIFLVGPVNDVTANLVVAQLLFLEAENPDKDI 73

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
             YINSPGG VTAGM+IYDTMQFIKP +ST C+GQAASMG+ LL+AG KG RFALPN+R+
Sbjct: 74  YFYINSPGGSVTAGMSIYDTMQFIKPDVSTLCIGQAASMGAFLLNAGAKGKRFALPNSRV 133

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI  HA++I+ I+ RLN I  ++ G+  E +EK  DRD+ +SA+EA
Sbjct: 134 MIHQPLGGFQGQASDIAIHAKEILSIRDRLNRIMAEHSGQPLERIEKDTDRDNFLSAAEA 193

Query: 196 CDWGVVDKVLMSR 208
            ++G++DKVL  R
Sbjct: 194 AEYGLIDKVLTRR 206


>gi|117620419|ref|YP_856542.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
 gi|117561826|gb|ABK38774.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
          Length = 200

 Score =  276 bits (705), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 126/191 (65%), Positives = 155/191 (81%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           L+PMVVEQT +GERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP ++IS+
Sbjct: 9   LIPMVVEQTAKGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDQDISI 68

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G KG RF LPNAR+++
Sbjct: 69  YINSPGGAVTAGMSIYDTMQFIKPDVSTVCMGQACSMGAFLLAGGAKGKRFCLPNARVMI 128

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQASDI+ HAQ+I+KIK  LNE    + G+    +E+  DRD+ MSA +A  
Sbjct: 129 HQPLGGFQGQASDIQIHAQEILKIKNTLNERLAFHTGQDMATIERDTDRDNFMSAEQAVA 188

Query: 198 WGVVDKVLMSR 208
           +G+VD VL  R
Sbjct: 189 YGLVDGVLSRR 199


>gi|77459919|ref|YP_349426.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           fluorescens Pf0-1]
 gi|92087005|sp|Q3K9W9|CLPP_PSEPF RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|77383922|gb|ABA75435.1| ATP-dependent Clp protease proteolytic subunit ClpP [Pseudomonas
           fluorescens Pf0-1]
          Length = 211

 Score =  276 bits (705), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 159/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMVVEQ+ RGER+YDIYSRLLKER++F+ G +ED+MA LICAQLLFLEAENP K+I 
Sbjct: 18  GLVPMVVEQSARGERAYDIYSRLLKERVIFLVGPVEDYMANLICAQLLFLEAENPDKDIH 77

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQA SMG+ LL+AG  G RF LPN+R++
Sbjct: 78  LYINSPGGSVTAGMSIYDTMQFIKPNVSTTCIGQACSMGAFLLTAGAPGKRFCLPNSRVM 137

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDIE HA++I+ I+ RLN +  K+ G+T EE+E+  +RD+ MSA  A 
Sbjct: 138 IHQPLGGFQGQASDIEIHAKEILFIRERLNTLMAKHSGRTLEEIERDTNRDNFMSAEAAK 197

Query: 197 DWGVVDKVLMSR 208
           ++G++D+V+  R
Sbjct: 198 EYGLIDEVINQR 209


>gi|6685315|sp|Q9X6W8|CLPP_AZOBR RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|5002357|gb|AAD37435.1|AF150957_2 heat-shock protein ClpP [Azospirillum brasilense]
          Length = 210

 Score =  276 bits (705), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 163/199 (81%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           D E     LVPMV+EQTNRGER YDIYSRLLKERI+F+ G + D +A+LIC+QLLFLE+E
Sbjct: 3   DFEPKMNALVPMVIEQTNRGERGYDIYSRLLKERIIFLIGGVNDAVASLICSQLLFLESE 62

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP K+I+LYINSPGG V+AG+AIYDTMQ+I+P +ST CMGQAASMGSLLL+AG  G RF+
Sbjct: 63  NPSKDIALYINSPGGYVSAGLAIYDTMQYIRPQVSTVCMGQAASMGSLLLAAGAPGKRFS 122

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPN+RI++HQPSGG  GQASDIE  AQ+I+K++ RLN+IYVK+ G++ + +E  ++RD  
Sbjct: 123 LPNSRIMIHQPSGGAQGQASDIEIQAQEILKLRSRLNDIYVKHTGQSLDTIEAXMERDKF 182

Query: 190 MSASEACDWGVVDKVLMSR 208
           MS  EA  +G++D+V+  R
Sbjct: 183 MSPEEAKAFGLIDEVVEKR 201


>gi|307293097|ref|ZP_07572943.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Sphingobium
           chlorophenolicum L-1]
 gi|306881163|gb|EFN12379.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Sphingobium
           chlorophenolicum L-1]
          Length = 211

 Score =  275 bits (704), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 162/196 (82%)

Query: 13  DVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQ 72
           D    LVP+V+EQ+NRGERS+DIYSRLL+ERI+FVTGQ+EDHMA+LI AQLLFLE+ENP+
Sbjct: 7   DPMAALVPIVIEQSNRGERSFDIYSRLLRERIIFVTGQVEDHMASLIVAQLLFLESENPK 66

Query: 73  KEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPN 132
           K+I +YINSPGGVVT+GMAI+DTM++I+P + T C+GQAASMGS LL+AGE G R AL N
Sbjct: 67  KDIWMYINSPGGVVTSGMAIHDTMKYIRPQVGTVCIGQAASMGSFLLAAGEPGKRIALSN 126

Query: 133 ARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSA 192
           ARI++HQPSGG  G ASDIE  A++I++I+ RLN +YV+  G+T EEVE+ +DRD  + A
Sbjct: 127 ARIMVHQPSGGAQGMASDIEIQAKEILRIRSRLNNLYVQYTGRTLEEVERAMDRDTFLEA 186

Query: 193 SEACDWGVVDKVLMSR 208
            EA  +G+VD+V   R
Sbjct: 187 EEAKAFGLVDEVFDRR 202


>gi|315127189|ref|YP_004069192.1| ATP-dependent Clp protease proteolytic subunit [Pseudoalteromonas
           sp. SM9913]
 gi|315015703|gb|ADT69041.1| ATP-dependent Clp protease proteolytic subunit [Pseudoalteromonas
           sp. SM9913]
          Length = 205

 Score =  275 bits (704), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 158/196 (80%)

Query: 13  DVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQ 72
           D    LVPMVVEQT +GERS+DIYSRLLKERI+F+TGQ+ED+MA LI AQ+LFLE+ENP+
Sbjct: 7   DPLNALVPMVVEQTAKGERSFDIYSRLLKERIIFLTGQVEDNMANLILAQMLFLESENPE 66

Query: 73  KEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPN 132
           K+I LYINSPGG VTAGMAIYDTM FIKP +ST C+GQAASMG+ LLS G KG RF LPN
Sbjct: 67  KDIFLYINSPGGSVTAGMAIYDTMNFIKPDVSTICVGQAASMGAFLLSGGAKGKRFCLPN 126

Query: 133 ARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSA 192
           +R+++HQP GGF GQASD E HA++I+ IK +LN +  ++ G+  + V +  DRD+ MSA
Sbjct: 127 SRVMIHQPLGGFQGQASDFEIHAKEILSIKDKLNRLMAEHTGQPLDVVSRDTDRDNFMSA 186

Query: 193 SEACDWGVVDKVLMSR 208
           S+A D+G+VD V  +R
Sbjct: 187 SQAVDYGIVDSVFTNR 202


>gi|70731346|ref|YP_261087.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           fluorescens Pf-5]
 gi|110816462|sp|Q4K9J6|CLPP_PSEF5 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|68345645|gb|AAY93251.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Pseudomonas
           fluorescens Pf-5]
          Length = 211

 Score =  275 bits (704), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 159/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMVVEQ+ RGER+YDIYSRLLKER++F+ G +ED+MA LICAQLLFLEAENP K+I 
Sbjct: 18  GLVPMVVEQSARGERAYDIYSRLLKERVIFLVGPVEDYMANLICAQLLFLEAENPDKDIH 77

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQA SMG+ LL+AG  G RF LPN+R++
Sbjct: 78  LYINSPGGSVTAGMSIYDTMQFIKPNVSTTCIGQACSMGAFLLTAGAPGKRFCLPNSRVM 137

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDIE HA++I+ I+ RLN +  K+ G+T EE+E+  +RD+ MSA  A 
Sbjct: 138 IHQPLGGFQGQASDIEIHAKEILFIRERLNTLMAKHSGRTLEEIERDTNRDNFMSAEAAR 197

Query: 197 DWGVVDKVLMSR 208
           ++G++D+V+  R
Sbjct: 198 EYGLIDEVINQR 209


>gi|285017388|ref|YP_003375099.1| ATP-dependent clp protease proteolytic subunit protein [Xanthomonas
           albilineans GPE PC73]
 gi|283472606|emb|CBA15111.1| probable atp-dependent clp protease proteolytic subunit protein
           [Xanthomonas albilineans]
          Length = 208

 Score =  275 bits (704), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 164/195 (84%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           L LVPMVVEQT+RGER+YDIYSRLLKER++F+ G I+DHMA ++ AQLLFLEA+NP+K+I
Sbjct: 8   LNLVPMVVEQTSRGERAYDIYSRLLKERLIFLVGPIDDHMANVVVAQLLFLEADNPEKDI 67

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGGVVTAGMAIYDTMQ+IKP +ST C+GQAASMG+LLL++G  G R+ALPN+R+
Sbjct: 68  SLYINSPGGVVTAGMAIYDTMQYIKPDVSTICVGQAASMGALLLASGAAGKRYALPNSRV 127

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI+ HA++I+ ++ RLNE+  K+ G++ E + +  +RD+  SA +A
Sbjct: 128 MIHQPLGGFQGQATDIDIHAREILTLRARLNEVLAKHTGQSLETIARDTERDNFKSAIDA 187

Query: 196 CDWGVVDKVLMSRID 210
             +G+VD+VL  R D
Sbjct: 188 QAYGLVDQVLERRPD 202


>gi|218461999|ref|ZP_03502090.1| ATP-dependent Clp protease proteolytic subunit [Rhizobium etli Kim
           5]
          Length = 203

 Score =  275 bits (704), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 160/193 (82%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMV+EQ++RGERS+DIYSRLL+ERI+F+ G++ D ++ L+CAQLLFLEAENP K I+L
Sbjct: 7   LVPMVIEQSSRGERSFDIYSRLLRERIIFLNGEVNDTVSALVCAQLLFLEAENPHKPINL 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G+A+YDTM+FI+ P+ T CMG A SMGS LL AGE G R ALPNA IL+
Sbjct: 67  YINSPGGVVTSGLAMYDTMRFIRAPVHTLCMGTARSMGSFLLMAGEPGGRAALPNASILI 126

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGGF GQASD+  HA++I+K K+R+  +Y ++CG++YE+ E+ +DRD  M+A EA +
Sbjct: 127 HQPSGGFQGQASDMLIHAEEILKTKQRMTRLYAEHCGRSYEDFERGMDRDRFMTAEEALE 186

Query: 198 WGVVDKVLMSRID 210
           WG++D++L  R D
Sbjct: 187 WGLIDRILKVRED 199


>gi|262374981|ref|ZP_06068215.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Acinetobacter
           lwoffii SH145]
 gi|262309994|gb|EEY91123.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Acinetobacter
           lwoffii SH145]
          Length = 201

 Score =  275 bits (704), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 161/192 (83%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQ++RGERS+DIYSRLL+ER++F+TG++ED+MA LI AQ+LFLEAENP K+I 
Sbjct: 9   ALVPMVVEQSSRGERSFDIYSRLLRERVIFMTGEVEDNMANLIVAQMLFLEAENPDKDIH 68

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGMAIYDTMQFIKP + T+CMGQAASMG+ LL+AG KG R+ L NAR++
Sbjct: 69  LYINSPGGSVTAGMAIYDTMQFIKPDVVTYCMGQAASMGAFLLNAGTKGKRYCLENARVM 128

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDIE HA++I+ IK RLN +  ++ G+ YE+V +  DRD+ M+A +A 
Sbjct: 129 IHQPLGGFRGQASDIEIHAREILFIKERLNRLMAEHSGQDYEKVARDTDRDNFMTAQQAK 188

Query: 197 DWGVVDKVLMSR 208
           ++G+VD+VL  R
Sbjct: 189 EYGLVDEVLTKR 200


>gi|213521159|gb|ACJ50516.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           fluorescens]
          Length = 211

 Score =  275 bits (704), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 159/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMVVEQ+ RGER+YDIYSRLLKER++F+ G +ED+MA LICAQLLFLEAENP K+I 
Sbjct: 18  GLVPMVVEQSARGERAYDIYSRLLKERVIFLVGPVEDYMANLICAQLLFLEAENPDKDIH 77

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQA SMG+ LL+AG +G RF LPN+R++
Sbjct: 78  LYINSPGGSVTAGMSIYDTMQFIKPNVSTTCIGQACSMGAFLLTAGAEGKRFCLPNSRVM 137

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDIE HA++I+ I+ RLN +  K+ G+T EE+E+  +RD+ MSA  A 
Sbjct: 138 IHQPLGGFQGQASDIEIHAKEILFIRERLNTLMAKHSGRTLEEIERDTNRDNFMSAEAAK 197

Query: 197 DWGVVDKVLMSR 208
           ++G++D V+  R
Sbjct: 198 EYGLIDAVIDKR 209


>gi|237747781|ref|ZP_04578261.1| ATP-dependent Clp protease proteolytic subunit [Oxalobacter
           formigenes OXCC13]
 gi|229379143|gb|EEO29234.1| ATP-dependent Clp protease proteolytic subunit [Oxalobacter
           formigenes OXCC13]
          Length = 207

 Score =  275 bits (704), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 126/195 (64%), Positives = 159/195 (81%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
            LG++PMV+EQ+ RGER+YDIYSRLLKERIVF+ G + D  A LI AQLLFLE+ENP K+
Sbjct: 13  MLGMIPMVIEQSGRGERAYDIYSRLLKERIVFLVGPVMDQNANLIVAQLLFLESENPDKD 72

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           ISLYINSPGG V+AGMAIYDTMQFIKP +ST C G AASMG+ LL+AGEKG RF+LPN+R
Sbjct: 73  ISLYINSPGGSVSAGMAIYDTMQFIKPQVSTLCTGLAASMGAFLLAAGEKGKRFSLPNSR 132

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           I++HQPSGG  GQA+DIE HA++I+ ++ RLN I   N GK+ E+V +  +RD+ MSA+E
Sbjct: 133 IMIHQPSGGAQGQATDIEIHAREILYLRERLNGILADNTGKSIEQVARDTERDNFMSANE 192

Query: 195 ACDWGVVDKVLMSRI 209
           A D+G++D VL  R+
Sbjct: 193 AKDYGLIDDVLSKRM 207


>gi|87121308|ref|ZP_01077198.1| putative ATP-dependent Clp protease, proteolytic subunit
           [Marinomonas sp. MED121]
 gi|86163465|gb|EAQ64740.1| putative ATP-dependent Clp protease, proteolytic subunit
           [Marinomonas sp. MED121]
          Length = 210

 Score =  275 bits (704), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 124/192 (64%), Positives = 157/192 (81%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMV+EQT RGERS+DIYSRLLKER++F+ GQ+EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 17  GLVPMVIEQTARGERSFDIYSRLLKERVIFLVGQVEDHMANLVVAQLLFLESENPDKDIH 76

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQAASMG+LLL+AG  G R+ LPN+R++
Sbjct: 77  LYINSPGGSVTAGMSIYDTMQFIKPDVSTMCIGQAASMGALLLTAGAAGKRYCLPNSRVM 136

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG+ GQASDIE H ++I+ IK RLNEI   + GK  EEV +  DRD+ M  + A 
Sbjct: 137 IHQPLGGYQGQASDIEIHTREILSIKHRLNEIISFHTGKPIEEVAEDTDRDNFMDPTAAK 196

Query: 197 DWGVVDKVLMSR 208
           ++G++D +L+ R
Sbjct: 197 EYGLIDDILLKR 208


>gi|260768947|ref|ZP_05877881.1| ATP-dependent Clp protease proteolytic subunit [Vibrio furnissii
           CIP 102972]
 gi|260616977|gb|EEX42162.1| ATP-dependent Clp protease proteolytic subunit [Vibrio furnissii
           CIP 102972]
 gi|315180643|gb|ADT87557.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           furnissii NCTC 11218]
          Length = 208

 Score =  275 bits (704), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 156/192 (81%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT+RGERSYDIYSRLLK+R++F+TGQ+EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 15  ALVPMVVEQTSRGERSYDIYSRLLKDRVIFLTGQVEDHMANLVVAQLLFLESENPDKDIF 74

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQA SMG+ LL+ G  G R+ LPN+R++
Sbjct: 75  LYINSPGGSVTAGMSIYDTMQFIKPNVSTLCIGQACSMGAFLLAGGAPGKRYVLPNSRVM 134

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI+ HAQ+I+ IK +LN +   + G+  E +E+  DRD+ MSA +A 
Sbjct: 135 IHQPLGGFQGQASDIQIHAQEILTIKNKLNRLLADHTGQPLEVIERDTDRDNFMSAQQAV 194

Query: 197 DWGVVDKVLMSR 208
           D+G+VD +L  R
Sbjct: 195 DYGLVDALLTHR 206


>gi|288958758|ref|YP_003449099.1| ATP-dependent Clp protease, protease subunit [Azospirillum sp.
           B510]
 gi|288911066|dbj|BAI72555.1| ATP-dependent Clp protease, protease subunit [Azospirillum sp.
           B510]
          Length = 208

 Score =  275 bits (704), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 163/199 (81%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           D E     LVPMV+EQTNRGER+YDIYSRLLKERI+F+ G + D +A+LIC+QLLFLE+E
Sbjct: 3   DFEPKMNALVPMVIEQTNRGERAYDIYSRLLKERIIFLIGGVNDAVASLICSQLLFLESE 62

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP K+I+LYINSPGG V+AG+AIYDTMQ+I+P +ST CMGQAASMGSLLL+AG  G RF+
Sbjct: 63  NPNKDIALYINSPGGYVSAGLAIYDTMQYIRPQVSTVCMGQAASMGSLLLAAGAPGKRFS 122

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPN+RI++HQPSGG  GQASDIE  AQ+I+K++ RLN+IYVK+ G+  + +E  ++RD  
Sbjct: 123 LPNSRIMIHQPSGGAQGQASDIEIQAQEILKLRSRLNDIYVKHTGQDLDTIETAMERDKF 182

Query: 190 MSASEACDWGVVDKVLMSR 208
           MS  EA  +G++D+V+  R
Sbjct: 183 MSPEEAKAFGLIDEVVEKR 201


>gi|162148815|ref|YP_001603276.1| ATP-dependent Clp protease proteolytic subunit [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209545437|ref|YP_002277666.1| ATP-dependent Clp protease proteolytic subunit [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161787392|emb|CAP56987.1| ATP-dependent Clp protease proteolytic subunit 1 (Endopeptidase Clp
           1) [Gluconacetobacter diazotrophicus PAl 5]
 gi|209533114|gb|ACI53051.1| Endopeptidase Clp [Gluconacetobacter diazotrophicus PAl 5]
          Length = 212

 Score =  275 bits (703), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 126/198 (63%), Positives = 166/198 (83%), Gaps = 1/198 (0%)

Query: 9   KDSEDVFL-GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           +D  ++F   LVPMVVEQT+RGER++DIYSRLL+ERI+F+TG + D +A ++ AQLL+LE
Sbjct: 4   RDPVEIFSSALVPMVVEQTSRGERAFDIYSRLLQERIIFLTGPVYDQVAAVVSAQLLYLE 63

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           + NP KEIS YINSPGGVV+AG+AIYDTMQ+I+ P+ST C+GQAASMGSLLL+ GEKG R
Sbjct: 64  SVNPTKEISFYINSPGGVVSAGLAIYDTMQYIRSPVSTVCIGQAASMGSLLLAGGEKGRR 123

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FALPNAR+++HQPSGG  GQASDIE  A++I+ I++RLNEIY  + G+T E++E+ L+RD
Sbjct: 124 FALPNARVMVHQPSGGAQGQASDIEIQAREILTIRQRLNEIYETHTGQTLEDIERRLERD 183

Query: 188 HIMSASEACDWGVVDKVL 205
             MSA EA  +G+VD+V+
Sbjct: 184 SYMSAEEAQAFGIVDEVV 201


>gi|78223080|ref|YP_384827.1| ATP-dependent Clp protease proteolytic subunit [Geobacter
           metallireducens GS-15]
 gi|90101408|sp|Q39UH2|CLPP_GEOMG RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|78194335|gb|ABB32102.1| ATP-dependent Clp protease proteolytic subunit ClpP [Geobacter
           metallireducens GS-15]
          Length = 199

 Score =  275 bits (703), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 159/191 (83%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+VVEQT RGERSYDIYSRLLK+RI+F+ G I+DH+A L+ AQLLFLEAE+P K+I L
Sbjct: 2   LVPIVVEQTGRGERSYDIYSRLLKDRIIFLGGPIDDHVANLVIAQLLFLEAEDPDKDIHL 61

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVTAGMAIYDTMQ+IK P+ST C+GQAASMG+LLLS GEKG RF+L ++RI++
Sbjct: 62  YINSPGGVVTAGMAIYDTMQYIKAPVSTICVGQAASMGALLLSGGEKGKRFSLTHSRIMI 121

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQA+DI  HAQ+I+K+K+RLNEI  +N G+  E+VE   +RD+ MS  EA  
Sbjct: 122 HQPLGGFQGQATDIHIHAQEILKMKKRLNEIIAENSGQALEKVEADTERDYFMSGEEAKS 181

Query: 198 WGVVDKVLMSR 208
           +G++D ++  +
Sbjct: 182 YGIIDAIIARK 192


>gi|21241838|ref|NP_641420.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas
           axonopodis pv. citri str. 306]
 gi|58580656|ref|YP_199672.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas oryzae
           pv. oryzae KACC10331]
 gi|78046637|ref|YP_362812.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
 gi|84622589|ref|YP_449961.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas oryzae
           pv. oryzae MAFF 311018]
 gi|166710928|ref|ZP_02242135.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas oryzae
           pv. oryzicola BLS256]
 gi|188578371|ref|YP_001915300.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas oryzae
           pv. oryzae PXO99A]
 gi|188992776|ref|YP_001904786.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas
           campestris pv. campestris str. B100]
 gi|289664185|ref|ZP_06485766.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas
           campestris pv. vasculorum NCPPB702]
 gi|289668776|ref|ZP_06489851.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas
           campestris pv. musacearum NCPPB4381]
 gi|294666562|ref|ZP_06731803.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
 gi|325914926|ref|ZP_08177258.1| ATP-dependent Clp protease proteolytic subunit ClpP [Xanthomonas
           vesicatoria ATCC 35937]
 gi|325927441|ref|ZP_08188688.1| ATP-dependent Clp protease proteolytic subunit ClpP [Xanthomonas
           perforans 91-118]
 gi|25008307|sp|Q8PNI5|CLPP_XANAC RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|67460159|sp|Q5H434|CLPP_XANOR RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|90183187|sp|Q3BWQ1|CLPP_XANC5 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|110816521|sp|Q2P6Z0|CLPP_XANOM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|226706557|sp|B0RTF7|CLPP_XANCB RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|226706558|sp|B2SMI3|CLPP_XANOP RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|21107218|gb|AAM35956.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas
           axonopodis pv. citri str. 306]
 gi|58425250|gb|AAW74287.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas oryzae
           pv. oryzae KACC10331]
 gi|78035067|emb|CAJ22712.1| ATP-dependent Clp protease [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|84366529|dbj|BAE67687.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas oryzae
           pv. oryzae MAFF 311018]
 gi|167734536|emb|CAP52746.1| ATP-dependent Clp protease [Xanthomonas campestris pv. campestris]
 gi|188522823|gb|ACD60768.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Xanthomonas
           oryzae pv. oryzae PXO99A]
 gi|292603706|gb|EFF47116.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
 gi|325538819|gb|EGD10483.1| ATP-dependent Clp protease proteolytic subunit ClpP [Xanthomonas
           vesicatoria ATCC 35937]
 gi|325542191|gb|EGD13686.1| ATP-dependent Clp protease proteolytic subunit ClpP [Xanthomonas
           perforans 91-118]
          Length = 208

 Score =  275 bits (703), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 123/193 (63%), Positives = 163/193 (84%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           L LVPMVVEQT+RGER+YDIYSRLLKER++F+ G I+DHMA +I AQLLFLEA+NP+K+I
Sbjct: 8   LNLVPMVVEQTSRGERAYDIYSRLLKERLIFLVGPIDDHMANVIVAQLLFLEADNPEKDI 67

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S+YINSPGGVVTAGMAIYDTMQ+IKP +ST C+GQAASMG+LLL++G  G R+ALPN+R+
Sbjct: 68  SIYINSPGGVVTAGMAIYDTMQYIKPDVSTICVGQAASMGALLLASGAAGKRYALPNSRV 127

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI+ HA++I+ ++ RLNEI  K+ G++ E + +  +RD+  SA +A
Sbjct: 128 MIHQPLGGFQGQATDIDIHAREILTLRSRLNEILAKHTGQSLETIARDTERDNFKSAVDA 187

Query: 196 CDWGVVDKVLMSR 208
             +G+VD+VL  R
Sbjct: 188 QAYGLVDQVLERR 200


>gi|289804604|ref|ZP_06535233.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Typhi str. AG3]
          Length = 228

 Score =  275 bits (702), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 163/194 (84%), Gaps = 2/194 (1%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 37  MSYSG--ERDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 94

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 95  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 154

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 155 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 214

Query: 181 EKTLDRDHIMSASE 194
           E+  +RD  +SA E
Sbjct: 215 ERDTERDRFLSAPE 228


>gi|90417350|ref|ZP_01225275.1| ATP-dependent Clp protease, proteolytic subunit ClpP [marine gamma
           proteobacterium HTCC2207]
 gi|90330792|gb|EAS46061.1| ATP-dependent Clp protease, proteolytic subunit ClpP [marine gamma
           proteobacterium HTCC2207]
          Length = 213

 Score =  275 bits (702), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 129/209 (61%), Positives = 166/209 (79%), Gaps = 1/209 (0%)

Query: 1   MSFEGCAKKDSEDV-FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLI 59
           M+F+      + DV   GLVPMVVEQT+RGER+YDIYSRLLKER++F+ GQ+EDHMA LI
Sbjct: 1   MNFQQPYAGHTHDVQASGLVPMVVEQTSRGERAYDIYSRLLKERVIFLVGQVEDHMANLI 60

Query: 60  CAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLL 119
            AQ+LFLE+ENP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQAASMG+ LL
Sbjct: 61  VAQMLFLESENPDKDIHLYINSPGGSVTAGMSIYDTMQFIKPNVSTMCIGQAASMGAFLL 120

Query: 120 SAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEE 179
           +AG +G R+ LPN+R ++HQPSGG  GQA+DI   +Q+I+KIK RLN +  K+ G++ E+
Sbjct: 121 AAGAEGKRYCLPNSRTMIHQPSGGAQGQATDIHIQSQEILKIKSRLNNLMAKHTGQSVEK 180

Query: 180 VEKTLDRDHIMSASEACDWGVVDKVLMSR 208
           V +  +RD+ MSA E+  +G+VD VL SR
Sbjct: 181 VTEDTERDNFMSAEESKAYGLVDDVLDSR 209


>gi|127513436|ref|YP_001094633.1| ATP-dependent Clp protease proteolytic subunit [Shewanella loihica
           PV-4]
 gi|171855248|sp|A3QFX6|CLPP_SHELP RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|126638731|gb|ABO24374.1| ATP-dependent Clp protease proteolytic subunit ClpP [Shewanella
           loihica PV-4]
          Length = 203

 Score =  275 bits (702), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 158/197 (80%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E V   LVPMVVEQT +GERSYDIYSRLLKER++F+ GQ+E+HMA LI AQLLFLE+E+P
Sbjct: 6   ESVLNALVPMVVEQTAKGERSYDIYSRLLKERVIFLVGQVEEHMANLIVAQLLFLESESP 65

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            K+I LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+ G KG R  LP
Sbjct: 66  DKDIYLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGAKGKRHCLP 125

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+R+++HQP GGF GQASDI  HAQ+I+ IK +LN++   + G+  E +E+  DRD+ MS
Sbjct: 126 NSRVMIHQPLGGFQGQASDIAIHAQEILGIKNKLNQMLADHTGQPLEVIERDTDRDNFMS 185

Query: 192 ASEACDWGVVDKVLMSR 208
           A+EA ++G+VD VL  R
Sbjct: 186 ATEAAEYGLVDSVLDKR 202


>gi|117921102|ref|YP_870294.1| ATP-dependent Clp protease proteolytic subunit [Shewanella sp.
           ANA-3]
 gi|166214711|sp|A0KYL9|CLPP_SHESA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|117613434|gb|ABK48888.1| ATP-dependent Clp protease proteolytic subunit ClpP [Shewanella sp.
           ANA-3]
          Length = 202

 Score =  275 bits (702), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 125/199 (62%), Positives = 162/199 (81%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           ++ D+   LVPMV+EQT +GERS+DIYSRLLKERI+F+ GQ+E+HMA LI AQLLFLE+E
Sbjct: 3   NASDIQSALVPMVIEQTAKGERSFDIYSRLLKERIIFLVGQVEEHMANLIVAQLLFLESE 62

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           +P K+I LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+ GEKG RF 
Sbjct: 63  SPDKDIFLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGEKGKRFC 122

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPN+R+++HQP GGF GQASDI  HAQ+I+ IK +LN +  ++ G+  E +E+  DRD+ 
Sbjct: 123 LPNSRVMIHQPLGGFQGQASDIAIHAQEILGIKHKLNLMLSEHTGQPLEVIERDTDRDNF 182

Query: 190 MSASEACDWGVVDKVLMSR 208
           MSA++A ++G+VD V+  R
Sbjct: 183 MSATQAVEYGLVDAVMTKR 201


>gi|308050308|ref|YP_003913874.1| ATP-dependent Clp protease proteolytic subunit ClpP [Ferrimonas
           balearica DSM 9799]
 gi|307632498|gb|ADN76800.1| ATP-dependent Clp protease proteolytic subunit ClpP [Ferrimonas
           balearica DSM 9799]
          Length = 207

 Score =  275 bits (702), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 124/192 (64%), Positives = 156/192 (81%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            L+PMVVEQT +GERSYDIYSRLLKER++F+TG +EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 11  ALIPMVVEQTAKGERSYDIYSRLLKERVIFLTGPVEDHMANLVVAQLLFLESENPDKDIY 70

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+ G KG R  LPN+R++
Sbjct: 71  LYINSPGGSVTAGMSIYDTMQFIKPDVSTVCMGQAASMGAFLLAGGAKGKRHVLPNSRVM 130

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI  HAQ+I+ IK +LN +  ++ G+  E +E+  DRD+ MSA++A 
Sbjct: 131 IHQPLGGFQGQASDIAIHAQEILGIKHKLNLLLAEHTGQPMEVIERDTDRDNFMSATDAV 190

Query: 197 DWGVVDKVLMSR 208
           ++G+VD VL  R
Sbjct: 191 EYGLVDSVLTRR 202


>gi|126173838|ref|YP_001049987.1| ATP-dependent Clp protease proteolytic subunit [Shewanella baltica
           OS155]
 gi|153000122|ref|YP_001365803.1| ATP-dependent Clp protease proteolytic subunit [Shewanella baltica
           OS185]
 gi|160874744|ref|YP_001554060.1| ATP-dependent Clp protease proteolytic subunit [Shewanella baltica
           OS195]
 gi|217973910|ref|YP_002358661.1| ATP-dependent Clp protease proteolytic subunit [Shewanella baltica
           OS223]
 gi|304409711|ref|ZP_07391331.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shewanella
           baltica OS183]
 gi|307304067|ref|ZP_07583820.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shewanella
           baltica BA175]
 gi|166214708|sp|A3D305|CLPP_SHEB5 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166214709|sp|A6WLQ1|CLPP_SHEB8 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|189082464|sp|A9KWH7|CLPP_SHEB9 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|254763799|sp|B8E5E9|CLPP_SHEB2 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|125997043|gb|ABN61118.1| ATP-dependent Clp protease proteolytic subunit ClpP [Shewanella
           baltica OS155]
 gi|151364740|gb|ABS07740.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shewanella
           baltica OS185]
 gi|160860266|gb|ABX48800.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shewanella
           baltica OS195]
 gi|217499045|gb|ACK47238.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shewanella
           baltica OS223]
 gi|304352229|gb|EFM16627.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shewanella
           baltica OS183]
 gi|306912965|gb|EFN43388.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shewanella
           baltica BA175]
 gi|315266986|gb|ADT93839.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shewanella
           baltica OS678]
          Length = 202

 Score =  275 bits (702), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 125/199 (62%), Positives = 162/199 (81%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           ++ D+   LVPMV+EQT +GERSYDIYSRLLKERI+F+ GQ+E+HMA LI AQLLFLE+E
Sbjct: 3   NASDIQSALVPMVIEQTAKGERSYDIYSRLLKERIIFLVGQVEEHMANLIVAQLLFLESE 62

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           +P K+I LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+ GEKG R  
Sbjct: 63  SPDKDIFLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGEKGKRHC 122

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPN+R+++HQP GGF GQASDI  HA++I+ IK +LN++  ++ G+  E VE+  DRD+ 
Sbjct: 123 LPNSRVMIHQPLGGFQGQASDIAIHAKEILGIKNKLNQMLAEHTGQPLEVVERDTDRDNF 182

Query: 190 MSASEACDWGVVDKVLMSR 208
           MSA++A ++G+VD V+  R
Sbjct: 183 MSATQAVEYGLVDSVMTKR 201


>gi|51473702|ref|YP_067459.1| ATP-dependent Clp protease proteolytic subunit [Rickettsia typhi
           str. Wilmington]
 gi|60389549|sp|Q68WL5|CLPP_RICTY RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|51460014|gb|AAU03977.1| Caseinolytic protease [Rickettsia typhi str. Wilmington]
          Length = 201

 Score =  275 bits (702), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 162/193 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +  +P+V+EQT+RGER+YDIYSRLLKERI+FV   +EDHMA LI AQLLFLEAENP+K+I
Sbjct: 1   MSYIPVVIEQTSRGERAYDIYSRLLKERIIFVCSTVEDHMANLIVAQLLFLEAENPKKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGGVVTAG+AIYDTMQFIKP ++T C+GQA SMGSLLL  GE GMR++LP++RI
Sbjct: 61  YMYINSPGGVVTAGLAIYDTMQFIKPKVATLCIGQACSMGSLLLCGGEHGMRYSLPHSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG+ GQA+DIE HA++ +KIK+ LNE+Y K+  +  + +EK+++RD+ MS  EA
Sbjct: 121 MIHQPSGGYKGQATDIEIHARETLKIKKLLNELYSKHTEQALKHIEKSMERDNFMSPGEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G+VD ++ SR
Sbjct: 181 KKFGLVDNIISSR 193


>gi|84499432|ref|ZP_00997720.1| Protease subunit of ATP-dependent Clp protease [Oceanicola
           batsensis HTCC2597]
 gi|84392576|gb|EAQ04787.1| Protease subunit of ATP-dependent Clp protease [Oceanicola
           batsensis HTCC2597]
          Length = 210

 Score =  275 bits (702), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 161/197 (81%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E+    LVPMVVEQT+RGER+YDI+SRLLKERI+FV+G + D M++LI AQLL LEAENP
Sbjct: 6   ENYMNNLVPMVVEQTSRGERAYDIFSRLLKERIIFVSGPVHDGMSSLIVAQLLHLEAENP 65

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            K+IS+YINSPGGVVT+G++IYDTMQ+IKP + T  +GQAASMGSLLL+ G  GMR+ALP
Sbjct: 66  TKDISMYINSPGGVVTSGLSIYDTMQYIKPKVGTLVIGQAASMGSLLLAGGAAGMRYALP 125

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           NA I++HQPSGG+ GQA+DI  HA+   K+K RLN+IYVK+ G+ +E V   L+RD+ M+
Sbjct: 126 NAEIMVHQPSGGYRGQATDIMIHARHTEKLKERLNKIYVKHTGQDFETVVDALERDNFMT 185

Query: 192 ASEACDWGVVDKVLMSR 208
           A EA DWG++D++  SR
Sbjct: 186 AEEAKDWGLIDEIFESR 202


>gi|114563762|ref|YP_751275.1| ATP-dependent Clp protease proteolytic subunit [Shewanella
           frigidimarina NCIMB 400]
 gi|122299288|sp|Q07ZX8|CLPP_SHEFN RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|114335055|gb|ABI72437.1| ATP-dependent Clp protease proteolytic subunit ClpP [Shewanella
           frigidimarina NCIMB 400]
          Length = 203

 Score =  274 bits (701), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 160/197 (81%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E V   LVPMVVEQT +GERSYDIYSRLLKER++F+ GQ+E+HMA LI AQLLFLE+E+P
Sbjct: 6   ESVLNALVPMVVEQTAKGERSYDIYSRLLKERVIFLVGQVEEHMANLIVAQLLFLESESP 65

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            K+I LYINSPGG VTAGMAIYDTMQFIKP +ST CMGQAASMG+ LL+ G KG R  LP
Sbjct: 66  DKDIYLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCMGQAASMGAFLLAGGAKGKRHCLP 125

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+R+++HQP GGF GQASDI  HA++I+ IK +LN++  ++ G+  + +E+  DRD+ MS
Sbjct: 126 NSRVMIHQPLGGFQGQASDIAIHAKEILGIKNKLNQMLAEHTGQPLDIIERDTDRDNFMS 185

Query: 192 ASEACDWGVVDKVLMSR 208
           A++A ++G+VD +L SR
Sbjct: 186 ATQAVEYGIVDSLLTSR 202


>gi|94498801|ref|ZP_01305347.1| ATP-dependent Clp protease [Sphingomonas sp. SKA58]
 gi|94421730|gb|EAT06785.1| ATP-dependent Clp protease [Sphingomonas sp. SKA58]
          Length = 211

 Score =  274 bits (701), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 125/196 (63%), Positives = 163/196 (83%)

Query: 13  DVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQ 72
           D    LVP+V+EQ+NRGERS+DI+SRLL+ERI+FVTGQ+EDHMA+LI AQLLFLE+ENP+
Sbjct: 7   DPMAALVPIVIEQSNRGERSFDIFSRLLRERIIFVTGQVEDHMASLIVAQLLFLESENPK 66

Query: 73  KEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPN 132
           K+I +YINSPGGVVT+GMAI+DTM++I+P + T C+GQAASMGS LL+AGE G R AL N
Sbjct: 67  KDIWMYINSPGGVVTSGMAIHDTMKYIRPQVGTVCIGQAASMGSFLLAAGEPGKRIALSN 126

Query: 133 ARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSA 192
           ARI++HQPSGG  G ASDIE  A++I++I+RRLN++YV+  G+T E VE+ +DRD  + A
Sbjct: 127 ARIMVHQPSGGAQGMASDIEIQAKEILRIRRRLNDLYVQYTGQTLEAVERAMDRDTFLEA 186

Query: 193 SEACDWGVVDKVLMSR 208
            EA  +G+VD+V   R
Sbjct: 187 DEAKAFGLVDEVFDRR 202


>gi|113970830|ref|YP_734623.1| ATP-dependent Clp protease proteolytic subunit [Shewanella sp.
           MR-4]
 gi|123029527|sp|Q0HHA1|CLPP_SHESM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|113885514|gb|ABI39566.1| ATP-dependent Clp protease proteolytic subunit ClpP [Shewanella sp.
           MR-4]
          Length = 202

 Score =  274 bits (701), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 125/199 (62%), Positives = 162/199 (81%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           ++ D+   LVPMV+EQT +GERS+DIYSRLLKERI+F+ GQ+E+HMA LI AQLLFLE+E
Sbjct: 3   NASDIQSALVPMVIEQTAKGERSFDIYSRLLKERIIFLVGQVEEHMANLIVAQLLFLESE 62

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           +P K+I LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+ GEKG RF 
Sbjct: 63  SPDKDIFLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGEKGKRFC 122

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPN+R+++HQP GGF GQASDI  HAQ+I+ IK +LN +  ++ G+  E +E+  DRD+ 
Sbjct: 123 LPNSRVMIHQPLGGFQGQASDIAIHAQEILGIKHKLNLMLSEHTGQPLELIERDTDRDNF 182

Query: 190 MSASEACDWGVVDKVLMSR 208
           MSA++A ++G+VD V+  R
Sbjct: 183 MSATQAVEYGLVDAVMTKR 201


>gi|58584810|ref|YP_198383.1| protease subunit of ATP-dependent Clp protease [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
 gi|67460156|sp|Q5GS83|CLPP_WOLTR RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|58419126|gb|AAW71141.1| Protease subunit of ATP-dependent Clp protease [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 208

 Score =  274 bits (701), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 120/197 (60%), Positives = 168/197 (85%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P+V+EQT+RGER+YDIYSRL+KERI+FVTG +ED+MA++I AQLLFLE+ENP K+I
Sbjct: 1   MTLIPIVIEQTSRGERAYDIYSRLVKERIIFVTGPVEDNMASVIVAQLLFLESENPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGGVVTAG++IYDTMQ+IKP +ST C+GQAASMGSLLL+AG +G R++LP++RI
Sbjct: 61  YMYINSPGGVVTAGLSIYDTMQYIKPDVSTLCIGQAASMGSLLLAAGTEGKRYSLPHSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG+ GQA+DIE HA +I+++KR+LN+IY K+ G + +++E  ++RD  M   EA
Sbjct: 121 MIHQPSGGYQGQATDIEIHANEILRVKRKLNQIYEKHTGNSLKKIEGMMERDKFMDPEEA 180

Query: 196 CDWGVVDKVLMSRIDIE 212
              G++D+V+  R DI+
Sbjct: 181 RRIGLIDRVIAERKDIK 197


>gi|296284617|ref|ZP_06862615.1| ATP-dependent Clp protease proteolytic subunit [Citromicrobium
           bathyomarinum JL354]
          Length = 228

 Score =  274 bits (701), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 160/191 (83%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+VVEQT+RGERS+DI+SRLL+ERIVF+TG +ED MA+L  AQLLFLE+ENP K IS+
Sbjct: 17  LVPVVVEQTSRGERSFDIFSRLLRERIVFLTGPVEDGMASLAVAQLLFLESENPSKPISM 76

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVTAGMAI+DTMQ+I+P IST C+GQAASMGS LL+AGE GMR ALPNARI++
Sbjct: 77  YINSPGGVVTAGMAIHDTMQYIQPRISTVCVGQAASMGSFLLAAGEPGMRIALPNARIMI 136

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGG  G ASDIE  A++I++I++ +NE+Y K  G+  E++E+ +DRD  + A EA  
Sbjct: 137 HQPSGGAQGMASDIEIQAREILRIRKNMNELYAKYTGQPLEKIEEAMDRDTFLDAQEAMK 196

Query: 198 WGVVDKVLMSR 208
           +G+VDKV  SR
Sbjct: 197 FGLVDKVFESR 207


>gi|121605848|ref|YP_983177.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Polaromonas
           naphthalenivorans CJ2]
 gi|120594817|gb|ABM38256.1| ATP-dependent Clp protease proteolytic subunit ClpP [Polaromonas
           naphthalenivorans CJ2]
          Length = 216

 Score =  274 bits (701), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 156/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG+VPMV+EQ+ RGERSYDIYSRLLKER++F+ G + D  A L+ AQLLFLE+ENP K+I
Sbjct: 23  LGMVPMVIEQSGRGERSYDIYSRLLKERVIFLVGPVNDQTANLVVAQLLFLESENPDKDI 82

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S YINSPGG VTAGMAIYDTMQFIKP +ST C+G AASMG+ LLS+G KG RF+LPN+R+
Sbjct: 83  SFYINSPGGSVTAGMAIYDTMQFIKPDVSTLCVGMAASMGAFLLSSGTKGKRFSLPNSRV 142

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQASDIE HA+DI+K + +LN I   N G+T E++E+  +RD+ M A EA
Sbjct: 143 MIHQPSGGAQGQASDIEIHARDILKTRDQLNRILAHNTGQTVEKIERDTERDYFMFADEA 202

Query: 196 CDWGVVDKVLMSR 208
             +GVVD+V+  R
Sbjct: 203 KAYGVVDQVISKR 215


>gi|209546440|ref|YP_002278330.1| ATP-dependent Clp protease proteolytic subunit [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209539297|gb|ACI59230.1| Endopeptidase Clp [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 203

 Score =  274 bits (701), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 118/191 (61%), Positives = 160/191 (83%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQ++RGERS+DIYSRLL+ERIVF+ G++ D ++ L+CAQLLFLEAENP+K I L
Sbjct: 7   LVPMVVEQSSRGERSFDIYSRLLRERIVFLNGEVNDTVSALVCAQLLFLEAENPKKPIYL 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G+A+YDTM++I+ P+ T CMG A SMGS LL AGE G R ALPNA IL+
Sbjct: 67  YINSPGGVVTSGLAMYDTMRYIRAPVHTLCMGTARSMGSFLLMAGEPGERAALPNASILI 126

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGGF GQA+D++ HA++I+K K+R+  +Y ++CG++YE+ E+ +DRD  M++ EA +
Sbjct: 127 HQPSGGFQGQATDMQIHAEEILKTKQRMTRLYAEHCGRSYEDFERAMDRDRFMTSQEALE 186

Query: 198 WGVVDKVLMSR 208
           WG++DK++  R
Sbjct: 187 WGLIDKIMQLR 197


>gi|256556952|gb|ACU83574.1| ATP-dependent Clp protease subunit [uncultured bacterium
           HF130_AEPn_2]
          Length = 211

 Score =  274 bits (701), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 158/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMVVEQ+ RGER+YDIYSRLLKER++F+ G +ED+MA LICAQLLFLEAENP K+I 
Sbjct: 18  GLVPMVVEQSARGERAYDIYSRLLKERVIFLVGPVEDYMANLICAQLLFLEAENPDKDIH 77

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQA SMG+ LL+AG +G RF LPN+R++
Sbjct: 78  LYINSPGGSVTAGMSIYDTMQFIKPNVSTTCIGQACSMGAFLLTAGAEGKRFCLPNSRVM 137

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDIE HA++I+ I+ RLN +  K+ G T EE+E+  +RD+ MSA  A 
Sbjct: 138 IHQPLGGFQGQASDIEIHAKEILFIRERLNTLMAKHSGHTLEEIERDTNRDNFMSAEAAR 197

Query: 197 DWGVVDKVLMSR 208
           ++G++D V+  R
Sbjct: 198 EYGLIDAVIDKR 209


>gi|103488219|ref|YP_617780.1| ATP-dependent Clp protease proteolytic subunit [Sphingopyxis
           alaskensis RB2256]
 gi|116243167|sp|Q1GPH5|CLPP_SPHAL RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|98978296|gb|ABF54447.1| ATP-dependent Clp protease proteolytic subunit ClpP [Sphingopyxis
           alaskensis RB2256]
          Length = 216

 Score =  274 bits (700), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 125/196 (63%), Positives = 165/196 (84%)

Query: 13  DVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQ 72
           D    LVP+VVEQT+RGERS+DI+SRLL+ERIVFVTG++ED+MA+LI AQLLFLE+ENP+
Sbjct: 3   DPLAALVPVVVEQTSRGERSFDIFSRLLRERIVFVTGEVEDNMASLIVAQLLFLESENPK 62

Query: 73  KEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPN 132
           K+I +YINSPGGVVTAGMAI+DTMQ+I+P + T C+GQAASMGS LL+AGE GMR AL N
Sbjct: 63  KDIYMYINSPGGVVTAGMAIHDTMQYIRPRVGTVCIGQAASMGSFLLAAGEPGMRVALTN 122

Query: 133 ARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSA 192
           AR+++HQPSGG  G ASDIE  A++I++I++R+N++YVK  GK+ +++EK +DRD  + A
Sbjct: 123 ARVMVHQPSGGARGMASDIEIQAKEILRIRKRMNDLYVKYTGKSLKDIEKAMDRDTFLEA 182

Query: 193 SEACDWGVVDKVLMSR 208
            EA ++G+VD V   R
Sbjct: 183 DEAKEFGIVDHVYDRR 198


>gi|21230439|ref|NP_636356.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66769567|ref|YP_244329.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas
           campestris pv. campestris str. 8004]
 gi|25008306|sp|Q8PBY6|CLPP_XANCP RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|81304478|sp|Q4URL4|CLPP_XANC8 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|21112001|gb|AAM40280.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66574899|gb|AAY50309.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas
           campestris pv. campestris str. 8004]
          Length = 208

 Score =  274 bits (700), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 123/193 (63%), Positives = 162/193 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           L LVPMVVEQT+RGER+YDIYSRLLKER++F+ G I+DHMA +I AQLLFLEA+NP+K+I
Sbjct: 8   LNLVPMVVEQTSRGERAYDIYSRLLKERLIFLVGPIDDHMANVIVAQLLFLEADNPEKDI 67

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S+YINSPGGVVTAGMAIYDTMQ+IKP +ST C+GQAASMG+LLL++G  G R+ALPN+R+
Sbjct: 68  SIYINSPGGVVTAGMAIYDTMQYIKPDVSTICVGQAASMGALLLASGAAGKRYALPNSRV 127

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI+ HA++I+ ++ RLNEI  K+ G++ E + +  +RD+  SA +A
Sbjct: 128 MIHQPLGGFQGQATDIDIHAREILTLRSRLNEILAKHTGQSLETIARDTERDNFKSAVDA 187

Query: 196 CDWGVVDKVLMSR 208
             +G+VD VL  R
Sbjct: 188 QAYGLVDHVLERR 200


>gi|58038575|ref|YP_190539.1| ATP-dependent Clp protease proteolytic subunit [Gluconobacter
           oxydans 621H]
 gi|67460438|sp|Q5FUR3|CLPP1_GLUOX RecName: Full=ATP-dependent Clp protease proteolytic subunit 1;
           AltName: Full=Endopeptidase Clp 1
 gi|58000989|gb|AAW59883.1| ATP-dependent Clp protease proteolytic subunit [Gluconobacter
           oxydans 621H]
          Length = 215

 Score =  274 bits (700), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 170/198 (85%), Gaps = 1/198 (0%)

Query: 9   KDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           +D  +VF   LVPMVVEQT RGERS+DI+SRLL+ERI+F+TG + D +++LICAQLL+LE
Sbjct: 6   RDPLEVFSNSLVPMVVEQTARGERSFDIFSRLLQERIIFLTGPVYDQVSSLICAQLLYLE 65

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           + NP KEIS YINSPGGVV+AG+AIYDTMQ+I+ P+ST C+GQAASMGSLLL+ GEKG R
Sbjct: 66  SVNPTKEISFYINSPGGVVSAGLAIYDTMQYIRCPVSTVCIGQAASMGSLLLAGGEKGHR 125

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           +ALPNAR+++HQPSGG  GQASDIE  A++I+ I++RLNEIY ++ G+T E++E+ L+RD
Sbjct: 126 YALPNARVMVHQPSGGAQGQASDIEIQAREILIIRQRLNEIYREHTGQTLEQIEQKLERD 185

Query: 188 HIMSASEACDWGVVDKVL 205
             +SA+EA ++G++DKV+
Sbjct: 186 SYLSANEAREFGLIDKVV 203


>gi|84686590|ref|ZP_01014483.1| Protease subunit of ATP-dependent Clp protease [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84665503|gb|EAQ11980.1| Protease subunit of ATP-dependent Clp protease [Rhodobacterales
           bacterium HTCC2654]
          Length = 193

 Score =  274 bits (700), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 160/193 (82%)

Query: 21  MVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYIN 80
           MVVEQT+RGER+YDI+SRLLKERI+F+ G + D M++LICAQLLFLEAENP KEI++YIN
Sbjct: 1   MVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLICAQLLFLEAENPSKEIAMYIN 60

Query: 81  SPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQP 140
           SPGGVVT+G++IYDTMQ+I+P +ST  +GQAASMGSLLL+AG  GMRF+LPN+RI++HQP
Sbjct: 61  SPGGVVTSGLSIYDTMQYIRPKVSTLVIGQAASMGSLLLTAGAPGMRFSLPNSRIMVHQP 120

Query: 141 SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGV 200
           SGG+ GQA+DI  HAQ+  K+K RLN IYVK+ G+  + V   L+RD+ M   +A DWG+
Sbjct: 121 SGGYQGQATDIMIHAQETQKLKDRLNSIYVKHTGQKLKAVVDALERDNFMDPEQAKDWGL 180

Query: 201 VDKVLMSRIDIEE 213
           +D++L SR D  E
Sbjct: 181 IDEILESRGDAPE 193


>gi|330808572|ref|YP_004353034.1| endopeptidase Clp (ATP-dependent Clp protease proteolytic subunit
           ClpP) [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327376680|gb|AEA68030.1| endopeptidase Clp (ATP-dependent Clp protease proteolytic subunit
           ClpP) [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 211

 Score =  274 bits (700), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 159/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMV+EQ+ RGER+YDIYSRLLKER++F+ G +ED+MA LICAQLLFLEAENP K+I 
Sbjct: 18  GLVPMVIEQSARGERAYDIYSRLLKERVIFLVGPVEDYMANLICAQLLFLEAENPDKDIH 77

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQA SMG+ LL+AG  G R+ LPN+R++
Sbjct: 78  LYINSPGGSVTAGMSIYDTMQFIKPNVSTTCIGQACSMGAFLLTAGAHGKRYCLPNSRVM 137

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDIE HA++I+ I+ RLN +  K+ G+T EE+E+  +RD+ MSA  A 
Sbjct: 138 IHQPLGGFQGQASDIEIHAKEILFIRERLNTLMAKHSGRTLEEIERDTNRDNFMSAEAAR 197

Query: 197 DWGVVDKVLMSR 208
           ++G++D+V+  R
Sbjct: 198 EYGLIDEVINQR 209


>gi|218510664|ref|ZP_03508542.1| ATP-dependent Clp protease proteolytic subunit [Rhizobium etli
           Brasil 5]
 gi|327192437|gb|EGE59394.1| ATP-dependent Clp protease proteolytic subunit [Rhizobium etli
           CNPAF512]
          Length = 203

 Score =  274 bits (700), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 159/193 (82%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMV+EQ++RGERS+DIYSRLL+ERI+F+ G++ D ++ L+CAQLLFLEAENP K I+L
Sbjct: 7   LVPMVIEQSSRGERSFDIYSRLLRERIIFLNGEVNDTVSALVCAQLLFLEAENPNKPINL 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G+A+YDTM+FI+ P+ T CMG A SMGS LL AGE G R ALPNA IL+
Sbjct: 67  YINSPGGVVTSGLAMYDTMRFIRAPVHTLCMGTARSMGSFLLMAGEPGGRAALPNASILI 126

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGGF GQASD+  HA++I+K K+R+  +Y ++CG++YE+ E  +DRD  M+A EA +
Sbjct: 127 HQPSGGFQGQASDMLIHAEEILKTKQRMTRLYAEHCGRSYEDFEHGMDRDRFMTAEEALE 186

Query: 198 WGVVDKVLMSRID 210
           WG++D++L  R D
Sbjct: 187 WGLIDRILKVRED 199


>gi|167624686|ref|YP_001674980.1| ATP-dependent Clp protease proteolytic subunit [Shewanella
           halifaxensis HAW-EB4]
 gi|189082465|sp|B0TLU9|CLPP_SHEHH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|167354708|gb|ABZ77321.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shewanella
           halifaxensis HAW-EB4]
          Length = 203

 Score =  274 bits (700), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 159/200 (79%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           K  E V   LVPMVVEQT +GERSYDIYSRLLKER++F+ GQ+E+HMA LI AQLLFLE+
Sbjct: 3   KAPESVLNALVPMVVEQTAKGERSYDIYSRLLKERVIFLVGQVEEHMANLIVAQLLFLES 62

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           E+P K+I LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+ G +G R 
Sbjct: 63  ESPDKDIYLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGAEGKRH 122

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
            LPN+R+++HQP GGF GQASDI  HAQ+I+ IK +LN +  ++ G+  E +E+  DRD+
Sbjct: 123 CLPNSRVMIHQPLGGFQGQASDIAIHAQEILGIKNKLNTMLAEHTGQPLEVIERDTDRDN 182

Query: 189 IMSASEACDWGVVDKVLMSR 208
            MSA+EA ++G+VD V+  R
Sbjct: 183 FMSATEAAEYGLVDSVIAKR 202


>gi|39996891|ref|NP_952842.1| ATP-dependent Clp protease proteolytic subunit [Geobacter
           sulfurreducens PCA]
 gi|60389697|sp|Q74C82|CLPP_GEOSL RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|39983779|gb|AAR35169.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Geobacter
           sulfurreducens PCA]
 gi|298505904|gb|ADI84627.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Geobacter
           sulfurreducens KN400]
          Length = 199

 Score =  274 bits (700), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 122/188 (64%), Positives = 159/188 (84%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+VVEQT RGERSYDIYSRLLK+RI+F+ G ++DH+A L+ AQ+LFLEAE+P K+I L
Sbjct: 2   LVPIVVEQTGRGERSYDIYSRLLKDRIIFLGGPVDDHVANLVIAQMLFLEAEDPDKDIHL 61

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+GMAIYDTMQ+IK P+ST C+GQAASMG+LLLS GEKG RF+L ++RI++
Sbjct: 62  YINSPGGVVTSGMAIYDTMQYIKAPVSTICVGQAASMGALLLSGGEKGKRFSLKHSRIMI 121

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQA+DI  HAQ+I+K+K+RLNEI  +N G+   +VE   +RD+ MS +EA D
Sbjct: 122 HQPLGGFQGQATDIHIHAQEILKLKKRLNEILAENTGQQLAKVEADTERDYFMSGAEAKD 181

Query: 198 WGVVDKVL 205
           +G++D ++
Sbjct: 182 YGIIDNII 189


>gi|294011932|ref|YP_003545392.1| ATP-dependent Clp protease protease subunit [Sphingobium japonicum
           UT26S]
 gi|292675262|dbj|BAI96780.1| ATP-dependent Clp protease protease subunit [Sphingobium japonicum
           UT26S]
          Length = 211

 Score =  274 bits (700), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 125/196 (63%), Positives = 162/196 (82%)

Query: 13  DVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQ 72
           D    LVP+V+EQ+NRGERS+DIYSRLL+ERI+FVTGQ+EDHMA+LI AQLLFLE+ENP+
Sbjct: 7   DPMAALVPIVIEQSNRGERSFDIYSRLLRERIIFVTGQVEDHMASLIVAQLLFLESENPK 66

Query: 73  KEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPN 132
           K+I +YINSPGGVVT+GMAI+DTM++I+P + T C+GQAASMGS LL+AGE G R AL N
Sbjct: 67  KDIWMYINSPGGVVTSGMAIHDTMKYIRPQVGTVCIGQAASMGSFLLAAGEPGKRIALSN 126

Query: 133 ARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSA 192
           ARI++HQPSGG  G ASDIE  A++I++I+ RLN +YV+  G++ EEVE+ +DRD  + A
Sbjct: 127 ARIMVHQPSGGAQGMASDIEIQAKEILRIRSRLNNLYVQYTGRSLEEVERAMDRDTFLEA 186

Query: 193 SEACDWGVVDKVLMSR 208
            EA  +G+VD+V   R
Sbjct: 187 EEAKAFGLVDEVFDRR 202


>gi|157962502|ref|YP_001502536.1| ATP-dependent Clp protease proteolytic subunit [Shewanella pealeana
           ATCC 700345]
 gi|189082466|sp|A8H614|CLPP_SHEPA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|157847502|gb|ABV88001.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shewanella
           pealeana ATCC 700345]
          Length = 203

 Score =  274 bits (700), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 159/200 (79%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           K  E V   LVPMVVEQT +GERSYDIYSRLLKER++F+ GQ+E+HMA LI AQLLFLE+
Sbjct: 3   KAPESVLNALVPMVVEQTAKGERSYDIYSRLLKERVIFLVGQVEEHMANLIVAQLLFLES 62

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           E+P K+I LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+ G +G R 
Sbjct: 63  ESPDKDIYLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGAEGKRH 122

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
            LPN+R+++HQP GGF GQASDI  HAQ+I+ IK +LN +  ++ G+  E +E+  DRD+
Sbjct: 123 CLPNSRVMIHQPLGGFQGQASDIAIHAQEILGIKNKLNTMLAEHTGQPLEVIERDTDRDN 182

Query: 189 IMSASEACDWGVVDKVLMSR 208
            MSA+EA ++G+VD V+  R
Sbjct: 183 FMSATEAAEYGLVDSVIAKR 202


>gi|71281884|ref|YP_270452.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Colwellia
           psychrerythraea 34H]
 gi|110816457|sp|Q47XL8|CLPP_COLP3 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|71147624|gb|AAZ28097.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Colwellia
           psychrerythraea 34H]
          Length = 220

 Score =  274 bits (700), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 126/194 (64%), Positives = 159/194 (81%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT +GERSYDIYSRLLKER++F+ GQ+EDHMA LI AQLLFLE+E+P K+I 
Sbjct: 26  ALVPMVVEQTAKGERSYDIYSRLLKERVIFLCGQVEDHMANLIIAQLLFLESESPDKDIY 85

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGMAIYDTM+FIKP IST C+GQAASMG+ LLS GEKG R+ LPNAR++
Sbjct: 86  LYINSPGGSVTAGMAIYDTMKFIKPNISTVCIGQAASMGAFLLSGGEKGKRYCLPNARVM 145

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASD E HA++I+ IK +LN++  ++ G+T ++V +  DRD+ +SA  A 
Sbjct: 146 IHQPLGGFQGQASDFEIHAKEILFIKDKLNKLMAEHTGQTLDKVSQDTDRDNFLSAEAAV 205

Query: 197 DWGVVDKVLMSRID 210
           ++G+VD +L  R D
Sbjct: 206 EYGLVDSILEQRND 219


>gi|330829918|ref|YP_004392870.1| ATP-dependent Clp protease proteolytic subunit [Aeromonas veronii
           B565]
 gi|328805054|gb|AEB50253.1| ATP-dependent Clp protease proteolytic subunit [Aeromonas veronii
           B565]
          Length = 207

 Score =  273 bits (699), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 126/192 (65%), Positives = 154/192 (80%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVP+VVEQT +GERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 15  ALVPIVVEQTAKGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDKDIY 74

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           +YINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G KG RF LPNAR++
Sbjct: 75  IYINSPGGSVTAGMSIYDTMQFIKPDVSTVCMGQACSMGAFLLAGGAKGKRFCLPNARVM 134

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI+ HAQ+I+KIK  LNE    + G+    +E+  DRD+ MSA +A 
Sbjct: 135 IHQPLGGFQGQASDIQIHAQEILKIKNTLNERLAFHTGQDMATIERDTDRDNFMSAEQAV 194

Query: 197 DWGVVDKVLMSR 208
            +G+VD VL  R
Sbjct: 195 AYGLVDGVLSQR 206


>gi|145298871|ref|YP_001141712.1| ATP-dependent Clp protease proteolytic subunit [Aeromonas
           salmonicida subsp. salmonicida A449]
 gi|226706437|sp|A4SM42|CLPP_AERS4 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|142851643|gb|ABO89964.1| ATP-dependent Clp protease, proteolytic subunit [Aeromonas
           salmonicida subsp. salmonicida A449]
          Length = 207

 Score =  273 bits (699), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 124/191 (64%), Positives = 155/191 (81%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           L+PMVVEQT +GERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP ++IS+
Sbjct: 16  LIPMVVEQTAKGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDQDISI 75

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G KG RF LP+AR+++
Sbjct: 76  YINSPGGAVTAGMSIYDTMQFIKPDVSTVCMGQACSMGAFLLAGGAKGKRFCLPSARVMI 135

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQASDI+ HAQ+I+KIK  LNE    + G+    +E+  DRD+ MSA +A  
Sbjct: 136 HQPLGGFQGQASDIQIHAQEILKIKNTLNERLAFHTGQEMATIERDTDRDNFMSADQAVA 195

Query: 198 WGVVDKVLMSR 208
           +G+VD +L  R
Sbjct: 196 YGLVDGILSQR 206


>gi|212636027|ref|YP_002312552.1| ATP-dependent Clp protease proteolytic subunit [Shewanella
           piezotolerans WP3]
 gi|226706473|sp|B8CRF7|CLPP_SHEPW RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|212557511|gb|ACJ29965.1| Peptidase S14, ClpP [Shewanella piezotolerans WP3]
          Length = 203

 Score =  273 bits (699), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 127/200 (63%), Positives = 158/200 (79%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           K  E V   LVPMVVEQT +GERSYDIYSRLLKER++F+ GQ+E+HMA LI AQLLFLE+
Sbjct: 3   KAPESVLNALVPMVVEQTAKGERSYDIYSRLLKERVIFLVGQVEEHMANLIVAQLLFLES 62

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           E+P K+I LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+ G +G R 
Sbjct: 63  ESPDKDIYLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGAEGKRH 122

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
            LPN+R+++HQP GGF GQASDI  HAQ+I+ IK +LN +  ++ G+  E +E+  DRD+
Sbjct: 123 CLPNSRVMIHQPLGGFQGQASDIAIHAQEILGIKNKLNTMLAEHTGQPIEVIERDTDRDN 182

Query: 189 IMSASEACDWGVVDKVLMSR 208
            MSA EA ++G+VD VL  R
Sbjct: 183 FMSADEAAEYGLVDSVLAKR 202


>gi|330503117|ref|YP_004379986.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           mendocina NK-01]
 gi|328917403|gb|AEB58234.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           mendocina NK-01]
          Length = 213

 Score =  273 bits (699), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 124/188 (65%), Positives = 156/188 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMV+EQ+ RGER+YDIYSRLLKER++F+ GQ+ED+MA LICAQLLFLEAENP K+I 
Sbjct: 18  GLVPMVIEQSARGERAYDIYSRLLKERVIFMVGQVEDYMANLICAQLLFLEAENPDKDIH 77

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGMAIYDTMQFIK  +ST C+GQA SMG+ LL+ G KG RF LPN+R++
Sbjct: 78  LYINSPGGSVTAGMAIYDTMQFIKADVSTTCIGQACSMGAFLLAGGAKGKRFCLPNSRVM 137

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDIE HA++I+ I+ RLNE+   + G++ E +E+  +RD+ MSAS A 
Sbjct: 138 IHQPLGGFQGQASDIEIHAKEILFIRERLNELLAHHTGQSLETIERDTNRDNFMSASRAV 197

Query: 197 DWGVVDKV 204
           ++G+VD V
Sbjct: 198 EYGLVDAV 205


>gi|157374680|ref|YP_001473280.1| ATP-dependent Clp protease proteolytic subunit [Shewanella
           sediminis HAW-EB3]
 gi|189082467|sp|A8FTH9|CLPP_SHESH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|157317054|gb|ABV36152.1| Endopeptidase Clp [Shewanella sediminis HAW-EB3]
          Length = 203

 Score =  273 bits (698), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 126/197 (63%), Positives = 158/197 (80%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E V   LVPMVVEQT +GERSYDIYSRLLKER++F+ GQ+E+HMA LI AQLLFLE+E+P
Sbjct: 6   ESVLNALVPMVVEQTAKGERSYDIYSRLLKERVIFLVGQVEEHMANLIVAQLLFLESESP 65

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            K+I LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+ G +G R  LP
Sbjct: 66  DKDIYLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGAEGKRHCLP 125

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+R+++HQP GGF GQASDI  HAQ+I+ IK +LN++   + G+  E +E+  DRD+ MS
Sbjct: 126 NSRVMIHQPLGGFQGQASDIAIHAQEILGIKNKLNQMLADHTGQPMEIIERDTDRDNFMS 185

Query: 192 ASEACDWGVVDKVLMSR 208
           A+EA ++G+VD VL  R
Sbjct: 186 AAEAAEYGLVDSVLSKR 202


>gi|238023189|ref|ZP_04603615.1| hypothetical protein GCWU000324_03115 [Kingella oralis ATCC 51147]
 gi|237865572|gb|EEP66712.1| hypothetical protein GCWU000324_03115 [Kingella oralis ATCC 51147]
          Length = 206

 Score =  273 bits (698), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 120/195 (61%), Positives = 160/195 (82%), Gaps = 2/195 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           L+P V+EQ+ RGER++DIYSRLLKERI+F+ G + DH A L+ AQLLFLE+ENP K+I  
Sbjct: 10  LIPTVIEQSGRGERAFDIYSRLLKERIIFLVGPVNDHTANLVVAQLLFLESENPDKDIYF 69

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTM+FIKP + T C+GQAASMG+ LLSAG KG RFALPN+R+++
Sbjct: 70  YINSPGGSVTAGMSIYDTMKFIKPDVQTLCLGQAASMGAFLLSAGTKGKRFALPNSRVMI 129

Query: 138 HQP--SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP  SGG  GQASDIE HA++++K+K +LN++  ++ GK+ E++E+  DRD+ MSA EA
Sbjct: 130 HQPLISGGLGGQASDIEIHARELLKLKEKLNQMLAEHTGKSLEQIERDTDRDNFMSAQEA 189

Query: 196 CDWGVVDKVLMSRID 210
            D+G++DKV+ +R D
Sbjct: 190 ADYGLIDKVITTRAD 204


>gi|190570982|ref|YP_001975340.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|213019499|ref|ZP_03335305.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
 gi|226706556|sp|B3CLB1|CLPP_WOLPP RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|190357254|emb|CAQ54678.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|212994921|gb|EEB55563.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
          Length = 208

 Score =  273 bits (698), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 168/197 (85%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P+VVEQT+RGER+YDIYSRL+KERI+FVTG IED+MA++I AQLLFLE+ENP K+I
Sbjct: 1   MTLIPIVVEQTSRGERAYDIYSRLVKERIIFVTGPIEDNMASVIVAQLLFLESENPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGGVVTAG++IYDTMQ+I P +ST C+GQAASMGSLLL+AG +G R++LP++RI
Sbjct: 61  CMYINSPGGVVTAGLSIYDTMQYINPDVSTLCIGQAASMGSLLLTAGAEGKRYSLPHSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG+ GQA+DIE HA +I+++K++LN+IY K+ G + +++E+ ++RD  M   EA
Sbjct: 121 MIHQPSGGYHGQATDIEIHANEILRVKKKLNQIYEKHTGNSLKKIEEMMERDKFMDPEEA 180

Query: 196 CDWGVVDKVLMSRIDIE 212
              G++D+V+  R D++
Sbjct: 181 MKTGLIDRVIAERKDMK 197


>gi|297538721|ref|YP_003674490.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Methylotenera
           sp. 301]
 gi|297258068|gb|ADI29913.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Methylotenera
           sp. 301]
          Length = 219

 Score =  273 bits (698), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 120/195 (61%), Positives = 162/195 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG +PMVVEQ+ RGERSYDIYSRLLKER++F+ G + D  A L+ AQLLFLEAENP K+I
Sbjct: 23  LGYIPMVVEQSGRGERSYDIYSRLLKERVIFLVGPVNDMSANLVVAQLLFLEAENPDKDI 82

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG VTAGM+IYDTMQFIK  +ST C+GQAASMG+ LL+AG KG RF+LPN+R+
Sbjct: 83  SLYINSPGGSVTAGMSIYDTMQFIKADVSTLCIGQAASMGAFLLAAGAKGKRFSLPNSRV 142

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGGF GQ++DIE HA++I+ ++ +LN+I   + GKT  E+++  +RD+ MSA+++
Sbjct: 143 MIHQPSGGFQGQSTDIEIHAKEILYLRAKLNDILAHHTGKTAAEIDRDTERDNFMSATQS 202

Query: 196 CDWGVVDKVLMSRID 210
            ++G++DKV+ SR +
Sbjct: 203 VEYGMIDKVIESRTE 217


>gi|312961789|ref|ZP_07776287.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           fluorescens WH6]
 gi|311284048|gb|EFQ62631.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           fluorescens WH6]
          Length = 211

 Score =  273 bits (698), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 124/192 (64%), Positives = 158/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMVVEQ+ RGER+YDIYSRLLKER++F+ G +ED+MA LICAQLLFLEAENP K+I 
Sbjct: 18  GLVPMVVEQSARGERAYDIYSRLLKERVIFLVGPVEDYMANLICAQLLFLEAENPDKDIH 77

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQA SMG+ LL+AG +G R+ LPN+R++
Sbjct: 78  LYINSPGGSVTAGMSIYDTMQFIKPNVSTTCIGQACSMGAFLLTAGAEGKRYCLPNSRVM 137

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDIE HA++I+ I+ RLN +  K+ G T EE+E+  +RD+ MSA  A 
Sbjct: 138 IHQPLGGFQGQASDIEIHAKEILFIRERLNTLMAKHSGHTLEEIERDTNRDNFMSAEAAR 197

Query: 197 DWGVVDKVLMSR 208
           ++G++D V+  R
Sbjct: 198 EYGLIDAVIEKR 209


>gi|261494048|ref|ZP_05990551.1| S14 family endopeptidase ClpP [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261496191|ref|ZP_05992597.1| S14 family endopeptidase ClpP [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261308143|gb|EEY09440.1| S14 family endopeptidase ClpP [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261310214|gb|EEY11414.1| S14 family endopeptidase ClpP [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 197

 Score =  273 bits (698), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 125/196 (63%), Positives = 162/196 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT++GERSYDIYSRLLKERI+F+ GQ+ED+MA LI AQLLFLEAE+P+K+I
Sbjct: 1   MALVPMVVEQTSKGERSYDIYSRLLKERIIFLNGQVEDNMANLIVAQLLFLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGVVTAG+AIYDTM FIKP ++T C GQAASMG+ LLSAG KG RFALP+ARI
Sbjct: 61  YLYINSPGGVVTAGLAIYDTMNFIKPDVATLCTGQAASMGAFLLSAGAKGKRFALPHARI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI+  A++I+++K  L     ++ G++YE+V    +RD+ MSA EA
Sbjct: 121 MIHQPLGGARGQATDIQIQAEEILRLKATLTHRMAEHSGQSYEKVLADTERDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSRIDI 211
            ++G++DKVL SR ++
Sbjct: 181 AEYGLIDKVLTSRSEV 196


>gi|254361750|ref|ZP_04977885.1| S14 family endopeptidase ClpP [Mannheimia haemolytica PHL213]
 gi|153093285|gb|EDN74281.1| S14 family endopeptidase ClpP [Mannheimia haemolytica PHL213]
          Length = 197

 Score =  273 bits (698), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 125/196 (63%), Positives = 162/196 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT++GERSYDIYSRLLKERI+F+ GQ+ED+MA LI AQLLFLEAE+P+K+I
Sbjct: 1   MALVPMVVEQTSKGERSYDIYSRLLKERIIFLNGQVEDNMANLIVAQLLFLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGVVTAG+AIYDTM FIKP ++T C GQAASMG+ LLSAG KG RFALP+ARI
Sbjct: 61  YLYINSPGGVVTAGLAIYDTMNFIKPDVATLCTGQAASMGAFLLSAGAKGKRFALPHARI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI+  A++I+++K  L     ++ G++YE+V    +RD+ MSA EA
Sbjct: 121 MIHQPLGGARGQATDIQIQAEEILRLKATLTRRMAEHSGQSYEKVLADTERDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSRIDI 211
            ++G++DKVL SR ++
Sbjct: 181 AEYGLIDKVLTSRSEV 196


>gi|114321437|ref|YP_743120.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Alkalilimnicola ehrlichii MLHE-1]
 gi|122311052|sp|Q0A6A7|CLPP_ALHEH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|114227831|gb|ABI57630.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Alkalilimnicola ehrlichii MLHE-1]
          Length = 214

 Score =  273 bits (698), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 156/192 (81%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMVVEQ+ RGER+YDIYSRLLKER++F+ G +EDHMA LI AQLLFLE+ENP K+I 
Sbjct: 17  GLVPMVVEQSARGERAYDIYSRLLKERVIFLVGPVEDHMANLIVAQLLFLESENPDKDIH 76

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           +YINSPGG VTAG+AIYDTMQFIKP +ST C+GQAASMG+LLL+ G KG R+ALPN+R++
Sbjct: 77  IYINSPGGAVTAGLAIYDTMQFIKPDVSTVCIGQAASMGALLLTGGTKGKRYALPNSRMM 136

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQA+D++ HA++I+ ++ RLN I   + G+  E + +  DRD+ MS   AC
Sbjct: 137 IHQPLGGFQGQATDVDIHAREILDMRDRLNRIMAHHTGQDMETIARDTDRDNFMSPDTAC 196

Query: 197 DWGVVDKVLMSR 208
           ++G+VD VL  R
Sbjct: 197 EYGLVDAVLADR 208


>gi|15837789|ref|NP_298477.1| ATP-dependent Clp protease proteolytic subunit [Xylella fastidiosa
           9a5c]
 gi|18203347|sp|Q9PE41|CLPP_XYLFA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|9106157|gb|AAF83997.1|AE003953_1 ATP-dependent Clp protease proteolytic subunit [Xylella fastidiosa
           9a5c]
          Length = 208

 Score =  273 bits (698), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 123/193 (63%), Positives = 162/193 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           L LVPMVVEQT+RGER+YDIYSRLLKER++F+ G I+D+MA LI AQLLFLEAENP+K+I
Sbjct: 8   LNLVPMVVEQTSRGERAYDIYSRLLKERLIFLVGPIDDYMANLIVAQLLFLEAENPEKDI 67

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           ++YINSPGGVVTAGMAIYDTMQ+IKP +ST C+GQAASMG+LLL++G  G R+ALPN+R+
Sbjct: 68  NIYINSPGGVVTAGMAIYDTMQYIKPAVSTICVGQAASMGALLLASGASGKRYALPNSRV 127

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI+ HA++I+ ++ RLNEI  K+ G++ E +    +RD+  SA +A
Sbjct: 128 MIHQPLGGFQGQATDIDIHAREILALRARLNEILAKHTGQSLETIAHDTERDNFKSAVDA 187

Query: 196 CDWGVVDKVLMSR 208
             +G+VD+VL  R
Sbjct: 188 QAYGLVDQVLGQR 200


>gi|254514393|ref|ZP_05126454.1| ATP-dependent Clp protease, proteolytic subunit ClpP [gamma
           proteobacterium NOR5-3]
 gi|219676636|gb|EED33001.1| ATP-dependent Clp protease, proteolytic subunit ClpP [gamma
           proteobacterium NOR5-3]
          Length = 213

 Score =  273 bits (698), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 125/193 (64%), Positives = 158/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVPMVVEQT+RGERSYDIYSRLLKER+VFV GQ+EDHMA LI AQLLFLE+ENP K+I
Sbjct: 15  LGLVPMVVEQTSRGERSYDIYSRLLKERVVFVVGQVEDHMANLIVAQLLFLESENPDKDI 74

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAG++IYDTMQFIKP IST C+GQAASMG+ LLS G KG R+ LPNAR 
Sbjct: 75  HLYINSPGGSVTAGLSIYDTMQFIKPDISTMCLGQAASMGAFLLSGGTKGKRYCLPNART 134

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA+DI+  A++I+ I+ RLN +  ++ G+  E +E+  +RD  M A ++
Sbjct: 135 MIHQPSGGAQGQATDIDIQAKEILIIRERLNRLMAEHTGQPLEVIERDTERDRFMDAEQS 194

Query: 196 CDWGVVDKVLMSR 208
            ++G+VD+V+ +R
Sbjct: 195 KEYGLVDEVVTAR 207


>gi|315499702|ref|YP_004088505.1| endopeptidase clp [Asticcacaulis excentricus CB 48]
 gi|315417714|gb|ADU14354.1| Endopeptidase Clp [Asticcacaulis excentricus CB 48]
          Length = 209

 Score =  273 bits (697), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 125/199 (62%), Positives = 162/199 (81%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E++   L+P V+EQ++RGER+YDIYSR+LKERI+F+TG  ED MAT ICAQLLFLE+ENP
Sbjct: 6   ENLTSYLIPTVIEQSSRGERAYDIYSRMLKERIIFLTGPFEDGMATSICAQLLFLESENP 65

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
           +KEIS+YINSPGG VT+ +AIYDTMQ+IK P++T CMG AAS GSL+L AGE G R +LP
Sbjct: 66  KKEISMYINSPGGQVTSALAIYDTMQYIKSPVTTVCMGMAASAGSLILQAGEAGQRISLP 125

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N++I++HQPSGG  G ASDIE  A+DI K K+ LNEIYVK+ G+ Y+ +E+TLDRD  M+
Sbjct: 126 NSKIMVHQPSGGARGMASDIEIQAEDIRKTKKLLNEIYVKHTGQPYDVIERTLDRDRYMT 185

Query: 192 ASEACDWGVVDKVLMSRID 210
           A+EA ++G++D V   R D
Sbjct: 186 AAEAKEFGLIDHVYEKRTD 204


>gi|152995749|ref|YP_001340584.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Marinomonas
           sp. MWYL1]
 gi|254763795|sp|A6VW20|CLPP_MARMS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|150836673|gb|ABR70649.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Marinomonas
           sp. MWYL1]
          Length = 210

 Score =  273 bits (697), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 156/192 (81%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMV+EQT RGERS+DIYSRLLKER++F+ GQ+EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 17  GLVPMVIEQTARGERSFDIYSRLLKERVIFLVGQVEDHMANLVVAQLLFLESENPDKDIH 76

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQAASMG+LLL+AG  G R+ LPN+R++
Sbjct: 77  LYINSPGGSVTAGMSIYDTMQFIKPDVSTMCIGQAASMGALLLTAGAAGKRYCLPNSRVM 136

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG+ GQASDIE H ++I+ IK +LNEI   + GK  E+V    DRD+ M+   A 
Sbjct: 137 IHQPLGGYQGQASDIEIHTREILSIKHKLNEIISFHTGKPIEQVALDTDRDNFMNPQTAK 196

Query: 197 DWGVVDKVLMSR 208
           D+G++D++L  R
Sbjct: 197 DYGLIDEILQKR 208


>gi|326795825|ref|YP_004313645.1| ATP-dependent Clp protease proteolytic subunit [Marinomonas
           mediterranea MMB-1]
 gi|326546589|gb|ADZ91809.1| ATP-dependent Clp protease proteolytic subunit [Marinomonas
           mediterranea MMB-1]
          Length = 210

 Score =  273 bits (697), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 157/193 (81%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMV+EQT RGERS+DIYSRLLKER++F+ GQ+EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 17  GLVPMVIEQTARGERSFDIYSRLLKERVIFLVGQVEDHMANLVVAQLLFLESENPDKDIH 76

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQAASMG+LLL+AG  G R+ LPN+R++
Sbjct: 77  LYINSPGGSVTAGMSIYDTMQFIKPDVSTMCIGQAASMGALLLTAGAAGKRYCLPNSRVM 136

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG+ GQASDIE H ++I+ IK RLNEI   + G+  E+V +  DRD+ M+   A 
Sbjct: 137 IHQPLGGYQGQASDIEIHTREILSIKHRLNEIIAHHTGQPIEKVAEDTDRDNFMNPESAK 196

Query: 197 DWGVVDKVLMSRI 209
           ++G++D +L  R+
Sbjct: 197 EYGLIDDILEKRL 209


>gi|254282219|ref|ZP_04957187.1| ATP-dependent Clp protease, proteolytic subunit ClpP [gamma
           proteobacterium NOR51-B]
 gi|219678422|gb|EED34771.1| ATP-dependent Clp protease, proteolytic subunit ClpP [gamma
           proteobacterium NOR51-B]
          Length = 220

 Score =  273 bits (697), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 122/194 (62%), Positives = 159/194 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVPMV+EQT+RGERS+DIYSRLLKER++FV G IEDHMA LI AQLLFLE+ENP K+I
Sbjct: 22  LGLVPMVIEQTSRGERSFDIYSRLLKERVIFVVGGIEDHMANLIVAQLLFLESENPDKDI 81

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGG VTAG++IYDTMQF+KP +ST C+GQAASMG+ LLS G KG R+ LPNAR 
Sbjct: 82  HIYINSPGGSVTAGLSIYDTMQFVKPDVSTMCIGQAASMGAFLLSGGAKGKRYILPNART 141

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQASDIE  A++I+ ++ RLN +   + G+T E +E+  +RD  MSA ++
Sbjct: 142 MIHQPSGGAQGQASDIEIQAKEILYLRERLNRLMADHTGQTLETIERDTERDRFMSAEQS 201

Query: 196 CDWGVVDKVLMSRI 209
            ++G+VD+V+ +R+
Sbjct: 202 VEYGLVDEVVENRV 215


>gi|190892539|ref|YP_001979081.1| endopeptidase Clp protein, subunit 1 [Rhizobium etli CIAT 652]
 gi|218516193|ref|ZP_03513033.1| ATP-dependent Clp protease proteolytic subunit [Rhizobium etli
           8C-3]
 gi|190697818|gb|ACE91903.1| endopeptidase Clp protein, subunit 1 [Rhizobium etli CIAT 652]
          Length = 203

 Score =  272 bits (696), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 119/193 (61%), Positives = 158/193 (81%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMV+EQ++RGERS+DIYSRLL+ERI+F+ G++ D ++ L+CAQLLFLEAENP K I+L
Sbjct: 7   LVPMVIEQSSRGERSFDIYSRLLRERIIFLNGEVNDTVSALVCAQLLFLEAENPNKPINL 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VT+G+A+YDTM+FI  P+ T CMG A SMGS LL AGE G R ALPNA IL+
Sbjct: 67  YINSPGGAVTSGLAMYDTMRFIHAPVHTLCMGTARSMGSFLLMAGEPGERAALPNASILI 126

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGGF GQASD+  HA++I+K K+R+  +Y ++CG++YE+ E+ +DRD  M+A EA +
Sbjct: 127 HQPSGGFQGQASDMLIHAEEILKTKQRMTRLYAEHCGRSYEDFERGMDRDRFMTAEEALE 186

Query: 198 WGVVDKVLMSRID 210
           WG++D++L  R D
Sbjct: 187 WGLIDRILKVRED 199


>gi|88705172|ref|ZP_01102884.1| ATP-dependent Clp protease, proteolytic subunit [Congregibacter
           litoralis KT71]
 gi|88700867|gb|EAQ97974.1| ATP-dependent Clp protease, proteolytic subunit [Congregibacter
           litoralis KT71]
          Length = 206

 Score =  272 bits (696), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 125/193 (64%), Positives = 158/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVPMVVEQT+RGERSYDIYSRLLKER+VFV GQ+EDHMA LI AQLLFLE+ENP K+I
Sbjct: 8   LGLVPMVVEQTSRGERSYDIYSRLLKERVVFVVGQVEDHMANLIVAQLLFLESENPDKDI 67

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAG++IYDTMQFIKP IST C+GQAASMG+ LLS G KG R+ LPNAR 
Sbjct: 68  HLYINSPGGSVTAGLSIYDTMQFIKPDISTMCLGQAASMGAFLLSGGTKGKRYCLPNART 127

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA+DI+  A++I+ I+ RLN +  ++ G+  E +E+  +RD  M A ++
Sbjct: 128 MIHQPSGGAQGQATDIDIQAKEILIIRERLNRLMAEHTGQPLEVIERDTERDRFMDAEQS 187

Query: 196 CDWGVVDKVLMSR 208
            ++G+VD+V+ +R
Sbjct: 188 KEYGLVDEVVTAR 200


>gi|77360986|ref|YP_340561.1| ATP-dependent Clp protease proteolytic subunit [Pseudoalteromonas
           haloplanktis TAC125]
 gi|110816463|sp|Q3IF46|CLPP_PSEHT RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|76875897|emb|CAI87118.1| ATP-dependent Clp protease proteolytic subunit (Endopeptidase Clp)
           (Caseinolytic protease) (Protease Ti)(Heat shock protein
           F21.5) [Pseudoalteromonas haloplanktis TAC125]
          Length = 205

 Score =  272 bits (696), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 125/196 (63%), Positives = 156/196 (79%)

Query: 13  DVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQ 72
           D    LVPMVVEQT +GERSYDIYSRLLKERI+F+TG +ED+MA LI AQ+LFLE+ENP 
Sbjct: 7   DPLNALVPMVVEQTPKGERSYDIYSRLLKERIIFLTGPVEDNMANLILAQMLFLESENPD 66

Query: 73  KEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPN 132
           K+I LYINSPGG VTAGMAIYDTM FIKP +ST C+GQAASMG+ LL+AG KG RF LPN
Sbjct: 67  KDIFLYINSPGGSVTAGMAIYDTMNFIKPDVSTICVGQAASMGAFLLTAGAKGKRFCLPN 126

Query: 133 ARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSA 192
           +R+++HQP GGF GQASD E HA++I+ IK +LN +  ++ G+  + + K  DRD+ MSA
Sbjct: 127 SRVMIHQPLGGFQGQASDFEIHAKEILSIKDKLNRLMAEHTGQPLDVISKDTDRDNFMSA 186

Query: 193 SEACDWGVVDKVLMSR 208
            +A D+G+VD V  +R
Sbjct: 187 DQAVDYGIVDSVFKNR 202


>gi|118602249|ref|YP_903464.1| ATP-dependent Clp protease proteolytic subunit [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
 gi|166214707|sp|A1AVN6|CLPP_RUTMC RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|118567188|gb|ABL01993.1| ATP-dependent Clp protease proteolytic subunit ClpP [Candidatus
           Ruthia magnifica str. Cm (Calyptogena magnifica)]
          Length = 198

 Score =  272 bits (696), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 161/193 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           L  +P+VVEQ+ RGER+YDIYSRLLKERI+F+ G IED+MA ++ AQLLFLE+ENP ++I
Sbjct: 6   LNQIPIVVEQSARGERAYDIYSRLLKERIIFLVGPIEDYMANVVVAQLLFLESENPDQDI 65

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG+V+AG+AIYDTMQFIKP +ST C+GQAASMG+LLL+AG K  RFALPN R 
Sbjct: 66  HLYINSPGGLVSAGLAIYDTMQFIKPDVSTLCIGQAASMGALLLTAGAKDKRFALPNVRC 125

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGFSGQASDI+ HAQ+I+K++ +LN+I+  +  +T + ++K  DRD+ MSA+EA
Sbjct: 126 MIHQPLGGFSGQASDIDIHAQEILKVREKLNQIFKLHTSQTIKTIQKDTDRDNFMSANEA 185

Query: 196 CDWGVVDKVLMSR 208
             +G++DKVL  R
Sbjct: 186 TKYGLIDKVLAKR 198


>gi|220934115|ref|YP_002513014.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995425|gb|ACL72027.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Thioalkalivibrio sp. HL-EbGR7]
          Length = 216

 Score =  272 bits (696), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 166/209 (79%), Gaps = 1/209 (0%)

Query: 1   MSFEGCAKKDSEDV-FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLI 59
           MS +G   + + D   L LVPMVVEQT RGER+YDIYSRLLKER++F  G +ED+MA +I
Sbjct: 1   MSNQGIGDRGALDTRALNLVPMVVEQTARGERAYDIYSRLLKERVIFAVGPVEDYMANVI 60

Query: 60  CAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLL 119
            AQLLFLE+ENP K+ISLYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG++LL
Sbjct: 61  VAQLLFLESENPDKDISLYINSPGGAVTAGMAIYDTMQFIKPDVSTLCIGQAASMGAVLL 120

Query: 120 SAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEE 179
           + G KG RF LP++R+++HQP GGF GQA+DI+ HA++I+K++  LN I   + G++ E+
Sbjct: 121 AGGAKGKRFCLPHSRVMIHQPLGGFQGQATDIDIHAREILKVRAELNRILAHHTGQSIEQ 180

Query: 180 VEKTLDRDHIMSASEACDWGVVDKVLMSR 208
           +E+  +RD  ++  EA ++G++D+VL SR
Sbjct: 181 IEQDTERDRFLNPVEAAEYGLIDQVLSSR 209


>gi|262373455|ref|ZP_06066733.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Acinetobacter
           junii SH205]
 gi|262311208|gb|EEY92294.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Acinetobacter
           junii SH205]
          Length = 201

 Score =  272 bits (696), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 124/192 (64%), Positives = 159/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVP+VVEQ++RGERS+DIYSRLL+ER++F+TG++ED+MA LI AQ+LFLEAENP+K+I 
Sbjct: 9   ALVPVVVEQSSRGERSFDIYSRLLRERVIFLTGEVEDNMANLIVAQMLFLEAENPEKDIH 68

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGMAIYDTMQFIKP + T+CMGQAASMG+ LL+AG KG R+ L NAR++
Sbjct: 69  LYINSPGGSVTAGMAIYDTMQFIKPDVVTYCMGQAASMGAFLLNAGAKGKRYCLENARVM 128

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDIE HA++I+ IK RLN +  ++ G+ YE V +  DRD+ M+A  A 
Sbjct: 129 IHQPLGGFRGQASDIEIHAREILFIKERLNRLMAQHSGQDYETVARDTDRDNFMTAEAAK 188

Query: 197 DWGVVDKVLMSR 208
            +G+VD+VL  R
Sbjct: 189 QYGLVDQVLSKR 200


>gi|260913095|ref|ZP_05919577.1| ATP-dependent Clp protease [Pasteurella dagmatis ATCC 43325]
 gi|260632682|gb|EEX50851.1| ATP-dependent Clp protease [Pasteurella dagmatis ATCC 43325]
          Length = 193

 Score =  272 bits (696), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 160/193 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++PMVVEQT+RGERSYDIYSRLLKER++F++G++ED MA LI AQLLFLE+E+P+K+I
Sbjct: 1   MSVIPMVVEQTSRGERSYDIYSRLLKERVIFLSGEVEDRMANLIVAQLLFLESEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           ++YINSPGG VTAGMAIYDTMQFIKP I T C+GQA SMG+ LL+ G  G R ALPNAR+
Sbjct: 61  NIYINSPGGSVTAGMAIYDTMQFIKPDIRTLCVGQACSMGAFLLAGGTAGKRIALPNARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI+ HAQ+I+KIK+ LNE    + G++ E +E+  DRD+ MSA EA
Sbjct: 121 MIHQPLGGFRGQASDIQIHAQEILKIKQTLNERLAFHTGQSIERIERDTDRDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G+VD+VL+ R
Sbjct: 181 KAYGLVDEVLVKR 193


>gi|262280902|ref|ZP_06058685.1| ATP-dependent Clp protease proteolytic subunit [Acinetobacter
           calcoaceticus RUH2202]
 gi|299771640|ref|YP_003733666.1| ATP-dependent Clp protease proteolytic subunit [Acinetobacter sp.
           DR1]
 gi|262257802|gb|EEY76537.1| ATP-dependent Clp protease proteolytic subunit [Acinetobacter
           calcoaceticus RUH2202]
 gi|298701728|gb|ADI92293.1| ATP-dependent Clp protease proteolytic subunit [Acinetobacter sp.
           DR1]
          Length = 201

 Score =  272 bits (696), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 124/192 (64%), Positives = 159/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVP+VVEQ++RGERS+DIYSRLL+ER++F+TG++ED+MA LI AQ+LFLEAENP K+I 
Sbjct: 9   ALVPVVVEQSSRGERSFDIYSRLLRERVIFLTGEVEDNMANLIVAQMLFLEAENPDKDIH 68

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGMAIYDTMQFIKP + T+CMGQAASMG+ LL+AG KG R+ L NAR++
Sbjct: 69  LYINSPGGSVTAGMAIYDTMQFIKPDVVTYCMGQAASMGAFLLNAGAKGKRYCLENARVM 128

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDIE HA++I+ IK RLN +  ++ G+ YE V +  DRD+ M+A  A 
Sbjct: 129 IHQPLGGFRGQASDIEIHAREILFIKERLNRLMAEHSGQDYETVARDTDRDNFMTAQSAK 188

Query: 197 DWGVVDKVLMSR 208
           ++G+VD+VL  R
Sbjct: 189 EYGLVDQVLSKR 200


>gi|148284741|ref|YP_001248831.1| ATP-dependent protease proteolytic subunit [Orientia tsutsugamushi
           str. Boryong]
 gi|189183283|ref|YP_001937068.1| ATP-dependent Clp protease proteolytic subunit [Orientia
           tsutsugamushi str. Ikeda]
 gi|146740180|emb|CAM80416.1| ATP-dependent protease proteolytic subunit [Orientia tsutsugamushi
           str. Boryong]
 gi|189180054|dbj|BAG39834.1| ATP-dependent Clp protease proteolytic subunit [Orientia
           tsutsugamushi str. Ikeda]
          Length = 206

 Score =  272 bits (696), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 123/196 (62%), Positives = 160/196 (81%)

Query: 19  VPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLY 78
           VPMVVEQTNRGER+YDIYSRLLKERIVFV G+IEDHMA L+ AQLLFLEAE+P K+I +Y
Sbjct: 10  VPMVVEQTNRGERAYDIYSRLLKERIVFVCGEIEDHMANLVVAQLLFLEAESPDKKIFMY 69

Query: 79  INSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLH 138
           INSPGG VTAGMAIYDTMQ+IK P+ T C+GQA SMGSLLL+AG+K MR  LPN+RI++H
Sbjct: 70  INSPGGAVTAGMAIYDTMQYIKSPVLTLCLGQACSMGSLLLAAGQKSMRHCLPNSRIMIH 129

Query: 139 QPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDW 198
           QPSGGF GQA+DI+ HAQ+I+K+K+ +N +YV +  +  + +E++++RD+ M    A ++
Sbjct: 130 QPSGGFRGQATDIQIHAQEILKMKKIINNLYVHHTNQPLQVIEESMERDNFMDPVAAKEF 189

Query: 199 GVVDKVLMSRIDIEEK 214
           G+VD +   R  + E+
Sbjct: 190 GLVDHITTERAQVAER 205


>gi|146307078|ref|YP_001187543.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           mendocina ymp]
 gi|166214700|sp|A4XTZ5|CLPP_PSEMY RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|145575279|gb|ABP84811.1| ATP-dependent Clp protease proteolytic subunit ClpP [Pseudomonas
           mendocina ymp]
          Length = 213

 Score =  272 bits (696), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 155/188 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMV+EQ+ RGER+YDIYSRLLKER++F+ GQ+ED+MA LICAQLLFLEAENP K+I 
Sbjct: 18  GLVPMVIEQSARGERAYDIYSRLLKERVIFLVGQVEDYMANLICAQLLFLEAENPDKDIH 77

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGMAIYDTMQFIK  +ST C+GQA SMG+ LL+ G KG RF LPN+R++
Sbjct: 78  LYINSPGGSVTAGMAIYDTMQFIKADVSTTCIGQACSMGAFLLAGGAKGKRFCLPNSRVM 137

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDIE HA++I+ I+ RLNE+   + G++ E +E+  +RD+ MSA  A 
Sbjct: 138 IHQPLGGFQGQASDIEIHAKEILFIRERLNELLAHHTGQSLETIERDTNRDNFMSAPRAV 197

Query: 197 DWGVVDKV 204
           ++G+VD V
Sbjct: 198 EYGIVDAV 205


>gi|300311895|ref|YP_003775987.1| ATP-dependent Clp protease proteolytic subunit [Herbaspirillum
           seropedicae SmR1]
 gi|124483356|emb|CAM32551.1| ATP-dependent Clp protease (proteolytic subunit) protein
           [Herbaspirillum seropedicae]
 gi|300074680|gb|ADJ64079.1| ATP-dependent Clp protease (proteolytic subunit) protein
           [Herbaspirillum seropedicae SmR1]
          Length = 208

 Score =  272 bits (695), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 160/205 (78%), Gaps = 1/205 (0%)

Query: 5   GCAKKDSEDV-FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQL 63
           G  K+ + D   LG+VPMV+EQ+ RGER+YDIYSRLLKERI+F+ G + D MA LI AQL
Sbjct: 3   GLMKQSALDTQMLGMVPMVIEQSGRGERAYDIYSRLLKERIIFLVGPVNDAMANLIVAQL 62

Query: 64  LFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGE 123
           LFLE+ENP K+ISLYINSPGG V+AGMAI+DTMQFIKP +ST C G AASMG+ LL+AG 
Sbjct: 63  LFLESENPDKDISLYINSPGGSVSAGMAIFDTMQFIKPQVSTLCTGLAASMGAFLLAAGA 122

Query: 124 KGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKT 183
           KG RF+LPN+RI++HQP GG  GQASDIE  A++I+ ++ RLN I  +  G+T E++ K 
Sbjct: 123 KGKRFSLPNSRIMIHQPLGGAQGQASDIEIQAREILYLRERLNTILAEKTGRTVEQISKD 182

Query: 184 LDRDHIMSASEACDWGVVDKVLMSR 208
            DRD+ MSA  A ++G++DKVL  R
Sbjct: 183 TDRDNFMSADAAAEYGLIDKVLTER 207


>gi|329850562|ref|ZP_08265407.1| clp protease family protein [Asticcacaulis biprosthecum C19]
 gi|328840877|gb|EGF90448.1| clp protease family protein [Asticcacaulis biprosthecum C19]
          Length = 208

 Score =  272 bits (695), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 158/193 (81%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           L+P V+EQ++RGER+YDIYSR+LKERI+F+TG  ED MAT ICAQLLFLE+ENP+KEIS+
Sbjct: 12  LIPTVIEQSSRGERAYDIYSRMLKERIIFLTGPFEDGMATSICAQLLFLESENPKKEISM 71

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VT+ +AIYDTMQ+IK P++T CMG AAS GSL+L AGE G R +LPN++I++
Sbjct: 72  YINSPGGQVTSALAIYDTMQYIKSPVTTVCMGMAASAGSLILQAGENGQRISLPNSKIMV 131

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGG  G ASDIE  A+D+ K K+ LNEIYVK+ G+ YE +E+TLDRD  M+A EA +
Sbjct: 132 HQPSGGARGMASDIEIQAEDMRKTKKLLNEIYVKHTGQPYEVIERTLDRDRYMTAEEAKE 191

Query: 198 WGVVDKVLMSRID 210
           +G++D V   R D
Sbjct: 192 FGLIDHVYEKRAD 204


>gi|319789118|ref|YP_004150751.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Thermovibrio
           ammonificans HB-1]
 gi|317113620|gb|ADU96110.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Thermovibrio
           ammonificans HB-1]
          Length = 200

 Score =  272 bits (695), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 126/197 (63%), Positives = 163/197 (82%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E++    VP+V+EQT RGER+YDIYSRLLK+RIV +   I+DH+A LI AQLLFLEAE+P
Sbjct: 2   EEILNQFVPIVIEQTGRGERAYDIYSRLLKDRIVMLGTPIDDHVANLIVAQLLFLEAEDP 61

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
           +K+I LYINSPGGVVTAG+AIYDTMQ+IKP + T CMGQAASMG++LL+AG KG RFALP
Sbjct: 62  EKDIYLYINSPGGVVTAGLAIYDTMQYIKPDVVTICMGQAASMGAVLLAAGAKGKRFALP 121

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           +ARI++HQP GGF GQA+DIE HA++I+++KR LNEI  K+  +  E+VE+  +RD+ MS
Sbjct: 122 HARIMIHQPLGGFQGQATDIEIHAKEILRLKRMLNEILAKHTRQPVEKVEQDTERDYFMS 181

Query: 192 ASEACDWGVVDKVLMSR 208
           A EA ++G++DKVL  R
Sbjct: 182 AEEAKEYGLIDKVLTRR 198


>gi|293610272|ref|ZP_06692573.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827504|gb|EFF85868.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325124452|gb|ADY83975.1| ATP-dependent Clp protease proteolytic subunit [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 201

 Score =  272 bits (695), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 124/192 (64%), Positives = 159/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVP+VVEQ++RGERS+DIYSRLL+ER++F+TG++ED+MA LI AQ+LFLEAENP K+I 
Sbjct: 9   ALVPVVVEQSSRGERSFDIYSRLLRERVIFLTGEVEDNMANLIVAQMLFLEAENPDKDIH 68

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGMAIYDTMQFIKP + T+CMGQAASMG+ LL+AG KG R+ L NAR++
Sbjct: 69  LYINSPGGSVTAGMAIYDTMQFIKPDVVTYCMGQAASMGAFLLNAGAKGKRYCLENARVM 128

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDIE HA++I+ IK RLN +  ++ G+ YE V +  DRD+ M+A  A 
Sbjct: 129 IHQPLGGFRGQASDIEIHAREILFIKERLNRLMAEHSGQDYETVARDTDRDNFMTAQAAK 188

Query: 197 DWGVVDKVLMSR 208
           ++G+VD+VL  R
Sbjct: 189 EYGLVDQVLSKR 200


>gi|15966977|ref|NP_387330.1| ATP-dependent Clp protease proteolytic subunit [Sinorhizobium
           meliloti 1021]
 gi|307302445|ref|ZP_07582202.1| Endopeptidase Clp [Sinorhizobium meliloti BL225C]
 gi|307316225|ref|ZP_07595669.1| Endopeptidase Clp [Sinorhizobium meliloti AK83]
 gi|18202305|sp|P58277|CLPP1_RHIME RecName: Full=ATP-dependent Clp protease proteolytic subunit 1;
           AltName: Full=Endopeptidase Clp 1
 gi|15076250|emb|CAC47803.1| Probable ATP-dependent CLP protease proteolytic subunit
           [Sinorhizobium meliloti 1021]
 gi|306898065|gb|EFN28807.1| Endopeptidase Clp [Sinorhizobium meliloti AK83]
 gi|306903115|gb|EFN33705.1| Endopeptidase Clp [Sinorhizobium meliloti BL225C]
          Length = 205

 Score =  272 bits (695), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 118/191 (61%), Positives = 156/191 (81%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQ++RGERS+DIYSRLL+ERI+F+ G++ D ++ L+CAQLLFLEAE+P+K I L
Sbjct: 7   LVPMVVEQSSRGERSFDIYSRLLRERIIFLNGEVNDAVSALVCAQLLFLEAESPKKPIQL 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G A+YDTM++I+ P+ T CMG A SMGS LL AGE G R ALPNA IL+
Sbjct: 67  YINSPGGVVTSGFAMYDTMRYIRAPVHTLCMGTARSMGSFLLMAGEAGERTALPNASILV 126

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGGF GQASD+  HA++I + K R+  +Y ++CG+TYEE E+ +DRD  M+A EA +
Sbjct: 127 HQPSGGFQGQASDMLIHAEEIRRTKHRMTRLYAEHCGRTYEEFERAMDRDRFMTAEEALE 186

Query: 198 WGVVDKVLMSR 208
           WG++D+++  R
Sbjct: 187 WGLIDRIITER 197


>gi|116250938|ref|YP_766776.1| ATP-dependent Clp protease proteolytic subunit [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|116243107|sp|Q1MK43|CLPP1_RHIL3 RecName: Full=ATP-dependent Clp protease proteolytic subunit 1;
           AltName: Full=Endopeptidase Clp 1
 gi|115255586|emb|CAK06667.1| putative ATP-dependent Clp protease proteolytic subunit [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 203

 Score =  272 bits (695), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 118/191 (61%), Positives = 159/191 (83%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMV+EQ++RGERS+DIYSRLL+ERI+F+ G++ D ++ L+CAQLLFLEAEN +K I+L
Sbjct: 7   LVPMVIEQSSRGERSFDIYSRLLRERIIFLNGEVNDTVSALVCAQLLFLEAENSKKPINL 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G+A+YDTM+FI+ P+ T CMG A SMGS LL AGE G R ALPNA IL+
Sbjct: 67  YINSPGGVVTSGLAMYDTMRFIRAPVHTLCMGTARSMGSFLLMAGEAGGRAALPNASILI 126

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGGF GQASD+  HA++I+K K+R+  +Y ++CG++YE+ E+ +DRD  M+A EA +
Sbjct: 127 HQPSGGFQGQASDMMIHAEEILKTKQRMTRLYAEHCGRSYEDFERGMDRDRFMTAEEALE 186

Query: 198 WGVVDKVLMSR 208
           WG++D++L  R
Sbjct: 187 WGLIDRILTVR 197


>gi|28198386|ref|NP_778700.1| ATP-dependent Clp protease proteolytic subunit [Xylella fastidiosa
           Temecula1]
 gi|182681028|ref|YP_001829188.1| ATP-dependent Clp protease proteolytic subunit [Xylella fastidiosa
           M23]
 gi|32129456|sp|Q87E51|CLPP_XYLFT RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|226706560|sp|B2I8K3|CLPP_XYLF2 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|28056456|gb|AAO28349.1| ATP-dependent Clp protease proteolytic subunit [Xylella fastidiosa
           Temecula1]
 gi|182631138|gb|ACB91914.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Xylella
           fastidiosa M23]
 gi|307579496|gb|ADN63465.1| ATP-dependent Clp protease proteolytic subunit [Xylella fastidiosa
           subsp. fastidiosa GB514]
          Length = 208

 Score =  272 bits (695), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 161/193 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           L LVPMVVEQT+RGER+YDIYSRLLKER++F+ G I+D+MA LI AQLLFLEAENP+K+I
Sbjct: 8   LNLVPMVVEQTSRGERAYDIYSRLLKERLIFLVGPIDDYMANLIVAQLLFLEAENPEKDI 67

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           ++YINSPGGVVTAGMAIYDTMQ+IKP +ST C+GQAASMG+LLL++G  G R+ALPN+R+
Sbjct: 68  NIYINSPGGVVTAGMAIYDTMQYIKPAVSTICVGQAASMGALLLASGASGKRYALPNSRV 127

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI+ HA++I+ ++ RLNEI  K+ G++ E +    +RD+  SA +A
Sbjct: 128 MIHQPLGGFQGQATDIDIHAREILALRARLNEILAKHTGQSLETIAHDTERDNFKSAVDA 187

Query: 196 CDWGVVDKVLMSR 208
             +G+VD+V   R
Sbjct: 188 QAYGLVDQVFGQR 200


>gi|262369923|ref|ZP_06063250.1| ATP-dependent Clp protease proteolytic subunit [Acinetobacter
           johnsonii SH046]
 gi|262314962|gb|EEY96002.1| ATP-dependent Clp protease proteolytic subunit [Acinetobacter
           johnsonii SH046]
          Length = 201

 Score =  271 bits (694), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 124/192 (64%), Positives = 159/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQ++RGERS+DIYSRLL+ER++F+TG++ED+MA LI AQ+LFLEAENP K+I 
Sbjct: 9   ALVPMVVEQSSRGERSFDIYSRLLRERVIFMTGEVEDNMANLIVAQMLFLEAENPDKDIH 68

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGMAIYDTMQFIKP + T+CMGQAASMG+ LL++G KG R+ L NAR++
Sbjct: 69  LYINSPGGSVTAGMAIYDTMQFIKPDVVTYCMGQAASMGAFLLNSGAKGKRYCLENARVM 128

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDIE HA++I+ IK RLN +  ++ G+ YE V +  DRD+ M+A  A 
Sbjct: 129 IHQPLGGFRGQASDIEIHAREILFIKERLNRLMAEHSGQDYETVARDTDRDNFMTAQAAK 188

Query: 197 DWGVVDKVLMSR 208
           ++G+VD+VL  R
Sbjct: 189 EYGLVDEVLSKR 200


>gi|323144789|ref|ZP_08079363.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Succinatimonas hippei YIT 12066]
 gi|322415435|gb|EFY06195.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Succinatimonas hippei YIT 12066]
          Length = 200

 Score =  271 bits (694), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 159/194 (81%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMV+EQT RGERS+DIYSRLLKER++F+TG++EDHMA LI AQLLFLE+++P K+I L
Sbjct: 5   LVPMVIEQTARGERSFDIYSRLLKERVIFMTGEVEDHMADLIVAQLLFLESDDPDKDIYL 64

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVTAGMAIYDTMQ+IKP + T CMGQA SMGS LL+ G  G RFALP++RI++
Sbjct: 65  YINSPGGVVTAGMAIYDTMQYIKPDVCTLCMGQACSMGSFLLAGGAPGKRFALPHSRIMI 124

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQASDI  HA++  ++KR L E+  K+ GK+ +EV +  DRD+ MSA EA  
Sbjct: 125 HQPLGGFKGQASDIMIHARETERVKRTLTELLAKHTGKSVDEVMQDCDRDNFMSAEEALA 184

Query: 198 WGVVDKVLMSRIDI 211
           +G++D+V+ SR +I
Sbjct: 185 YGLIDRVITSRDEI 198


>gi|329894939|ref|ZP_08270738.1| ATP-dependent Clp protease proteolytic subunit [gamma
           proteobacterium IMCC3088]
 gi|328922668|gb|EGG30003.1| ATP-dependent Clp protease proteolytic subunit [gamma
           proteobacterium IMCC3088]
          Length = 200

 Score =  271 bits (694), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 123/193 (63%), Positives = 160/193 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGL+PMVVEQT+RGERSYDIYSRLLKER++FV GQ+EDHMA LI AQLLFLE+ENP K+I
Sbjct: 7   LGLIPMVVEQTSRGERSYDIYSRLLKERVIFVVGQVEDHMANLIVAQLLFLESENPDKDI 66

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAG+AIYDTM+FIKP ++T CMGQAASMG+ LLSAG KG R+ LPNAR 
Sbjct: 67  HLYINSPGGSVTAGLAIYDTMKFIKPDVTTTCMGQAASMGAFLLSAGAKGKRYCLPNART 126

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA+DI+  A++I+ I+ RLN +  ++ G+  + +E+  +RD  M+A ++
Sbjct: 127 MIHQPSGGAQGQATDIDIQAKEILIIRERLNRLMAEHTGQPIDVIERDTERDRFMNAEQS 186

Query: 196 CDWGVVDKVLMSR 208
            ++G+VD+V+ SR
Sbjct: 187 KEYGLVDEVVSSR 199


>gi|212704616|ref|ZP_03312744.1| hypothetical protein DESPIG_02679 [Desulfovibrio piger ATCC 29098]
 gi|212672015|gb|EEB32498.1| hypothetical protein DESPIG_02679 [Desulfovibrio piger ATCC 29098]
          Length = 200

 Score =  271 bits (694), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 170/200 (85%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMV+E T R ER+YDIYSRLLK+RI+ ++ ++ D +A+L+CAQLLFLE+++P+KEI
Sbjct: 1   MSLVPMVIETTGRSERAYDIYSRLLKDRIILLSSEVNDTVASLVCAQLLFLESQDPEKEI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           +LYINSPGG VTAG+AIYDTM++I  P+ST CMG+AASMG+ LL+AG+KGMR+ALPN++I
Sbjct: 61  NLYINSPGGSVTAGLAIYDTMRYITAPVSTVCMGRAASMGAFLLAAGQKGMRYALPNSQI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+D++ HA+++++IK RLN +  +N GK+Y+EV +  +RD+ ++  +A
Sbjct: 121 MIHQPLGGFQGQATDVDIHAREMLRIKERLNTMLAENTGKSYDEVVRATERDNFLTPEQA 180

Query: 196 CDWGVVDKVLMSRIDIEEKS 215
            ++G++D+VL+SR D+ EK+
Sbjct: 181 LEFGIIDRVLVSRSDMTEKN 200


>gi|254480762|ref|ZP_05094009.1| ATP-dependent Clp protease, proteolytic subunit ClpP [marine gamma
           proteobacterium HTCC2148]
 gi|214039345|gb|EEB80005.1| ATP-dependent Clp protease, proteolytic subunit ClpP [marine gamma
           proteobacterium HTCC2148]
          Length = 213

 Score =  271 bits (694), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 158/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVPMVVEQT+RGERSYDIYSRLLKER++FV GQ+EDHMA LI AQLLFLE+ENP K+I
Sbjct: 16  LGLVPMVVEQTSRGERSYDIYSRLLKERVIFVVGQVEDHMANLIVAQLLFLESENPDKDI 75

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAG++IYDTMQFIKP +ST C+GQAASMG+ LL  G KG R+ LPNAR 
Sbjct: 76  HLYINSPGGSVTAGLSIYDTMQFIKPDVSTMCLGQAASMGAFLLCGGAKGKRYCLPNART 135

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA+DIE  A++I+ I+ +LN++  ++ G+  E +E+  +RD  M+A E+
Sbjct: 136 MIHQPSGGAQGQATDIEIQAKEILIIREKLNQLMAEHTGQPLEVIERDTERDRFMNAEES 195

Query: 196 CDWGVVDKVLMSR 208
             +G+VD+V+ SR
Sbjct: 196 TAYGLVDEVVTSR 208


>gi|325577258|ref|ZP_08147742.1| ATP-dependent Clp protease, protease subunit [Haemophilus
           parainfluenzae ATCC 33392]
 gi|325160840|gb|EGC72961.1| ATP-dependent Clp protease, protease subunit [Haemophilus
           parainfluenzae ATCC 33392]
          Length = 193

 Score =  271 bits (693), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 159/193 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++PMVVEQT+RGERSYDIYSRLLKER++F++G++ED MA LI AQLLFLE+E+P+K+I
Sbjct: 1   MSVIPMVVEQTSRGERSYDIYSRLLKERVIFLSGEVEDRMANLIVAQLLFLESEDPKKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           ++YINSPGG VTAGMAIYDTMQFIKP + T C+GQA SMG+ LL+ G  G R ALPNAR+
Sbjct: 61  NIYINSPGGSVTAGMAIYDTMQFIKPDVRTLCIGQACSMGAFLLAGGTAGKRAALPNARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI+ HAQ+I+KIK+ LNE    + G++ E +EK  DRD+ MSA EA
Sbjct: 121 MIHQPLGGFRGQASDIQIHAQEILKIKQTLNERLAFHTGQSIERIEKDTDRDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G+VD VL+ R
Sbjct: 181 KAYGLVDDVLIKR 193


>gi|226953943|ref|ZP_03824407.1| ATP-dependent Clp protease proteolytic subunit [Acinetobacter sp.
           ATCC 27244]
 gi|294651552|ref|ZP_06728861.1| ATP-dependent Clp protease proteolytic subunit [Acinetobacter
           haemolyticus ATCC 19194]
 gi|226835297|gb|EEH67680.1| ATP-dependent Clp protease proteolytic subunit [Acinetobacter sp.
           ATCC 27244]
 gi|292822575|gb|EFF81469.1| ATP-dependent Clp protease proteolytic subunit [Acinetobacter
           haemolyticus ATCC 19194]
          Length = 201

 Score =  271 bits (693), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 160/192 (83%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVP+VVEQ++RGERS+DI+SRLL+ER++F+TG++ED+MA LI AQ+LFLEAENP+K+I 
Sbjct: 9   ALVPVVVEQSSRGERSFDIFSRLLRERVIFLTGEVEDNMANLIVAQMLFLEAENPEKDIH 68

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGMAIYDTMQFIKP + T+CMGQAASMG+ LL+AG KG R+ L NAR++
Sbjct: 69  LYINSPGGSVTAGMAIYDTMQFIKPDVVTYCMGQAASMGAFLLNAGAKGKRYCLENARVM 128

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDIE HA++I+ IK RLN +  ++ G+ YE V +  DRD+ M+A  A 
Sbjct: 129 IHQPLGGFRGQASDIEIHAREILFIKERLNRLMAEHSGQDYETVARDTDRDNFMTAQAAK 188

Query: 197 DWGVVDKVLMSR 208
           ++G+VD+VL  R
Sbjct: 189 EYGLVDQVLSKR 200


>gi|71276511|ref|ZP_00652786.1| Peptidase S14, ClpP [Xylella fastidiosa Dixon]
 gi|71900578|ref|ZP_00682705.1| Peptidase S14, ClpP [Xylella fastidiosa Ann-1]
 gi|170729732|ref|YP_001775165.1| ATP-dependent Clp protease proteolytic subunit [Xylella fastidiosa
           M12]
 gi|226706561|sp|B0U5N1|CLPP_XYLFM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|71162688|gb|EAO12415.1| Peptidase S14, ClpP [Xylella fastidiosa Dixon]
 gi|71729635|gb|EAO31739.1| Peptidase S14, ClpP [Xylella fastidiosa Ann-1]
 gi|167964525|gb|ACA11535.1| Endopeptidase Clp [Xylella fastidiosa M12]
          Length = 208

 Score =  271 bits (693), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 121/193 (62%), Positives = 161/193 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           L LVPMVVEQT+RGER+YDIYSRLLKER++F+ G I+D+MA LI AQLLFLEAENP+K+I
Sbjct: 8   LNLVPMVVEQTSRGERAYDIYSRLLKERLIFLVGPIDDYMANLIVAQLLFLEAENPEKDI 67

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           ++YINSPGGVVTAGMAIYDTMQ+IKP +ST C+GQAASMG+LLL++G  G R+ALPN+R+
Sbjct: 68  NIYINSPGGVVTAGMAIYDTMQYIKPAVSTICVGQAASMGALLLASGASGKRYALPNSRV 127

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+D++ HA++I+ ++ RLNEI  K+ G++ E +    +RD+  SA +A
Sbjct: 128 MIHQPLGGFQGQATDVDIHAREILALRARLNEILAKHTGQSLETIAHDTERDNFKSAVDA 187

Query: 196 CDWGVVDKVLMSR 208
             +G+VD+V   R
Sbjct: 188 QAYGLVDQVFGQR 200


>gi|71901066|ref|ZP_00683176.1| Peptidase S14, ClpP [Xylella fastidiosa Ann-1]
 gi|71729193|gb|EAO31314.1| Peptidase S14, ClpP [Xylella fastidiosa Ann-1]
          Length = 208

 Score =  271 bits (693), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 121/193 (62%), Positives = 161/193 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           L LVPMVVEQT+RGER+YDIYSRLLKER++F+ G I+D+MA L+ AQLLFLEAENP+K+I
Sbjct: 8   LNLVPMVVEQTSRGERAYDIYSRLLKERLIFLVGPIDDYMANLVVAQLLFLEAENPEKDI 67

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           ++YINSPGGVVTAGMAIYDTMQ+IKP +ST C+GQAASMG+LLL++G  G R+ALPN+R+
Sbjct: 68  NIYINSPGGVVTAGMAIYDTMQYIKPAVSTICVGQAASMGALLLASGASGKRYALPNSRV 127

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI+ HA++I+ ++ RLNEI  K+ G++ E +    +RD+  SA +A
Sbjct: 128 MIHQPLGGFQGQATDIDIHAREILALRARLNEILAKHTGQSLETIAHDTERDNFKSAVDA 187

Query: 196 CDWGVVDKVLMSR 208
             +G+VD+V   R
Sbjct: 188 QAYGLVDQVFGQR 200


>gi|330431763|gb|AEC16822.1| ATP-dependent Clp protease proteolytic subunit [Gallibacterium
           anatis UMN179]
          Length = 195

 Score =  271 bits (693), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 157/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT RGER++DIYSRLLKER++F+ GQ+ED+MA LI AQLLFLEAENP ++I
Sbjct: 1   MALVPMVVEQTARGERAFDIYSRLLKERVIFLNGQVEDNMANLIVAQLLFLEAENPDEDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           +LYINSPGGVVTAGMAIYDTMQFIKP + T CMGQA SMG+ LL+ G  G RFALP+ARI
Sbjct: 61  NLYINSPGGVVTAGMAIYDTMQFIKPDVRTLCMGQACSMGAFLLAGGAAGKRFALPHARI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG+ GQASDI+ HAQ+I+KIK  LN+    + G+  E VE+  DRD+ MSA  A
Sbjct: 121 MIHQPLGGYRGQASDIQIHAQEILKIKDTLNQRLAFHTGQPLEVVERDTDRDNFMSAQAA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++D+VL  R
Sbjct: 181 KEYGLIDEVLTHR 193


>gi|255321158|ref|ZP_05362324.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Acinetobacter
           radioresistens SK82]
 gi|262380154|ref|ZP_06073309.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Acinetobacter
           radioresistens SH164]
 gi|255301712|gb|EET80963.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Acinetobacter
           radioresistens SK82]
 gi|262298348|gb|EEY86262.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Acinetobacter
           radioresistens SH164]
          Length = 201

 Score =  271 bits (692), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 159/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVP+VVEQ++RGERS+DI+SRLL+ER++F+TG++ED+MA LI AQ+LFLEAENP K+I 
Sbjct: 9   ALVPVVVEQSSRGERSFDIFSRLLRERVIFLTGEVEDNMANLIVAQMLFLEAENPDKDIH 68

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGMAIYDTMQFIKP + T+CMGQAASMG+ LL+AG KG RF L NAR++
Sbjct: 69  LYINSPGGSVTAGMAIYDTMQFIKPDVVTYCMGQAASMGAFLLNAGAKGKRFCLENARVM 128

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDIE HA++I+ IK RLN +  ++ G+ YE + +  DRD+ M+A  A 
Sbjct: 129 IHQPLGGFRGQASDIEIHAREILFIKERLNRLMAEHSGQDYERIARDTDRDNFMTAQAAK 188

Query: 197 DWGVVDKVLMSR 208
           ++G+VD+VL  R
Sbjct: 189 EYGLVDEVLSKR 200


>gi|325294216|ref|YP_004280730.1| ATP-dependent Clp protease proteolytic subunit [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325064664|gb|ADY72671.1| ATP-dependent Clp protease proteolytic subunit [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 200

 Score =  271 bits (692), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 163/197 (82%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E++    VP+V+EQT RGER+YDIYSRLLK+RI+ +   I+DH+A LI AQLLFLEAE+P
Sbjct: 2   EEILNQFVPIVIEQTGRGERAYDIYSRLLKDRIIMLGTPIDDHVANLIVAQLLFLEAEDP 61

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
           +K+I LYINSPGGVVTAG+AIYDTMQ+IKP + T C+GQAASMG++LL+AG KG RFALP
Sbjct: 62  EKDIYLYINSPGGVVTAGLAIYDTMQYIKPDVVTICLGQAASMGAVLLAAGAKGKRFALP 121

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           +ARI++HQP GGF GQA+DIE HA++I+++K+ LNEI  K+ G++  ++EK  +RD+ MS
Sbjct: 122 HARIMIHQPLGGFQGQATDIEIHAKEILRLKKMLNEILSKHTGQSLRKIEKDTERDYFMS 181

Query: 192 ASEACDWGVVDKVLMSR 208
           A EA  +G++DKVL  R
Sbjct: 182 AEEAQKYGLIDKVLTRR 198


>gi|148244363|ref|YP_001219057.1| ATP-dependent Clp protease proteolytic subunit [Candidatus
           Vesicomyosocius okutanii HA]
 gi|166214721|sp|A5CXJ8|CLPP_VESOH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|146326190|dbj|BAF61333.1| ATP-dependent Clp protease proteolytic subunit ClpP [Candidatus
           Vesicomyosocius okutanii HA]
          Length = 198

 Score =  271 bits (692), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 123/193 (63%), Positives = 158/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           L  +P+VVEQ+ RGER+YDIYSRLLKERI+F+ G IED+MA ++ AQLLFLE+ENP K+I
Sbjct: 6   LNQIPIVVEQSARGERAYDIYSRLLKERIIFLVGPIEDYMANVVVAQLLFLESENPDKDI 65

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG V+AG+AIYDTMQFIK  IST C+GQAASMG+LLL+AG KG RFALPN R 
Sbjct: 66  HLYINSPGGSVSAGLAIYDTMQFIKSDISTLCIGQAASMGALLLTAGTKGKRFALPNVRC 125

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGFSGQASD++ HAQ+I+K++  LN+I+  + G+  + ++K  DRD+ MSA EA
Sbjct: 126 MIHQPLGGFSGQASDVDIHAQEILKVRANLNQIFKLHTGQVIKTIQKDTDRDNFMSADEA 185

Query: 196 CDWGVVDKVLMSR 208
             +G++DKVL  R
Sbjct: 186 TKYGLIDKVLAKR 198


>gi|237745591|ref|ZP_04576071.1| ATP-dependent Clp protease [Oxalobacter formigenes HOxBLS]
 gi|229376942|gb|EEO27033.1| ATP-dependent Clp protease [Oxalobacter formigenes HOxBLS]
          Length = 207

 Score =  271 bits (692), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 121/193 (62%), Positives = 159/193 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG++PMV+EQ+ RGER++DIYSRLLKERI+F+ G + D  A LI AQLLFLE+ENP+K+I
Sbjct: 14  LGMIPMVIEQSGRGERAFDIYSRLLKERIIFLVGPVTDQNANLIVAQLLFLESENPEKDI 73

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V+AGMAIYDTMQFI+P +ST C G AASMG+ LL+AG KG RF+LPN+RI
Sbjct: 74  SLYINSPGGSVSAGMAIYDTMQFIRPQVSTLCTGLAASMGAFLLAAGAKGKRFSLPNSRI 133

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA+DIE HA++I+ ++ RLN I  +N GK  E++ +  +RD+ MSA+EA
Sbjct: 134 MIHQPSGGAQGQATDIEIHAREILYLRERLNGILAENTGKPVEQIARDTERDNFMSAAEA 193

Query: 196 CDWGVVDKVLMSR 208
            D+G++D+VL  R
Sbjct: 194 KDYGLIDEVLTRR 206


>gi|304311290|ref|YP_003810888.1| ATP-dependent Clp protease proteolytic subunit [gamma
           proteobacterium HdN1]
 gi|301797023|emb|CBL45236.1| ATP-dependent Clp protease proteolytic subunit [gamma
           proteobacterium HdN1]
          Length = 189

 Score =  271 bits (692), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 124/189 (65%), Positives = 157/189 (83%)

Query: 21  MVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYIN 80
           MV+EQT RGERS+DIYSRLLKER++F+ GQ+EDHMA LI AQLLFLE+ENP K+I LYIN
Sbjct: 1   MVIEQTARGERSFDIYSRLLKERLIFMVGQVEDHMANLIVAQLLFLESENPDKDIHLYIN 60

Query: 81  SPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQP 140
           SPGG VTAGM+IYDTMQFIK  +ST C+GQA SMG+ LL+AG  G R+ALPN+R+++HQP
Sbjct: 61  SPGGSVTAGMSIYDTMQFIKADVSTICVGQACSMGAFLLAAGAPGKRYALPNSRVMIHQP 120

Query: 141 SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGV 200
            GGF GQASDIE HA++I+ +KRRLNE+  K+ G+  E+VE   DRD+ MSA +A ++G+
Sbjct: 121 LGGFQGQASDIEIHAREIITMKRRLNEMLAKHSGQPIEKVEGDTDRDNFMSAFDAKEYGL 180

Query: 201 VDKVLMSRI 209
           VD+VL  R+
Sbjct: 181 VDQVLEKRV 189


>gi|251798425|ref|YP_003013156.1| ATP-dependent Clp protease proteolytic subunit ClpP [Paenibacillus
           sp. JDR-2]
 gi|247546051|gb|ACT03070.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Paenibacillus
           sp. JDR-2]
          Length = 195

 Score =  270 bits (691), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 160/194 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGERSYDIYSRLLK+RI+F+   I+D +A  + AQLLFL A++P+K+I
Sbjct: 1   MNLVPIVVEQTNRGERSYDIYSRLLKDRIIFLGSAIDDDVANSVIAQLLFLAADDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAGMAIYDTMQ+IKP +ST CMG AASMGSLLL+AG KG RFALPNA +
Sbjct: 61  HLYINSPGGSVTAGMAIYDTMQYIKPDVSTICMGMAASMGSLLLTAGAKGKRFALPNAEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDI+ HA  I+K K++LNEIYV+  G+ YE++++  DRD+ MSA +A
Sbjct: 121 MIHQPLGGVRGQASDIKIHADWILKTKQKLNEIYVERTGQPYEKIDRDTDRDNFMSAEDA 180

Query: 196 CDWGVVDKVLMSRI 209
            ++G++DKV+ + +
Sbjct: 181 LNYGLIDKVITTPV 194


>gi|294627913|ref|ZP_06706492.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
 gi|292597827|gb|EFF41985.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
          Length = 208

 Score =  270 bits (691), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 162/193 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           L LVPMVVEQT+RGER+YDIYS LLKER++F+ G I+DHMA +I AQLLFLEA+NP+K+I
Sbjct: 8   LNLVPMVVEQTSRGERAYDIYSCLLKERLIFLVGPIDDHMANVIVAQLLFLEADNPEKDI 67

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S+YINSPGGVVTAGMAIYDTMQ+IKP +ST C+GQAASMG+LLL++G  G R+ALPN+R+
Sbjct: 68  SIYINSPGGVVTAGMAIYDTMQYIKPDVSTICVGQAASMGALLLASGAAGKRYALPNSRV 127

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI+ HA++I+ ++ RLNEI  K+ G++ E + +  +RD+  SA +A
Sbjct: 128 MIHQPLGGFQGQATDIDIHAREILTLRSRLNEILAKHTGQSLETIARDTERDNFKSAVDA 187

Query: 196 CDWGVVDKVLMSR 208
             +G+VD+VL  R
Sbjct: 188 QAYGLVDQVLERR 200


>gi|33151467|ref|NP_872820.1| ATP-dependent Clp protease proteolytic subunit ClpP [Haemophilus
           ducreyi 35000HP]
 gi|60389738|sp|Q7VP78|CLPP_HAEDU RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|33147687|gb|AAP95209.1| ATP-dependent Clp protease proteolytic subunit ClpP [Haemophilus
           ducreyi 35000HP]
          Length = 197

 Score =  270 bits (691), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 161/196 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++PMVVEQT++GERSYDIYSRLLKERI+F+ G++EDHMA LI AQLLFLEAE+P+K+I
Sbjct: 1   MAVIPMVVEQTSKGERSYDIYSRLLKERIIFLNGEVEDHMANLIVAQLLFLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGVVTAG+AIYDTM FIKP ++T C GQA SMG+ LLS G+KG RFALPNAR+
Sbjct: 61  YLYINSPGGVVTAGLAIYDTMNFIKPDVATLCTGQACSMGAFLLSGGKKGKRFALPNARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI+  AQ+I+K+K  L     ++ G+T+ +V    +RD+ MSA+EA
Sbjct: 121 MIHQPLGGARGQATDIQIQAQEILKLKEMLTRKMAEHSGQTFAKVAADTERDNFMSATEA 180

Query: 196 CDWGVVDKVLMSRIDI 211
            ++G++DKVL SR ++
Sbjct: 181 KNYGLIDKVLTSRGEV 196


>gi|253996690|ref|YP_003048754.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Methylotenera
           mobilis JLW8]
 gi|253983369|gb|ACT48227.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Methylotenera
           mobilis JLW8]
          Length = 214

 Score =  270 bits (691), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 119/193 (61%), Positives = 160/193 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG +PMV+EQ+ RGERS+DIYSRLLKER++F+ G + D  A L+ AQLLFLEAENP K+I
Sbjct: 18  LGYIPMVIEQSGRGERSFDIYSRLLKERVIFLVGPVNDMSANLVVAQLLFLEAENPDKDI 77

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG VTAGM+IYDTMQFIKP +ST C+GQAASMG+ LL+AG K  R++LPN+RI
Sbjct: 78  SLYINSPGGSVTAGMSIYDTMQFIKPDVSTLCIGQAASMGAFLLAAGAKDKRYSLPNSRI 137

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGGF GQ+SDIE HA++I+ ++ +LN+I   + G+T EE+++  +RD+ MSA ++
Sbjct: 138 MIHQPSGGFQGQSSDIEIHAKEILYLRAKLNDILAHHTGRTAEEIDRDTERDNFMSAEQS 197

Query: 196 CDWGVVDKVLMSR 208
             +G++DKV+ SR
Sbjct: 198 VAYGLIDKVIGSR 210


>gi|50083772|ref|YP_045282.1| ATP-dependent Clp protease proteolytic subunit [Acinetobacter sp.
           ADP1]
 gi|60389584|sp|Q6FEP8|CLPP_ACIAD RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|49529748|emb|CAG67460.1| ATP-dependent Clp protease proteolytic subunit (Endopeptidase Clp)
           (Caseinolytic protease) (Protease Ti) (Heat shock
           protein F21.5) [Acinetobacter sp. ADP1]
          Length = 201

 Score =  270 bits (691), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 159/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVP+VVEQ++RGERS+DI+SRLL+ER++F+TG++ED+MA LI AQ+LFLEAENP K+I 
Sbjct: 9   ALVPVVVEQSSRGERSFDIFSRLLRERVIFLTGEVEDNMANLIVAQMLFLEAENPDKDIH 68

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGMAIYDTMQFIKP + T+CMGQAASMG+ LL+AG KG R+ L NAR++
Sbjct: 69  LYINSPGGSVTAGMAIYDTMQFIKPDVVTYCMGQAASMGAFLLNAGAKGKRYCLENARVM 128

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDIE HA++I+ IK RLN +  ++ G+ YE V +  DRD+ M+A  A 
Sbjct: 129 IHQPLGGFRGQASDIEIHAREILFIKERLNRLMAEHSGQDYERVARDTDRDNFMTAQAAK 188

Query: 197 DWGVVDKVLMSR 208
           ++G+VD+VL  R
Sbjct: 189 EYGLVDEVLSKR 200


>gi|157370220|ref|YP_001478209.1| ATP-dependent Clp protease proteolytic subunit [Serratia
           proteamaculans 568]
 gi|157321984|gb|ABV41081.1| Endopeptidase Clp [Serratia proteamaculans 568]
          Length = 197

 Score =  270 bits (690), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 122/191 (63%), Positives = 152/191 (79%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQT++GERS+DIYSRLL++RIVF+ G++ D +A ++CAQLLFLEAENP+K I L
Sbjct: 7   LVPMVVEQTSQGERSFDIYSRLLRDRIVFLNGEVNDQIAEVLCAQLLFLEAENPEKPIHL 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGV+T+G AIYDTM +I  P+ T CMG A SMGS LL AGE G R  LPNA + +
Sbjct: 67  YINSPGGVITSGFAIYDTMNYINAPVHTLCMGTARSMGSFLLMAGEAGHRMVLPNASLHV 126

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQASDI  HA+++ + K  +  +Y K+CG++YEEVE+ LDRDH MSA EA +
Sbjct: 127 HQPLGGFQGQASDILIHAEEMKRTKHSVITLYAKHCGRSYEEVERALDRDHFMSADEAVE 186

Query: 198 WGVVDKVLMSR 208
           WG+VDKVL  R
Sbjct: 187 WGLVDKVLRGR 197


>gi|27375722|ref|NP_767251.1| ATP-dependent Clp protease proteolytic subunit [Bradyrhizobium
           japonicum USDA 110]
 gi|67460544|sp|Q89WR7|CLPP1_BRAJA RecName: Full=ATP-dependent Clp protease proteolytic subunit 1;
           AltName: Full=Endopeptidase Clp 1
 gi|27348860|dbj|BAC45876.1| ATP-dependent protease proteolytic subunit [Bradyrhizobium
           japonicum USDA 110]
          Length = 200

 Score =  270 bits (690), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 121/193 (62%), Positives = 154/193 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           L LVPMVVEQ+ RGERS+DIYSRLL+ERI+F+ G++ D M+ L+CAQLLFLEAENP + I
Sbjct: 5   LQLVPMVVEQSARGERSFDIYSRLLRERIIFLNGEVNDAMSGLVCAQLLFLEAENPNRPI 64

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           +LYINS GGVVT+G+A+YDTMQFIK P+ T CMG A SMGS LL AGE+G R ALPNA +
Sbjct: 65  NLYINSYGGVVTSGLAMYDTMQFIKAPVHTLCMGTARSMGSFLLMAGERGHRAALPNASL 124

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
            +HQP GGF GQASDI  HA ++ + KRR+  +Y ++CG+T  EVE+TLDRDH M+A + 
Sbjct: 125 HVHQPLGGFQGQASDILIHANEMQETKRRITRLYAQHCGRTEAEVERTLDRDHFMTAQQG 184

Query: 196 CDWGVVDKVLMSR 208
            +WG++D+V   R
Sbjct: 185 VEWGLIDRVFAER 197


>gi|169634426|ref|YP_001708162.1| ATP-dependent Clp protease proteolytic subunit [Acinetobacter
           baumannii SDF]
 gi|169797267|ref|YP_001715060.1| ATP-dependent Clp protease proteolytic subunit [Acinetobacter
           baumannii AYE]
 gi|184156807|ref|YP_001845146.1| ATP-dependent Clp protease proteolytic subunit [Acinetobacter
           baumannii ACICU]
 gi|213155939|ref|YP_002317984.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Acinetobacter
           baumannii AB0057]
 gi|215484708|ref|YP_002326943.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Acinetobacter
           baumannii AB307-0294]
 gi|239500790|ref|ZP_04660100.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Acinetobacter
           baumannii AB900]
 gi|260549098|ref|ZP_05823319.1| ATP-dependent Clp protease proteolytic subunit [Acinetobacter sp.
           RUH2624]
 gi|260556149|ref|ZP_05828368.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Acinetobacter
           baumannii ATCC 19606]
 gi|294836355|ref|ZP_06781038.1| ATP-dependent Clp protease proteolytic subunit [Acinetobacter sp.
           6013113]
 gi|294841889|ref|ZP_06786572.1| ATP-dependent Clp protease proteolytic subunit [Acinetobacter sp.
           6014059]
 gi|294857705|ref|ZP_06795474.1| ATP-dependent Clp protease proteolytic subunit [Acinetobacter sp.
           6013150]
 gi|301346762|ref|ZP_07227503.1| ATP-dependent Clp protease proteolytic subunit [Acinetobacter
           baumannii AB056]
 gi|301512252|ref|ZP_07237489.1| ATP-dependent Clp protease proteolytic subunit [Acinetobacter
           baumannii AB058]
 gi|301594241|ref|ZP_07239249.1| ATP-dependent Clp protease proteolytic subunit [Acinetobacter
           baumannii AB059]
 gi|169150194|emb|CAM88088.1| ATP-dependent Clp protease proteolytic subunit (Endopeptidase Clp)
           (Caseinolytic protease) (Protease Ti) (Heat shock
           protein F21.5) [Acinetobacter baumannii AYE]
 gi|169153218|emb|CAP02314.1| ATP-dependent Clp protease proteolytic subunit (Endopeptidase Clp)
           (Caseinolytic protease) (Protease Ti) (Heat shock
           protein F21.5) [Acinetobacter baumannii]
 gi|183208401|gb|ACC55799.1| Protease subunit of ATP-dependent Clp protease [Acinetobacter
           baumannii ACICU]
 gi|193076289|gb|ABO10931.2| ATP-dependent Clp protease proteolytic subunit [Acinetobacter
           baumannii ATCC 17978]
 gi|213055099|gb|ACJ40001.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Acinetobacter
           baumannii AB0057]
 gi|213988734|gb|ACJ59033.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Acinetobacter
           baumannii AB307-0294]
 gi|260407826|gb|EEX01298.1| ATP-dependent Clp protease proteolytic subunit [Acinetobacter sp.
           RUH2624]
 gi|260410204|gb|EEX03503.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Acinetobacter
           baumannii ATCC 19606]
 gi|322506699|gb|ADX02153.1| clpP [Acinetobacter baumannii 1656-2]
 gi|323516573|gb|ADX90954.1| ATP-dependent Clp protease proteolytic subunit [Acinetobacter
           baumannii TCDC-AB0715]
          Length = 201

 Score =  270 bits (690), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 122/192 (63%), Positives = 159/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVP+VVEQ++RGERS+DIYSRLL+ER++F+TG++ED+MA LI AQ+LFLEAENP K+I 
Sbjct: 9   ALVPVVVEQSSRGERSFDIYSRLLRERVIFLTGEVEDNMANLIVAQMLFLEAENPDKDIH 68

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGMAIYDTMQFIKP + T+CMGQAASMG+ LL+AG KG R+ L NAR++
Sbjct: 69  LYINSPGGSVTAGMAIYDTMQFIKPDVVTYCMGQAASMGAFLLNAGAKGKRYCLENARVM 128

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDIE HA++I+ IK RLN +  ++ G+ Y+ + +  DRD+ M+A  A 
Sbjct: 129 IHQPLGGFRGQASDIEIHAREILFIKERLNRLMAEHSGQDYDTIARDTDRDNFMTAQAAK 188

Query: 197 DWGVVDKVLMSR 208
           ++G+VD+VL  R
Sbjct: 189 EYGLVDQVLSKR 200


>gi|74317695|ref|YP_315435.1| ATP-dependent Clp protease proteolytic subunit ClpP [Thiobacillus
           denitrificans ATCC 25259]
 gi|90183186|sp|Q3SI98|CLPP_THIDA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|74057190|gb|AAZ97630.1| peptidase S14, ClpP [Thiobacillus denitrificans ATCC 25259]
          Length = 212

 Score =  270 bits (690), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 158/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVPMVVEQ+ RGER+YDIYSRLLKER++F+ G + D  A LI AQ+LFLE+ENP K+I
Sbjct: 15  LGLVPMVVEQSGRGERAYDIYSRLLKERVIFLVGPVNDATANLIVAQMLFLESENPDKDI 74

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG V+AG+AIYDTMQFIKP +ST C+GQAASMG+ LL+AG KG R+ LPN+R+
Sbjct: 75  YLYINSPGGSVSAGLAIYDTMQFIKPDVSTLCIGQAASMGAFLLTAGAKGKRYCLPNSRV 134

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDIE HA++I+ +K RLN +  K+ G++ E +++  DRD+ MSA ++
Sbjct: 135 MIHQPLGGFQGQASDIEIHAKEILYLKARLNGMLAKHTGQSLEVIDRDTDRDNFMSAEDS 194

Query: 196 CDWGVVDKVLMSR 208
             +G+VDKVL SR
Sbjct: 195 VKYGLVDKVLTSR 207


>gi|330814219|ref|YP_004358458.1| ATP-dependent Clp protease proteolytic subunit [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327487314|gb|AEA81719.1| ATP-dependent Clp protease proteolytic subunit [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 204

 Score =  270 bits (690), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 164/201 (81%), Gaps = 1/201 (0%)

Query: 9   KDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           KD  D+++  LVPMVVEQT RGER+YDIYSRLLKERI+F+ G I   +++LI AQLLFLE
Sbjct: 2   KDPIDIYMNTLVPMVVEQTPRGERAYDIYSRLLKERIIFLVGPINSQVSSLISAQLLFLE 61

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           +EN  KEI +YINSPGG+VT G+AIYDTMQ+IKP ++T C+GQA SMGS LL+AGEKG R
Sbjct: 62  SENNSKEIFMYINSPGGIVTDGLAIYDTMQYIKPAVATLCIGQACSMGSFLLAAGEKGQR 121

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
            +LPN+R+++HQPS GF GQA+DIE HA +I++ K++LNEIY K+ G++ E++++ L+RD
Sbjct: 122 MSLPNSRVMVHQPSAGFQGQATDIEIHANEIMQTKKKLNEIYSKHTGQSVEKIKEALERD 181

Query: 188 HIMSASEACDWGVVDKVLMSR 208
             MSA EA  +G++DKV+  R
Sbjct: 182 KFMSAEEAKAFGLIDKVVEKR 202


>gi|307822658|ref|ZP_07652889.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Methylobacter
           tundripaludum SV96]
 gi|307736262|gb|EFO07108.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Methylobacter
           tundripaludum SV96]
          Length = 215

 Score =  270 bits (690), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 120/198 (60%), Positives = 165/198 (83%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVP+V+EQT RGERS+DIYSRLLKER++F+ GQ+ED+ A LI AQLLFLE+ENP K+I 
Sbjct: 18  GLVPIVIEQTARGERSFDIYSRLLKERVIFLVGQVEDYSANLIVAQLLFLESENPDKDIH 77

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQAASMG+LLL+ G KG R+ LP++R++
Sbjct: 78  LYINSPGGSVTAGMSIYDTMQFIKPDVSTMCIGQAASMGALLLAGGAKGKRYCLPHSRMM 137

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG+ GQASDI+ HA++I+ I+ +LN+I   + G+  E+V++  DRD+ +SA++A 
Sbjct: 138 IHQPLGGYQGQASDIDIHAREILLIREKLNKILSDHTGQPMEKVQQDTDRDNFLSANDAV 197

Query: 197 DWGVVDKVLMSRIDIEEK 214
            +G++D+VL+SR  + +K
Sbjct: 198 SYGLIDQVLLSRATVADK 215


>gi|163751869|ref|ZP_02159083.1| ATP-dependent Clp protease proteolytic subunit [Shewanella benthica
           KT99]
 gi|161328219|gb|EDP99383.1| ATP-dependent Clp protease proteolytic subunit [Shewanella benthica
           KT99]
          Length = 203

 Score =  270 bits (689), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 122/194 (62%), Positives = 158/194 (81%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E VF  LVPMVVEQT +GERSYDIYSRLLKERI+F+ G +E+HMA L+ AQLLFLE+E+P
Sbjct: 6   ESVFNALVPMVVEQTAKGERSYDIYSRLLKERIIFLVGPVEEHMANLVVAQLLFLESESP 65

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            K+I LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+ G  G R  LP
Sbjct: 66  DKDIFLYINSPGGSVTAGMAIYDTMQFIKPDVSTVCIGQAASMGAFLLAGGAAGKRHCLP 125

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+R+++HQP GGF GQASDI  HAQ+I+ IK +LN++  ++ G++ E +E+  DRD+ MS
Sbjct: 126 NSRVMIHQPLGGFQGQASDIAIHAQEILGIKDKLNQMLAEHTGQSLEVIERDTDRDNFMS 185

Query: 192 ASEACDWGVVDKVL 205
           A++A ++G++D V+
Sbjct: 186 AAQAAEYGLIDSVM 199


>gi|253999170|ref|YP_003051233.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Methylovorus
           sp. SIP3-4]
 gi|313201272|ref|YP_004039930.1| ATP-dependent clp protease, proteolytic subunit clpp [Methylovorus
           sp. MP688]
 gi|253985849|gb|ACT50706.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Methylovorus
           sp. SIP3-4]
 gi|312440588|gb|ADQ84694.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Methylovorus
           sp. MP688]
          Length = 208

 Score =  270 bits (689), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 158/195 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG +PMV+EQ+ RGER+YDIYSRLL+ER++F+ G + D  A L+ AQLLFLEAENP K+I
Sbjct: 12  LGYIPMVIEQSGRGERAYDIYSRLLRERVIFLVGPVNDMTANLVVAQLLFLEAENPDKDI 71

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+LLL+AG K  RF LPN+R+
Sbjct: 72  SLYINSPGGSVTAGMAIYDTMQFIKPDVSTLCIGQAASMGALLLTAGAKDKRFCLPNSRV 131

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDIE HA++I+ ++ +LN I   + G+  + +E+  DRD+ MSA ++
Sbjct: 132 MIHQPLGGFQGQASDIEIHAKEILYLREKLNLILASHTGQPVDVIERDTDRDNFMSAQQS 191

Query: 196 CDWGVVDKVLMSRID 210
            ++G+VDKV+ SR D
Sbjct: 192 VNYGLVDKVIASRTD 206


>gi|145628436|ref|ZP_01784237.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae 22.1-21]
 gi|145633845|ref|ZP_01789567.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae 3655]
 gi|145637965|ref|ZP_01793604.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae PittHH]
 gi|145639474|ref|ZP_01795079.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae PittII]
 gi|148826642|ref|YP_001291395.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae PittEE]
 gi|148827882|ref|YP_001292635.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae PittGG]
 gi|229845547|ref|ZP_04465675.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae 6P18H1]
 gi|229847178|ref|ZP_04467282.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae 7P49H1]
 gi|260583375|ref|ZP_05851146.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Haemophilus
           influenzae NT127]
 gi|319775445|ref|YP_004137933.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae F3047]
 gi|166201826|sp|A5UE11|CLPP_HAEIE RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166201827|sp|A5UHJ6|CLPP_HAEIG RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|144980211|gb|EDJ89870.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae 22.1-21]
 gi|144985287|gb|EDJ92126.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae 3655]
 gi|145268831|gb|EDK08795.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae PittHH]
 gi|145271521|gb|EDK11433.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae PittII]
 gi|148716802|gb|ABQ99012.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae PittEE]
 gi|148719124|gb|ABR00252.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae PittGG]
 gi|229809854|gb|EEP45576.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae 7P49H1]
 gi|229811563|gb|EEP47264.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae 6P18H1]
 gi|260093580|gb|EEW77497.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Haemophilus
           influenzae NT127]
 gi|309751687|gb|ADO81671.1| ATP-dependent Clp protease proteolytic subunit ClpP [Haemophilus
           influenzae R2866]
 gi|309973789|gb|ADO96990.1| ATP-dependent Clp protease proteolytic subunit ClpP [Haemophilus
           influenzae R2846]
 gi|317450036|emb|CBY86250.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae F3047]
          Length = 193

 Score =  270 bits (689), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 158/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++PMVVEQT+RGERSYDIYSRLLKER++F++G++ED MA LI AQLLFLE+E+P K+I
Sbjct: 1   MSVIPMVVEQTSRGERSYDIYSRLLKERVIFLSGEVEDRMANLIVAQLLFLESEDPTKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           ++YINSPGG VTAGMAIYDTMQFIKP I T C+GQA SMG+ LL+ G  G R ALPNAR+
Sbjct: 61  NIYINSPGGSVTAGMAIYDTMQFIKPDIRTLCIGQACSMGAFLLAGGTAGKRAALPNARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI+ HAQ+I+KIK  LN+    + G++ E +EK  DRD+ MSA EA
Sbjct: 121 MIHQPLGGFRGQASDIQIHAQEILKIKHTLNDRLAFHTGQSIERIEKDTDRDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G+VD+VL+ R
Sbjct: 181 QAYGLVDEVLVKR 193


>gi|297250503|ref|ZP_06864443.2| ATP-dependent Clp protease, proteolytic subunit ClpP [Neisseria
           polysaccharea ATCC 43768]
 gi|296838809|gb|EFH22747.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Neisseria
           polysaccharea ATCC 43768]
          Length = 209

 Score =  270 bits (689), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 160/197 (81%), Gaps = 2/197 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFLE+ENP K+I  
Sbjct: 12  LVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFF 71

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG RFALPN+RI++
Sbjct: 72  YINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMI 131

Query: 138 HQP--SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP  SGG  GQASDIE HA++++KIK +LN +  K+CG+   ++E+  DRD+ MSA EA
Sbjct: 132 HQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCGRDLADLERDTDRDNFMSAEEA 191

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G++D+VL +R+ ++
Sbjct: 192 KEYGLIDQVLENRVSLQ 208


>gi|254468869|ref|ZP_05082275.1| ATP-dependent Clp protease, proteolytic subunit ClpP [beta
           proteobacterium KB13]
 gi|207087679|gb|EDZ64962.1| ATP-dependent Clp protease, proteolytic subunit ClpP [beta
           proteobacterium KB13]
          Length = 207

 Score =  270 bits (689), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 156/195 (80%)

Query: 14  VFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQK 73
           V LG +PMVVEQ+ RGERSYDIYSRLLKER+VF+ G ++D  A L+ AQLLFLEAENP K
Sbjct: 13  VGLGYIPMVVEQSGRGERSYDIYSRLLKERVVFLVGPVDDMTANLVVAQLLFLEAENPDK 72

Query: 74  EISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNA 133
           +ISLYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+LLL+AG K  RF LPN+
Sbjct: 73  DISLYINSPGGSVTAGMAIYDTMQFIKPDVSTLCIGQAASMGALLLTAGAKDKRFCLPNS 132

Query: 134 RILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSAS 193
           R+++HQP GGF GQASDIE HA++I+ +K +LN I   + G+  + + K  DRD+ MS+ 
Sbjct: 133 RVMIHQPLGGFQGQASDIEIHAKEILYLKDKLNRILSHHTGQDIKTISKDTDRDNFMSSE 192

Query: 194 EACDWGVVDKVLMSR 208
           +A  +G+VDKV+  R
Sbjct: 193 DAVKYGLVDKVINER 207


>gi|15888940|ref|NP_354621.1| ATP-dependent Clp protease proteolytic subunit [Agrobacterium
           tumefaciens str. C58]
 gi|21759065|sp|Q8UEX6|CLPP1_AGRT5 RecName: Full=ATP-dependent Clp protease proteolytic subunit 1;
           AltName: Full=Endopeptidase Clp 1
 gi|15156717|gb|AAK87406.1| ATP-dependent Clp protease, proteolytic subunit [Agrobacterium
           tumefaciens str. C58]
          Length = 202

 Score =  270 bits (689), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 156/193 (80%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQ++RGERS+DIYSRLL+ERI+F+ G+++D ++ L+CAQLLFLEAENP+K I L
Sbjct: 7   LVPMVVEQSSRGERSFDIYSRLLRERIIFLNGEVDDTVSALVCAQLLFLEAENPKKPIHL 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG+VT+G A+YDTM++I+ P+ T CMG A SMGS LL AGE G R ALPNA IL+
Sbjct: 67  YINSPGGMVTSGFAMYDTMRYIRAPVHTLCMGTARSMGSFLLMAGEPGTRAALPNASILI 126

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGGF GQASD+  HA++I + K R+  +Y ++CG++YEE E  +DRD  M+  EA +
Sbjct: 127 HQPSGGFQGQASDMLIHAEEIRQTKHRMTRLYAEHCGRSYEEFETAMDRDRFMTVQEALE 186

Query: 198 WGVVDKVLMSRID 210
           WG++D++L  R D
Sbjct: 187 WGLIDRILEVRED 199


>gi|254512409|ref|ZP_05124476.1| Clp protease [Rhodobacteraceae bacterium KLH11]
 gi|221536120|gb|EEE39108.1| Clp protease [Rhodobacteraceae bacterium KLH11]
          Length = 196

 Score =  270 bits (689), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 124/188 (65%), Positives = 157/188 (83%)

Query: 21  MVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYIN 80
           MVVEQT+RGER+YDI+SRLLKERI+F+ G I D M+ L+ AQLL LEAENP KEIS+YIN
Sbjct: 1   MVVEQTSRGERAYDIFSRLLKERIIFINGPIHDGMSHLVVAQLLHLEAENPNKEISIYIN 60

Query: 81  SPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQP 140
           SPGGVVT+G++IYDTMQ+IKP  ST  +GQAASMGS+LL+ GEKGMRF+LPN+RI++HQP
Sbjct: 61  SPGGVVTSGLSIYDTMQYIKPKCSTLVIGQAASMGSVLLAGGEKGMRFSLPNSRIMVHQP 120

Query: 141 SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGV 200
           SGG+ GQASDI  HA +  K+K RL +IYV++ G+T + VEK LDRD+ MS  EA DWG 
Sbjct: 121 SGGYQGQASDIMIHAAETQKLKDRLYDIYVRHTGQTKKAVEKALDRDNFMSPEEAKDWGH 180

Query: 201 VDKVLMSR 208
           +D+++ +R
Sbjct: 181 IDEIVENR 188


>gi|15603841|ref|NP_246915.1| ATP-dependent Clp protease proteolytic subunit [Pasteurella
           multocida subsp. multocida str. Pm70]
 gi|18202809|sp|Q9CJM2|CLPP_PASMU RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|12722415|gb|AAK04060.1| ClpP [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 193

 Score =  270 bits (689), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 158/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++PMVVEQT RGERSYDIYSRLLKER++F+ G++ED MA LI AQLLFLE+E+P+K+I
Sbjct: 1   MSVIPMVVEQTARGERSYDIYSRLLKERVIFLGGEVEDRMANLIVAQLLFLESEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           ++YINSPGG VTAGMAIYDTMQF+KP I T C+GQA SMG+ LL+ G  G R ALP+AR+
Sbjct: 61  NIYINSPGGSVTAGMAIYDTMQFVKPDIRTLCVGQACSMGAFLLAGGTAGKRIALPSARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI+ HAQ+I+KIK+ LNE    + G+T E +E+  DRD+ MSA EA
Sbjct: 121 MIHQPLGGFRGQASDIQIHAQEILKIKQTLNERLAFHTGQTIERIERDTDRDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G+VD+VL SR
Sbjct: 181 KAYGLVDEVLASR 193


>gi|251772219|gb|EES52789.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Leptospirillum ferrodiazotrophum]
          Length = 201

 Score =  269 bits (688), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 165/200 (82%), Gaps = 1/200 (0%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           L+PMVVEQTNRGER+YDIYSRLL++RI+ +   I+D +A L+ AQ+LFLE+E+  K+I+L
Sbjct: 2   LIPMVVEQTNRGERAYDIYSRLLRDRIIILGTPIDDTVANLVIAQMLFLESEDSSKDINL 61

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG+VTAG+AIYDT++FIKP +ST C+GQAASMG+ LLSAG KG R+ALPNARI++
Sbjct: 62  YINSPGGIVTAGLAIYDTIKFIKPDVSTICIGQAASMGAFLLSAGAKGKRYALPNARIMI 121

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQA+DIE HA++I+K+K  LN +  ++CG+  E+V +  DRD+ MSA EA D
Sbjct: 122 HQPMGGFQGQATDIEIHAREILKLKADLNRMMSEHCGQPVEKVAQDTDRDYFMSAKEAKD 181

Query: 198 WGVVDKVLMS-RIDIEEKSK 216
           +G++D V+ S RID E+ SK
Sbjct: 182 YGLIDSVITSHRIDTEKTSK 201


>gi|332186782|ref|ZP_08388524.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Sphingomonas
           sp. S17]
 gi|332013115|gb|EGI55178.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Sphingomonas
           sp. S17]
          Length = 229

 Score =  269 bits (688), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 160/192 (83%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVP+V+EQ+NRGERS+DI+SRLL+ERI+FVTG +ED MA+LICAQLLFLE+ENP+K+I 
Sbjct: 27  GLVPIVIEQSNRGERSFDIFSRLLRERIIFVTGGVEDGMASLICAQLLFLESENPKKDIY 86

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           +YINSPGGVVTAGMAI+DTMQ+I+P + T C+GQAASMGS LL+AGE GMR A  N+RI+
Sbjct: 87  MYINSPGGVVTAGMAIHDTMQYIRPRVGTLCIGQAASMGSFLLAAGEPGMRVATTNSRIM 146

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG  G A+DIE  A++I++++  LN +Y K  GK  EE+E+ +DRD  MS+ EA 
Sbjct: 147 IHQPSGGAQGMAADIEIQAREILRMRHFLNSLYAKYTGKPLEEIERAMDRDKFMSSEEAK 206

Query: 197 DWGVVDKVLMSR 208
           ++G++D+V   R
Sbjct: 207 EFGLIDQVFDKR 218


>gi|161486690|ref|YP_719644.2| ATP-dependent Clp protease proteolytic subunit [Haemophilus somnus
           129PT]
          Length = 193

 Score =  269 bits (688), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 123/193 (63%), Positives = 160/193 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++PMVVEQT+RGERSYDIYSRLLKER++F+TG++ED MA LI AQLLFLEAE+P K+I
Sbjct: 1   MSVIPMVVEQTSRGERSYDIYSRLLKERVIFLTGEVEDRMANLIVAQLLFLEAEDPAKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           ++YINSPGG VTAGMAIYDTMQFIKP + T C+GQA SMG+ LL+ G  G R ALP+AR+
Sbjct: 61  NIYINSPGGSVTAGMAIYDTMQFIKPDVRTLCIGQACSMGAFLLAGGTAGKRAALPHARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI+ HAQ+I+KIK+ LNE    + G++ E++E+  DRD+ MSA +A
Sbjct: 121 MIHQPLGGFRGQASDIQIHAQEILKIKQTLNERLAFHTGQSIEQIEQDTDRDNFMSAEQA 180

Query: 196 CDWGVVDKVLMSR 208
             +G+VD+VL+ R
Sbjct: 181 KLYGLVDEVLIKR 193


>gi|150398272|ref|YP_001328739.1| ATP-dependent Clp protease proteolytic subunit [Sinorhizobium
           medicae WSM419]
 gi|150029787|gb|ABR61904.1| Endopeptidase Clp [Sinorhizobium medicae WSM419]
          Length = 205

 Score =  269 bits (687), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 156/197 (79%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQ++RGERS+DIYSRLL+ERI+F+ G++ D ++ L+CAQLLFLEAE+P K I L
Sbjct: 7   LVPMVVEQSSRGERSFDIYSRLLRERIIFLNGEVNDAVSALVCAQLLFLEAESPTKPIQL 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G A+YDTM++I+ P+ T CMG A SMGS LL AGE G R ALPN  IL+
Sbjct: 67  YINSPGGVVTSGFAMYDTMRYIRAPVHTLCMGTARSMGSFLLMAGEAGGRAALPNTSILV 126

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGGF GQASD+  HA++I + K R+  +Y ++CG+TYEE E+ +DRD  M+A EA +
Sbjct: 127 HQPSGGFQGQASDMLIHAEEIRRTKHRMTRLYAEHCGRTYEEFERAMDRDRFMTAEEALE 186

Query: 198 WGVVDKVLMSRIDIEEK 214
           WG++D +L  R+   E+
Sbjct: 187 WGLIDCILTERVAGAER 203


>gi|145635952|ref|ZP_01791637.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae PittAA]
 gi|319897851|ref|YP_004136048.1| ATP-dependent clp protease proteolytic subunit [Haemophilus
           influenzae F3031]
 gi|145266785|gb|EDK06804.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae PittAA]
 gi|301169432|emb|CBW29032.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Haemophilus influenzae 10810]
 gi|317433357|emb|CBY81736.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae F3031]
          Length = 193

 Score =  269 bits (687), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 158/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++PMVVEQT+RGERSYDIYSRLLKER++F++G++ED MA LI AQLLFLE+E+P K+I
Sbjct: 1   MSVIPMVVEQTSRGERSYDIYSRLLKERVIFLSGEVEDRMANLIVAQLLFLESEDPTKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           ++YINSPGG VTAGMAIYDTMQFIKP I T C+GQA SMG+ LL+ G  G R ALPNAR+
Sbjct: 61  NIYINSPGGSVTAGMAIYDTMQFIKPDIRTLCIGQACSMGAFLLAGGTAGKRAALPNARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI+ HAQ+I+KIK  LN+    + G++ E +EK  DRD+ MSA EA
Sbjct: 121 MIHQPLGGFRGQASDIQIHAQEILKIKHTLNDRLAFHTGQSIERIEKDTDRDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G+VD+VL+ R
Sbjct: 181 QVYGLVDEVLVKR 193


>gi|330427935|gb|AEC19269.1| ATP-dependent Clp protease proteolytic subunit [Pusillimonas sp.
           T7-7]
          Length = 218

 Score =  269 bits (687), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 122/195 (62%), Positives = 154/195 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG VP+V+EQ+ RGERSYDIYSRLL+ER++F  G + DH A L+ AQLLFLE+ENP K+I
Sbjct: 22  LGYVPIVIEQSGRGERSYDIYSRLLRERVIFFVGPVNDHTANLVVAQLLFLESENPDKDI 81

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V AGMAIYDTMQFIKP +ST C G AASMG+ LL+AG KG R+ LPN+RI
Sbjct: 82  SLYINSPGGSVYAGMAIYDTMQFIKPDVSTLCTGIAASMGAFLLAAGAKGKRYTLPNSRI 141

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQASDI+  A++I+ ++ RLN I  KN G+  E + +  +RD+ MSA +A
Sbjct: 142 MIHQPSGGAQGQASDIQIQAREILSLRERLNTILAKNTGQPVERIAEDTERDNFMSAEDA 201

Query: 196 CDWGVVDKVLMSRID 210
             +G+VDKVL+SR D
Sbjct: 202 VSYGLVDKVLVSRAD 216


>gi|32035048|ref|ZP_00135114.1| COG0740: Protease subunit of ATP-dependent Clp proteases
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126208746|ref|YP_001053971.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           pleuropneumoniae L20]
 gi|165976699|ref|YP_001652292.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|307246197|ref|ZP_07528278.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307255177|ref|ZP_07536995.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307257345|ref|ZP_07539115.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|307259615|ref|ZP_07541339.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|307261756|ref|ZP_07543422.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|166201796|sp|A3N1T0|CLPP_ACTP2 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|226706436|sp|B0BQL3|CLPP_ACTPJ RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|126097538|gb|ABN74366.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
 gi|165876800|gb|ABY69848.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|306852806|gb|EFM85030.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306862050|gb|EFM94026.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306864195|gb|EFM96108.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306866260|gb|EFM98124.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306868574|gb|EFN00385.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 196

 Score =  269 bits (687), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 123/193 (63%), Positives = 157/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQT++GERSYDIYSRLLKERI+F+TGQ+EDHMA LI AQ+LFLEAE+P+K+I
Sbjct: 1   MALVPIVVEQTSKGERSYDIYSRLLKERIIFLTGQVEDHMANLIVAQMLFLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGVVTAG+AIYDTM FIKP ++T C GQA SMG+ LLS G KG RFALPNAR+
Sbjct: 61  YLYINSPGGVVTAGLAIYDTMNFIKPDVATLCTGQACSMGAFLLSGGAKGKRFALPNARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI+  AQ+I+K+K  L     ++ G+ +E+V    +RD+ MSA EA
Sbjct: 121 MIHQPLGGARGQATDIQIQAQEILKLKEMLTRKMAEHSGQPFEKVAADTERDNFMSAVEA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++DKVL  R
Sbjct: 181 MEYGLIDKVLTHR 193


>gi|329122525|ref|ZP_08251109.1| ATP-dependent Clp protease, protease subunit [Haemophilus aegyptius
           ATCC 11116]
 gi|327473154|gb|EGF18577.1| ATP-dependent Clp protease, protease subunit [Haemophilus aegyptius
           ATCC 11116]
          Length = 211

 Score =  269 bits (687), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 158/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++PMVVEQT+RGERSYDIYSRLLKER++F++G++ED MA LI AQLLFLE+E+P K+I
Sbjct: 19  MSVIPMVVEQTSRGERSYDIYSRLLKERVIFLSGEVEDRMANLIVAQLLFLESEDPTKDI 78

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           ++YINSPGG VTAGMAIYDTMQFIKP I T C+GQA SMG+ LL+ G  G R ALPNAR+
Sbjct: 79  NIYINSPGGSVTAGMAIYDTMQFIKPDIRTLCIGQACSMGAFLLAGGTAGKRAALPNARV 138

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI+ HAQ+I+KIK  LN+    + G++ E +EK  DRD+ MSA EA
Sbjct: 139 MIHQPLGGFRGQASDIQIHAQEILKIKHTLNDRLAFHTGQSIERIEKDTDRDNFMSAEEA 198

Query: 196 CDWGVVDKVLMSR 208
             +G+VD+VL+ R
Sbjct: 199 QVYGLVDEVLVKR 211


>gi|190150599|ref|YP_001969124.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|303252091|ref|ZP_07338260.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|307248303|ref|ZP_07530328.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|307263943|ref|ZP_07545546.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|226706435|sp|B3H252|CLPP_ACTP7 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|189915730|gb|ACE61982.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|302649073|gb|EFL79260.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|306855173|gb|EFM87351.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|306870705|gb|EFN02446.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 196

 Score =  269 bits (687), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 123/193 (63%), Positives = 157/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQT++GERSYDIYSRLLKERI+F+TGQ+EDHMA LI AQ+LFLEAE+P+K+I
Sbjct: 1   MALVPIVVEQTSKGERSYDIYSRLLKERIIFLTGQVEDHMANLIVAQMLFLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGVVTAG+AIYDTM FIKP ++T C GQA SMG+ LLS G KG RFALPNAR+
Sbjct: 61  YLYINSPGGVVTAGLAIYDTMNFIKPDVATLCTGQACSMGAFLLSGGAKGKRFALPNARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI+  AQ+I+K+K  L     ++ G+ +E+V    +RD+ MSA EA
Sbjct: 121 MIHQPLGGARGQATDIQIQAQEILKLKEMLTRKMAEHSGQPFEKVAADTERDNFMSAVEA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++DKVL  R
Sbjct: 181 MEYGLIDKVLTHR 193


>gi|91787906|ref|YP_548858.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Polaromonas
           sp. JS666]
 gi|91697131|gb|ABE43960.1| ATP-dependent Clp protease proteolytic subunit ClpP [Polaromonas
           sp. JS666]
          Length = 218

 Score =  269 bits (687), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 156/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG+VPMV+EQ+ RGERSYDIYSRLLKER++F+ G + D  A L+ AQLLFLE+ENP K+I
Sbjct: 25  LGMVPMVIEQSGRGERSYDIYSRLLKERVIFLVGPVNDQTANLVVAQLLFLESENPDKDI 84

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S YINSPGG VTAGMAIYDTMQFIKP +ST C+G AASMG+ LLSAG KG RF+LPN+R+
Sbjct: 85  SFYINSPGGSVTAGMAIYDTMQFIKPDVSTLCVGMAASMGAFLLSAGAKGKRFSLPNSRV 144

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA+DIE HA+DI+K + +LN I   N G+  E++E+  +RD+ + A +A
Sbjct: 145 MIHQPSGGAQGQATDIEIHARDILKTRDQLNRILAANTGQPIEKIERDTERDYFLFAEDA 204

Query: 196 CDWGVVDKVLMSR 208
            ++G+VD+V+  R
Sbjct: 205 KEYGLVDQVISRR 217


>gi|26989024|ref|NP_744449.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas putida
           KT2440]
 gi|148548677|ref|YP_001268779.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas putida
           F1]
 gi|38257487|sp|Q88KJ0|CLPP_PSEPK RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166214701|sp|A5W635|CLPP_PSEP1 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|24983847|gb|AAN67913.1|AE016423_8 ATP-dependent Clp protease, proteolytic subunit ClpP [Pseudomonas
           putida KT2440]
 gi|148512735|gb|ABQ79595.1| ATP-dependent Clp protease proteolytic subunit ClpP [Pseudomonas
           putida F1]
 gi|171362771|dbj|BAG15849.1| probable ATP-dependent clp protease [Pseudomonas putida]
          Length = 213

 Score =  269 bits (687), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 155/192 (80%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMV+EQ+ RGER+YDIYSRLLKER++F+ G +ED+MA L+ AQLLFLEAENP K+I 
Sbjct: 18  GLVPMVIEQSARGERAYDIYSRLLKERVIFLVGPVEDYMANLVVAQLLFLEAENPDKDIH 77

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQA SMG+ LL+AG KG R  LPN+R++
Sbjct: 78  LYINSPGGSVTAGMSIYDTMQFIKPDVSTICIGQACSMGAFLLAAGAKGKRHCLPNSRVM 137

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQA+DIE HAQ+I+ IK RLNE+   + G+  E +++  +RD+ MSAS A 
Sbjct: 138 IHQPLGGFQGQATDIEIHAQEILNIKARLNELLAYHTGQDLETIKRDTERDNFMSASRAA 197

Query: 197 DWGVVDKVLMSR 208
           ++G++D V   R
Sbjct: 198 EYGLIDSVYDKR 209


>gi|254448838|ref|ZP_05062294.1| ATP-dependent Clp protease, proteolytic subunit ClpP [gamma
           proteobacterium HTCC5015]
 gi|198261528|gb|EDY85817.1| ATP-dependent Clp protease, proteolytic subunit ClpP [gamma
           proteobacterium HTCC5015]
          Length = 236

 Score =  269 bits (687), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 158/191 (82%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQ+ RGER++DIYSRLLKER++F+ GQ+E+HMA LI AQLLFLEA+NP K+ISL
Sbjct: 46  LVPMVVEQSARGERAFDIYSRLLKERVIFMVGQVEEHMANLIVAQLLFLEADNPDKDISL 105

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGMAIYDTM+FIKP +ST C+GQAASMG+ LLS G KG RFALPN+ +++
Sbjct: 106 YINSPGGSVTAGMAIYDTMRFIKPDVSTLCIGQAASMGAFLLSGGAKGKRFALPNSSVMI 165

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQA+DI+ HA++I+K K +LN +   + G+ +E V +  +RD+ M A EA +
Sbjct: 166 HQPLGGFQGQATDIDIHARNILKTKEKLNRMLADHTGQPFERVVEDTERDNFMGADEAKE 225

Query: 198 WGVVDKVLMSR 208
           +G++D VL++R
Sbjct: 226 YGLIDDVLVTR 236


>gi|294141768|ref|YP_003557746.1| ATP-dependent Clp protease, proteolytic subunit [Shewanella
           violacea DSS12]
 gi|293328237|dbj|BAJ02968.1| ATP-dependent Clp protease, proteolytic subunit [Shewanella
           violacea DSS12]
          Length = 203

 Score =  269 bits (687), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 156/194 (80%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E V   LVPMVVEQT +GERSYDIYSRLLKERI+F+ G +E+HMA L+ AQLLFLE+E+P
Sbjct: 6   ESVLNALVPMVVEQTAKGERSYDIYSRLLKERIIFLVGPVEEHMANLVVAQLLFLESESP 65

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            K+I LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+ G  G R  LP
Sbjct: 66  DKDIFLYINSPGGSVTAGMAIYDTMQFIKPDVSTVCIGQAASMGAFLLAGGAAGKRHCLP 125

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+R+++HQP GGF GQASDI  HAQ+I+ IK +LNE+  ++ G+  E +E+  DRD+ MS
Sbjct: 126 NSRVMIHQPLGGFQGQASDIAIHAQEILGIKNKLNEMLAEHTGQPLEVIERDTDRDNFMS 185

Query: 192 ASEACDWGVVDKVL 205
           A++A ++G+VD V+
Sbjct: 186 AAQAAEYGLVDSVM 199


>gi|153007825|ref|YP_001369040.1| ATP-dependent Clp protease proteolytic subunit [Ochrobactrum
           anthropi ATCC 49188]
 gi|151559713|gb|ABS13211.1| Endopeptidase Clp [Ochrobactrum anthropi ATCC 49188]
          Length = 202

 Score =  269 bits (687), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 118/191 (61%), Positives = 156/191 (81%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQ++RGERS+DIYSRLL+ERI+F+ G++ D ++ LICAQLLFLEAEN ++ I+L
Sbjct: 7   LVPMVVEQSSRGERSFDIYSRLLRERIIFLNGEVNDTVSALICAQLLFLEAENSKQPINL 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G+AIYDTM++++ P+ T CMG A SMGS LL AGE G R ALPNA +L+
Sbjct: 67  YINSPGGVVTSGLAIYDTMRYVRAPVHTLCMGTARSMGSFLLMAGEPGHRAALPNANLLV 126

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGGF GQASDI  HA++  + KR +  +Y ++CG+TYEEVE+ LDRD+ M+A    +
Sbjct: 127 HQPSGGFQGQASDIFIHAEEAQRTKRLMTRLYAEHCGRTYEEVERALDRDNFMTAEAGLE 186

Query: 198 WGVVDKVLMSR 208
           WG++D++L  R
Sbjct: 187 WGLIDRILERR 197


>gi|323697668|ref|ZP_08109580.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Desulfovibrio
           sp. ND132]
 gi|323457600|gb|EGB13465.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Desulfovibrio
           desulfuricans ND132]
          Length = 202

 Score =  269 bits (687), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 120/198 (60%), Positives = 162/198 (81%)

Query: 19  VPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLY 78
           +PMV+E T R ER+YDIYSRLLK+RI+ +   I+DH+A+LICAQLLFLE+E+P+KEI +Y
Sbjct: 4   IPMVIETTGRTERAYDIYSRLLKDRIILLGTAIDDHVASLICAQLLFLESEDPEKEIYMY 63

Query: 79  INSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLH 138
           INSPGGVVT+GMAIYDTMQ+I  P++T CMGQAASM SLLL AGEKGMR++LP++RIL+H
Sbjct: 64  INSPGGVVTSGMAIYDTMQYISAPVATLCMGQAASMASLLLCAGEKGMRYSLPHSRILIH 123

Query: 139 QPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDW 198
           QP GG  GQASDI  HA++I+++K  LN I  ++ G++ E++    DRD+ MS+ EA ++
Sbjct: 124 QPLGGAQGQASDISIHAKEILRMKDELNGIMARHTGQSIEKITADTDRDYFMSSEEALEY 183

Query: 199 GVVDKVLMSRIDIEEKSK 216
           G++DKV+ SR D++E  K
Sbjct: 184 GLIDKVMKSRADVDESIK 201


>gi|258544428|ref|ZP_05704662.1| endopeptidase Clp [Cardiobacterium hominis ATCC 15826]
 gi|258520317|gb|EEV89176.1| endopeptidase Clp [Cardiobacterium hominis ATCC 15826]
          Length = 206

 Score =  268 bits (686), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 121/196 (61%), Positives = 158/196 (80%), Gaps = 2/196 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           L+PMVVEQT RGERSYDIYSRLLKER++F+ G + D  A L+ AQ+LFLEAENP ++I L
Sbjct: 8   LIPMVVEQTGRGERSYDIYSRLLKERVIFLVGPVNDASANLVVAQMLFLEAENPDQDIHL 67

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM++YDTM FIKP +ST C+GQAASMG++LL+AG KG RFALP++R+++
Sbjct: 68  YINSPGGSVTAGMSVYDTMNFIKPDVSTLCLGQAASMGAMLLTAGAKGKRFALPHSRVMI 127

Query: 138 HQP--SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP  SGG  GQASDIE HA++++K+K  LNE+  K+ G+  E++E+  DRD+ MSA EA
Sbjct: 128 HQPLISGGLGGQASDIEIHARELLKMKATLNELLAKHSGQPLEKIERDTDRDNFMSAEEA 187

Query: 196 CDWGVVDKVLMSRIDI 211
             +G++D V  +R DI
Sbjct: 188 AAYGLIDHVTTARADI 203


>gi|218768333|ref|YP_002342845.1| endopeptidase [Neisseria meningitidis Z2491]
 gi|18203136|sp|Q9JU33|CLPP_NEIMA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|121052341|emb|CAM08672.1| endopeptidase [Neisseria meningitidis Z2491]
 gi|308389431|gb|ADO31751.1| ATP-dependent Clp protease, proteolytic subunit [Neisseria
           meningitidis alpha710]
 gi|319410578|emb|CBY90947.1| ATP-dependent Clp protease proteolytic subunit (endopeptidase Clp)
           [Neisseria meningitidis WUE 2594]
          Length = 204

 Score =  268 bits (686), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 159/197 (80%), Gaps = 2/197 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFLE+ENP K+I  
Sbjct: 7   LVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFF 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG RFALPN+RI++
Sbjct: 67  YINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMI 126

Query: 138 HQP--SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP  SGG  GQASDIE HA++++KIK +LN +  K+CG+   ++E+  DRD+ MSA EA
Sbjct: 127 HQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCGRDLADLERDTDRDNFMSAEEA 186

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G++D+VL +R  ++
Sbjct: 187 KEYGLIDQVLENRASLQ 203


>gi|255067667|ref|ZP_05319522.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Neisseria
           sicca ATCC 29256]
 gi|255048141|gb|EET43605.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Neisseria
           sicca ATCC 29256]
          Length = 206

 Score =  268 bits (686), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 159/197 (80%), Gaps = 2/197 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFLE+ENP K+I  
Sbjct: 9   LVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFF 68

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG RFALPN+RI++
Sbjct: 69  YINSPGGSVTAGMSIYDTMNFIKPNVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMI 128

Query: 138 HQP--SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP  SGG  GQASDIE HA++++KIK +LN +  K+CG+   ++E+  DRD+ MSA EA
Sbjct: 129 HQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCGRDLADLERDTDRDNFMSAEEA 188

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G++D+VL +R  ++
Sbjct: 189 KEYGLIDQVLENRASLQ 205


>gi|160897495|ref|YP_001563077.1| ATP-dependent Clp protease proteolytic subunit [Delftia acidovorans
           SPH-1]
 gi|160363079|gb|ABX34692.1| Endopeptidase Clp [Delftia acidovorans SPH-1]
          Length = 201

 Score =  268 bits (686), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 154/191 (80%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQ+ RGERS+DIYSRLL++R++F+ G++ D ++ L+CAQLLFLEAENP K I L
Sbjct: 7   LVPMVVEQSARGERSFDIYSRLLRDRVIFLNGEVNDAVSALVCAQLLFLEAENPDKPIHL 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGV+T+G+A+YDTMQFIK P+ T CMG A SMGS LL AGE G R ALPNA + +
Sbjct: 67  YINSPGGVITSGLAMYDTMQFIKSPVHTLCMGTARSMGSFLLMAGEPGHRMALPNASLHV 126

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG  GQASDI  HA+++++ K R+  +Y ++CG++YEEVE+ LDRD  M+A EA +
Sbjct: 127 HQPLGGVQGQASDIRIHAEEMLRTKDRVTRLYAQHCGRSYEEVERDLDRDRFMTAEEARE 186

Query: 198 WGVVDKVLMSR 208
           WG++DKVL  R
Sbjct: 187 WGLIDKVLDRR 197


>gi|170718338|ref|YP_001783566.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus somnus
           2336]
 gi|189082460|sp|B0UW20|CLPP_HAES2 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|168826467|gb|ACA31838.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Haemophilus
           somnus 2336]
          Length = 193

 Score =  268 bits (686), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 123/193 (63%), Positives = 159/193 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++PMVVEQT+RGERSYDIYSRLLKER++F+TG++ED MA LI AQLLFLEAE+P K+I
Sbjct: 1   MSVIPMVVEQTSRGERSYDIYSRLLKERVIFLTGEVEDRMANLIVAQLLFLEAEDPAKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           ++YINSPGG VTAGMAIYDTMQFIKP + T C+GQA SMG+ LL+ G  G R ALP+AR+
Sbjct: 61  NIYINSPGGSVTAGMAIYDTMQFIKPNVRTLCIGQACSMGAFLLAGGTAGKRAALPHARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI+ HAQ+I+KIK+ LNE    + G++ E++E+  DRD+ MSA +A
Sbjct: 121 MIHQPLGGFRGQASDIQIHAQEILKIKQTLNERLAFHTGQSIEQIEQDTDRDNFMSAEQA 180

Query: 196 CDWGVVDKVLMSR 208
             +G+VD VL+ R
Sbjct: 181 KLYGLVDDVLIKR 193


>gi|261364459|ref|ZP_05977342.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Neisseria
           mucosa ATCC 25996]
 gi|288567379|gb|EFC88939.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Neisseria
           mucosa ATCC 25996]
          Length = 206

 Score =  268 bits (685), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 159/197 (80%), Gaps = 2/197 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFLE+ENP K+I  
Sbjct: 9   LVPTVIEQSGRGERAFDIYSRLLKERIVFLIGPVTDESANLVVAQLLFLESENPDKDIFF 68

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG RFALPN+RI++
Sbjct: 69  YINSPGGSVTAGMSIYDTMNFIKPNVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMI 128

Query: 138 HQP--SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP  SGG  GQASDIE HA++++KIK +LN +  K+CG+   ++E+  DRD+ MSA EA
Sbjct: 129 HQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCGRDLADLERDTDRDNFMSAEEA 188

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G++D+VL +R  ++
Sbjct: 189 KEYGLIDQVLENRASLQ 205


>gi|254670503|emb|CBA06249.1| ATP-dependent Clp protease, proteolytic subunit [Neisseria
           meningitidis alpha153]
          Length = 209

 Score =  268 bits (685), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 159/197 (80%), Gaps = 2/197 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFLE+ENP K+I  
Sbjct: 12  LVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFF 71

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG RFALPN+RI++
Sbjct: 72  YINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMI 131

Query: 138 HQP--SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP  SGG  GQASDIE HA++++KIK +LN +  K+CG+   ++E+  DRD+ MSA EA
Sbjct: 132 HQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCGRDLADLERDTDRDNFMSAEEA 191

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G++D+VL +R  ++
Sbjct: 192 KEYGLIDQVLENRASLQ 208


>gi|68249290|ref|YP_248402.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae 86-028NP]
 gi|161350016|ref|NP_438872.3| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae Rd KW20]
 gi|260581528|ref|ZP_05849336.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Haemophilus
           influenzae RdAW]
 gi|1168977|sp|P43867|CLPP_HAEIN RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|81336285|sp|Q4QMK5|CLPP_HAEI8 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|1573716|gb|AAC22371.1| ATP-dependent Clp protease, proteolytic subunit (clpP) [Haemophilus
           influenzae Rd KW20]
 gi|68057489|gb|AAX87742.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae 86-028NP]
 gi|260091826|gb|EEW75781.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Haemophilus
           influenzae RdAW]
          Length = 193

 Score =  268 bits (685), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 157/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++PMVVEQT+RGERSYDIYSRLLKER++F++G++ED MA LI AQLLFLE+E+P K+I
Sbjct: 1   MSVIPMVVEQTSRGERSYDIYSRLLKERVIFLSGEVEDRMANLIVAQLLFLESEDPTKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           ++YINSPGG VTAGMAIYDTMQFIKP I T C+GQA SMG+ LL+ G  G R ALPNAR+
Sbjct: 61  NIYINSPGGSVTAGMAIYDTMQFIKPDIRTLCIGQACSMGAFLLAGGTAGKRAALPNARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI+ HAQ+I+KIK  LN+    + G+  E +EK  DRD+ MSA EA
Sbjct: 121 MIHQPLGGFRGQASDIQIHAQEILKIKHTLNDRLAFHTGQGIERIEKDTDRDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G+VD+VL+ R
Sbjct: 181 QAYGLVDEVLVKR 193


>gi|223042116|ref|ZP_03612288.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           minor 202]
 gi|240950344|ref|ZP_04754614.1| ATP-dependent Clp protease proteolytic subunit ClpP [Actinobacillus
           minor NM305]
 gi|223017093|gb|EEF15533.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           minor 202]
 gi|240295155|gb|EER45974.1| ATP-dependent Clp protease proteolytic subunit ClpP [Actinobacillus
           minor NM305]
          Length = 197

 Score =  268 bits (685), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 160/196 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+PMVVEQT++GERSYDIYSRLLKERI+F+ GQ+ED+MA LI AQLLFLEAE+P+K+I
Sbjct: 1   MALIPMVVEQTSKGERSYDIYSRLLKERIIFLNGQVEDNMANLIVAQLLFLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGVVTAG+AIYDTM FIKP ++T C GQA SMG+ LLS G KG RFALPNAR+
Sbjct: 61  YLYINSPGGVVTAGLAIYDTMNFIKPDVATLCTGQACSMGAFLLSGGAKGKRFALPNARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI+  AQ+I+K+K  L     ++ G+++++V    +RD+ MSA EA
Sbjct: 121 MIHQPLGGARGQATDIQIQAQEILKLKEMLTRKMAEHSGQSFDKVAADTERDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSRIDI 211
            ++G++DKVL SR ++
Sbjct: 181 KEYGLIDKVLTSRGEV 196


>gi|71066496|ref|YP_265223.1| ATP-dependent Clp protease proteolytic subunit [Psychrobacter
           arcticus 273-4]
 gi|110816464|sp|Q4FQB9|CLPP_PSYA2 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|71039481|gb|AAZ19789.1| ATP-dependent Clp protease proteolytic subunit ClpP [Psychrobacter
           arcticus 273-4]
          Length = 225

 Score =  268 bits (685), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 160/192 (83%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQ+ RGERS+DI+SRLL+ER++F+TGQ+EDHMA LI AQLLFLEAENP K+I 
Sbjct: 30  ALVPMVVEQSARGERSFDIFSRLLRERVIFLTGQVEDHMANLIVAQLLFLEAENPDKDIH 89

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG V+AG+AI+DTM FIKP +ST CMG A SMGS LL+AG+KG R+AL NAR++
Sbjct: 90  LYINSPGGSVSAGLAIFDTMNFIKPEVSTICMGGAYSMGSFLLAAGQKGKRYALANARVM 149

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG  GQA+DIE +A++I+K + RLNEI  +  G++ E++EK ++RD+ + A EA 
Sbjct: 150 IHQPSGGAQGQATDIEINAREILKTRARLNEILAERTGQSVEKIEKDVERDYWLDAKEAK 209

Query: 197 DWGVVDKVLMSR 208
           ++G++D+VL  R
Sbjct: 210 EYGLIDEVLERR 221


>gi|300114126|ref|YP_003760701.1| ATP-dependent Clp protease proteolytic subunit ClpP [Nitrosococcus
           watsonii C-113]
 gi|299540063|gb|ADJ28380.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Nitrosococcus
           watsonii C-113]
          Length = 203

 Score =  268 bits (685), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 157/194 (80%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQT RGER+YDIYSRLLKER+VF+ G +EDHMA L+ AQLLFLE+ENP K+I L
Sbjct: 8   LVPMVVEQTARGERAYDIYSRLLKERVVFLVGPVEDHMANLVVAQLLFLESENPDKDIHL 67

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAG++IYDTMQFIKP +ST C+GQAASMG++LL+ G  G R  LP++R+L+
Sbjct: 68  YINSPGGSVTAGLSIYDTMQFIKPDVSTLCVGQAASMGAVLLAGGAPGKRHCLPHSRLLI 127

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQA+DI+ HA++I+ ++ RLN I  K+ G+  E+++   DRD+ MSA+E+  
Sbjct: 128 HQPLGGFQGQATDIDIHAREILLVRERLNHILAKHTGQPIEKIQHDTDRDYFMSATESLA 187

Query: 198 WGVVDKVLMSRIDI 211
           +G+VD VL  R +I
Sbjct: 188 YGLVDSVLKQRTEI 201


>gi|292493106|ref|YP_003528545.1| ATP-dependent Clp protease proteolytic subunit ClpP [Nitrosococcus
           halophilus Nc4]
 gi|291581701|gb|ADE16158.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Nitrosococcus
           halophilus Nc4]
          Length = 203

 Score =  268 bits (685), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 120/191 (62%), Positives = 157/191 (82%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQT RGER+YDIYSRLLKER+VF+ G +EDHMA L+ AQLLFLE+ENP K+I L
Sbjct: 8   LVPMVVEQTARGERAYDIYSRLLKERVVFLVGPVEDHMANLVVAQLLFLESENPDKDIHL 67

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAG+++YDTMQFIKP IST C+GQAASMG++LL+ G +G R  LP++R+L+
Sbjct: 68  YINSPGGSVTAGLSVYDTMQFIKPDISTLCIGQAASMGAVLLAGGTQGKRHCLPHSRLLI 127

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQA+DI+ HA++I+ ++ RLN I  K+ G+  E++++  DRD+ MSA+E+  
Sbjct: 128 HQPLGGFQGQAADIDIHAREIMLVRERLNHILAKHTGQPIEKIQRDTDRDYFMSANESVA 187

Query: 198 WGVVDKVLMSR 208
           +G+VD VL  R
Sbjct: 188 YGLVDSVLQQR 198


>gi|192360657|ref|YP_001982472.1| ATP-dependent Clp protease proteolytic subunit [Cellvibrio
           japonicus Ueda107]
 gi|190686822|gb|ACE84500.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Cellvibrio
           japonicus Ueda107]
          Length = 214

 Score =  268 bits (685), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 163/209 (77%), Gaps = 1/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS++   K  S  +  GLVP+V+EQT RGERS+DIYSRLLKER++F+ G +ED+MA L+ 
Sbjct: 1   MSYD-YPKSQSPIINSGLVPIVIEQTARGERSFDIYSRLLKERVIFLVGPVEDYMANLVV 59

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLEAENP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQA SMG+ LL+
Sbjct: 60  AQLLFLEAENPDKDIHLYINSPGGSVTAGMSIYDTMQFIKPDVSTMCIGQACSMGAFLLN 119

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG +G RF LPN+R+++HQPSGG  GQASDI   AQ+I+KI+ RLNE+   + G+  E +
Sbjct: 120 AGAEGKRFCLPNSRVMIHQPSGGAQGQASDIHIQAQEILKIRARLNELMAHHSGQPIERI 179

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E   +RD+ MSA +A D+G++D V+  RI
Sbjct: 180 EVDTERDNFMSAQQAKDYGLIDAVVEKRI 208


>gi|170720927|ref|YP_001748615.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas putida
           W619]
 gi|325274289|ref|ZP_08140400.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas sp.
           TJI-51]
 gi|226706466|sp|B1J692|CLPP_PSEPW RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|169758930|gb|ACA72246.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Pseudomonas
           putida W619]
 gi|324100572|gb|EGB98307.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas sp.
           TJI-51]
          Length = 213

 Score =  268 bits (685), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 120/192 (62%), Positives = 155/192 (80%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMV+EQ+ RGER+YDIYSRLLKER++F+ G +ED+MA L+ AQ+LFLEAENP K+I 
Sbjct: 18  GLVPMVIEQSARGERAYDIYSRLLKERVIFLVGPVEDYMANLVVAQMLFLEAENPDKDIH 77

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQA SMG+ LL+AG KG R  LPN+R++
Sbjct: 78  LYINSPGGSVTAGMSIYDTMQFIKPDVSTICIGQACSMGAFLLAAGAKGKRHCLPNSRVM 137

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQA+DIE HAQ+I+ IK RLNE+   + G+  E +++  +RD+ MSAS A 
Sbjct: 138 IHQPLGGFQGQATDIEIHAQEILNIKARLNELLAYHTGQDLETIKRDTERDNFMSASRAA 197

Query: 197 DWGVVDKVLMSR 208
           ++G++D V   R
Sbjct: 198 EYGLIDSVYDKR 209


>gi|116785036|gb|ABK23566.1| unknown [Picea sitchensis]
          Length = 243

 Score =  268 bits (685), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 159/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GL+PMV+EQT+RGER+YDI+SRLLKERI+ + G IED  A ++ AQLLFLE+ENP K I+
Sbjct: 32  GLIPMVIEQTSRGERAYDIFSRLLKERIICINGVIEDDTAAVVVAQLLFLESENPAKPIN 91

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGVVTAG+AIYDTMQ+I+ P+STFCMGQAASMGSLLL+AG KG R +LPNARI+
Sbjct: 92  LYINSPGGVVTAGLAIYDTMQYIRSPVSTFCMGQAASMGSLLLAAGAKGERRSLPNARIM 151

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG SGQASDI   A++I+  + RLN +Y K+ G++ +++EK ++RD  MS  EA 
Sbjct: 152 IHQPSGGASGQASDIAIQAKEILLTRDRLNSLYAKHTGQSIDKIEKCMERDMFMSPEEAK 211

Query: 197 DWGVVDKVLMSR 208
           ++G+VD V+  R
Sbjct: 212 EFGLVDTVIEQR 223


>gi|91775762|ref|YP_545518.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Methylobacillus flagellatus KT]
 gi|116243149|sp|Q1H1G0|CLPP_METFK RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|91709749|gb|ABE49677.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Methylobacillus flagellatus KT]
          Length = 213

 Score =  268 bits (684), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 159/210 (75%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           + +   A+   E   LG +PMV+EQ+ RGERSYDIYSRLLKERI+F+ G + D  A L+ 
Sbjct: 2   IHYPATAQSQFEAQGLGYIPMVIEQSGRGERSYDIYSRLLKERIIFLVGPVNDATANLVV 61

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLEAENP K+I  YINSPGG VTAGM IYDTMQF+KP +ST C+GQAASMG+LLL+
Sbjct: 62  AQLLFLEAENPDKDIYFYINSPGGSVTAGMGIYDTMQFVKPDVSTLCVGQAASMGALLLA 121

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG +G RF LPN+R+++HQP GGF GQASDIE HA++I+ ++ +LN I   + G+  E++
Sbjct: 122 AGAQGKRFCLPNSRVMIHQPLGGFQGQASDIEIHAKEILFLREKLNHILASHTGQPVEKI 181

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRID 210
               DRD+ MSA ++  +G+VDKV+ SR D
Sbjct: 182 ALDTDRDNFMSAEQSVAYGIVDKVIASRAD 211


>gi|254805112|ref|YP_003083333.1| ATP-dependent Clp protease, proteolytic subunit [Neisseria
           meningitidis alpha14]
 gi|254668654|emb|CBA06317.1| ATP-dependent Clp protease, proteolytic subunit [Neisseria
           meningitidis alpha14]
          Length = 204

 Score =  268 bits (684), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 122/197 (61%), Positives = 159/197 (80%), Gaps = 2/197 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFLE+ENP K+I  
Sbjct: 7   LVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFF 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG RFALPN+RI++
Sbjct: 67  YINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMI 126

Query: 138 HQP--SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP  SGG  GQASDIE HA++++KIK +LN +  K+CG+   ++E+  DRD+ MSA EA
Sbjct: 127 HQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCGRDLADLERDTDRDNFMSAEEA 186

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G++D++L +R  ++
Sbjct: 187 KEYGLIDQILENRASLQ 203


>gi|254525030|ref|ZP_05137085.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Stenotrophomonas sp. SKA14]
 gi|219722621|gb|EED41146.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Stenotrophomonas sp. SKA14]
          Length = 196

 Score =  268 bits (684), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 119/190 (62%), Positives = 161/190 (84%)

Query: 21  MVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYIN 80
           MVVEQT+RGER+YDIYSRLLKER++F+ G I+DHMA ++ AQLLFLE+ENP+K+I++YIN
Sbjct: 1   MVVEQTSRGERAYDIYSRLLKERLIFLVGPIDDHMANVVVAQLLFLESENPEKDINIYIN 60

Query: 81  SPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQP 140
           SPGGVVTAGMAIYDTMQ+IKP +ST C+GQAASMG+LLL+AGE G R+ALPN+R+++HQP
Sbjct: 61  SPGGVVTAGMAIYDTMQYIKPNVSTTCIGQAASMGALLLAAGEAGKRYALPNSRVMIHQP 120

Query: 141 SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGV 200
            GG+ GQA+DI+ HA++I+ ++ RLNE+  K+ G++ E + +  +RD+  SA EA  +G+
Sbjct: 121 LGGYQGQATDIDIHAREILTLRSRLNEVLAKHTGQSLETIARDTERDNFKSAFEAQAYGL 180

Query: 201 VDKVLMSRID 210
           VD+VL  R D
Sbjct: 181 VDQVLERRPD 190


>gi|194098886|ref|YP_002001950.1| ATP-dependent Clp protease proteolytic subunit [Neisseria
           gonorrhoeae NCCP11945]
 gi|193934176|gb|ACF30000.1| putative endopeptidase [Neisseria gonorrhoeae NCCP11945]
 gi|317164458|gb|ADV07999.1| ATP-dependent Clp protease proteolytic subunit [Neisseria
           gonorrhoeae TCDC-NG08107]
          Length = 209

 Score =  268 bits (684), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 123/193 (63%), Positives = 157/193 (81%), Gaps = 2/193 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFLE+ENP K+I  
Sbjct: 12  LVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFF 71

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG RFALPN+RI++
Sbjct: 72  YINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMI 131

Query: 138 HQP--SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP  SGG  GQASDIE HA++++KIK +LN +  K+CG+   ++E+  DRD+ MSA EA
Sbjct: 132 HQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCGRDLADLERDTDRDNFMSAEEA 191

Query: 196 CDWGVVDKVLMSR 208
            ++G++D+VL +R
Sbjct: 192 KEYGLIDQVLENR 204


>gi|261377747|ref|ZP_05982320.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Neisseria
           cinerea ATCC 14685]
 gi|269146032|gb|EEZ72450.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Neisseria
           cinerea ATCC 14685]
          Length = 206

 Score =  268 bits (684), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 122/197 (61%), Positives = 159/197 (80%), Gaps = 2/197 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFLE+ENP K+I  
Sbjct: 9   LVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFF 68

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG RFALPN+RI++
Sbjct: 69  YINSPGGSVTAGMSIYDTMNFIKPNVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMI 128

Query: 138 HQP--SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP  SGG  GQASDIE HA++++KIK +LN +  K+CG+   ++E+  DRD+ MSA EA
Sbjct: 129 HQPLISGGLGGQASDIEIHARELLKIKEKLNHLMAKHCGRDLADLERDTDRDNFMSAEEA 188

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G++D++L +R  ++
Sbjct: 189 KEYGLIDQILENRASLQ 205


>gi|329908483|ref|ZP_08274873.1| ATP-dependent Clp protease proteolytic subunit [Oxalobacteraceae
           bacterium IMCC9480]
 gi|327546710|gb|EGF31661.1| ATP-dependent Clp protease proteolytic subunit [Oxalobacteraceae
           bacterium IMCC9480]
          Length = 206

 Score =  268 bits (684), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 122/197 (61%), Positives = 157/197 (79%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E   LG++PMV+EQ+ RGERSYDIYSRLLKER++F+ G + D +A LI AQLLFLE+ENP
Sbjct: 9   EPQMLGMIPMVIEQSGRGERSYDIYSRLLKERVIFLVGPVNDGVANLIVAQLLFLESENP 68

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            K+ISLYINSPGG V+AGMAI+DTMQFIKP +ST C G AASMG+ LL+AG KG RF+LP
Sbjct: 69  DKDISLYINSPGGSVSAGMAIFDTMQFIKPNVSTLCTGLAASMGAFLLAAGAKGKRFSLP 128

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+RI++HQPSGG  GQA+DIE  A++I+ ++ RLN I     G+T EE+ +  +RD+ MS
Sbjct: 129 NSRIMIHQPSGGAQGQATDIEIQAKEILYLRERLNGILADKTGRTIEEIRRDTERDNFMS 188

Query: 192 ASEACDWGVVDKVLMSR 208
           A EA  +G++DKVL +R
Sbjct: 189 ADEAEKYGMIDKVLTTR 205


>gi|313887837|ref|ZP_07821517.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Peptoniphilus harei ACS-146-V-Sch2b]
 gi|312846180|gb|EFR33561.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Peptoniphilus harei ACS-146-V-Sch2b]
          Length = 194

 Score =  268 bits (684), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 159/194 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQTNRGERSYDIYSRLLK+RI+F++G++ D MA LI AQLLFLEAE+P K+I
Sbjct: 1   MALVPMVVEQTNRGERSYDIYSRLLKDRIIFLSGEVNDTMADLIVAQLLFLEAEDPNKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG V+AG AIYDTM +IKP +ST C+G AASMG+ LL++G KG RFALPN+ I
Sbjct: 61  QLYINSPGGSVSAGFAIYDTMNYIKPDVSTICIGMAASMGAFLLASGAKGKRFALPNSDI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQASDI+ +A+ I+KI+ +LNEI  +  G+  E++EK  DRD+ +++ EA
Sbjct: 121 MIHQPSGGAQGQASDIQINAEKILKIRHKLNEILAERTGQDLEKIEKDTDRDYWLNSQEA 180

Query: 196 CDWGVVDKVLMSRI 209
            D+G++DKV+  R+
Sbjct: 181 KDYGLIDKVIEKRV 194


>gi|254673129|emb|CBA07904.1| ATP-dependent Clp protease, proteolytic subunit [Neisseria
           meningitidis alpha275]
          Length = 209

 Score =  268 bits (684), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 122/197 (61%), Positives = 159/197 (80%), Gaps = 2/197 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFLE+ENP K+I  
Sbjct: 12  LVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFF 71

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG RFALPN+RI++
Sbjct: 72  YINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMI 131

Query: 138 HQP--SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP  SGG  GQASDIE HA++++KIK +LN +  K+CG+   ++E+  DRD+ MSA EA
Sbjct: 132 HQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCGRDLADLERDTDRDNFMSAEEA 191

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G++D++L +R  ++
Sbjct: 192 KEYGLIDQILENRASLQ 208


>gi|59801023|ref|YP_207735.1| putative endopeptidase [Neisseria gonorrhoeae FA 1090]
 gi|239999171|ref|ZP_04719095.1| putative endopeptidase [Neisseria gonorrhoeae 35/02]
 gi|240013921|ref|ZP_04720834.1| putative endopeptidase [Neisseria gonorrhoeae DGI18]
 gi|240016363|ref|ZP_04722903.1| putative endopeptidase [Neisseria gonorrhoeae FA6140]
 gi|240080482|ref|ZP_04725025.1| putative endopeptidase [Neisseria gonorrhoeae FA19]
 gi|240113150|ref|ZP_04727640.1| putative endopeptidase [Neisseria gonorrhoeae MS11]
 gi|240115906|ref|ZP_04729968.1| putative endopeptidase [Neisseria gonorrhoeae PID18]
 gi|240118204|ref|ZP_04732266.1| putative endopeptidase [Neisseria gonorrhoeae PID1]
 gi|240121490|ref|ZP_04734452.1| putative endopeptidase [Neisseria gonorrhoeae PID24-1]
 gi|240123752|ref|ZP_04736708.1| putative endopeptidase [Neisseria gonorrhoeae PID332]
 gi|240125943|ref|ZP_04738829.1| putative endopeptidase [Neisseria gonorrhoeae SK-92-679]
 gi|240128455|ref|ZP_04741116.1| putative endopeptidase [Neisseria gonorrhoeae SK-93-1035]
 gi|254493943|ref|ZP_05107114.1| endopeptidase [Neisseria gonorrhoeae 1291]
 gi|260440279|ref|ZP_05794095.1| ATP-dependent Clp protease proteolytic subunit [Neisseria
           gonorrhoeae DGI2]
 gi|268595002|ref|ZP_06129169.1| ATP-dependent Clp protease proteolytic subunit [Neisseria
           gonorrhoeae 35/02]
 gi|268596618|ref|ZP_06130785.1| ATP-dependent Clp protease proteolytic subunit [Neisseria
           gonorrhoeae FA19]
 gi|268599230|ref|ZP_06133397.1| endopeptidase [Neisseria gonorrhoeae MS11]
 gi|268601577|ref|ZP_06135744.1| endopeptidase [Neisseria gonorrhoeae PID18]
 gi|268603916|ref|ZP_06138083.1| endopeptidase [Neisseria gonorrhoeae PID1]
 gi|268682379|ref|ZP_06149241.1| endopeptidase [Neisseria gonorrhoeae PID332]
 gi|268684537|ref|ZP_06151399.1| endopeptidase [Neisseria gonorrhoeae SK-92-679]
 gi|268686847|ref|ZP_06153709.1| endopeptidase [Neisseria gonorrhoeae SK-93-1035]
 gi|291043574|ref|ZP_06569290.1| ATP-dependent Clp protease proteolytic subunit [Neisseria
           gonorrhoeae DGI2]
 gi|293398887|ref|ZP_06643052.1| Clp protease [Neisseria gonorrhoeae F62]
 gi|67460148|sp|Q5F914|CLPP_NEIG1 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|59717918|gb|AAW89323.1| putative endopeptidase [Neisseria gonorrhoeae FA 1090]
 gi|226512983|gb|EEH62328.1| endopeptidase [Neisseria gonorrhoeae 1291]
 gi|268548391|gb|EEZ43809.1| ATP-dependent Clp protease proteolytic subunit [Neisseria
           gonorrhoeae 35/02]
 gi|268550406|gb|EEZ45425.1| ATP-dependent Clp protease proteolytic subunit [Neisseria
           gonorrhoeae FA19]
 gi|268583361|gb|EEZ48037.1| endopeptidase [Neisseria gonorrhoeae MS11]
 gi|268585708|gb|EEZ50384.1| endopeptidase [Neisseria gonorrhoeae PID18]
 gi|268588047|gb|EEZ52723.1| endopeptidase [Neisseria gonorrhoeae PID1]
 gi|268622663|gb|EEZ55063.1| endopeptidase [Neisseria gonorrhoeae PID332]
 gi|268624821|gb|EEZ57221.1| endopeptidase [Neisseria gonorrhoeae SK-92-679]
 gi|268627131|gb|EEZ59531.1| endopeptidase [Neisseria gonorrhoeae SK-93-1035]
 gi|291012037|gb|EFE04026.1| ATP-dependent Clp protease proteolytic subunit [Neisseria
           gonorrhoeae DGI2]
 gi|291610301|gb|EFF39411.1| Clp protease [Neisseria gonorrhoeae F62]
          Length = 204

 Score =  268 bits (684), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 123/193 (63%), Positives = 157/193 (81%), Gaps = 2/193 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFLE+ENP K+I  
Sbjct: 7   LVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFF 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG RFALPN+RI++
Sbjct: 67  YINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMI 126

Query: 138 HQP--SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP  SGG  GQASDIE HA++++KIK +LN +  K+CG+   ++E+  DRD+ MSA EA
Sbjct: 127 HQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCGRDLADLERDTDRDNFMSAEEA 186

Query: 196 CDWGVVDKVLMSR 208
            ++G++D+VL +R
Sbjct: 187 KEYGLIDQVLENR 199


>gi|121635023|ref|YP_975268.1| endopeptidase [Neisseria meningitidis FAM18]
 gi|161870184|ref|YP_001599354.1| ATP-dependent Clp protease, proteolytic subunit [Neisseria
           meningitidis 053442]
 gi|166201829|sp|A1KUD9|CLPP_NEIMF RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|189082461|sp|A9LZN9|CLPP_NEIM0 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|120866729|emb|CAM10482.1| endopeptidase [Neisseria meningitidis FAM18]
 gi|161595737|gb|ABX73397.1| ATP-dependent Clp protease, proteolytic subunit [Neisseria
           meningitidis 053442]
 gi|261392408|emb|CAX49950.1| ATP-dependent Clp protease proteolytic subunit (endopeptidase Clp)
           [Neisseria meningitidis 8013]
 gi|325128392|gb|EGC51275.1| endopeptidase Clp [Neisseria meningitidis N1568]
 gi|325130325|gb|EGC53091.1| endopeptidase Clp [Neisseria meningitidis OX99.30304]
 gi|325132488|gb|EGC55181.1| endopeptidase Clp [Neisseria meningitidis M6190]
 gi|325134447|gb|EGC57092.1| endopeptidase Clp [Neisseria meningitidis M13399]
 gi|325136185|gb|EGC58793.1| endopeptidase Clp [Neisseria meningitidis M0579]
 gi|325138262|gb|EGC60831.1| endopeptidase Clp [Neisseria meningitidis ES14902]
 gi|325142516|gb|EGC64917.1| endopeptidase Clp [Neisseria meningitidis 961-5945]
 gi|325198463|gb|ADY93919.1| endopeptidase Clp [Neisseria meningitidis G2136]
 gi|325201978|gb|ADY97432.1| endopeptidase Clp [Neisseria meningitidis M01-240149]
 gi|325204312|gb|ADY99765.1| endopeptidase Clp [Neisseria meningitidis M01-240355]
 gi|325208271|gb|ADZ03723.1| endopeptidase Clp [Neisseria meningitidis NZ-05/33]
          Length = 204

 Score =  268 bits (684), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 122/197 (61%), Positives = 159/197 (80%), Gaps = 2/197 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFLE+ENP K+I  
Sbjct: 7   LVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFF 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG RFALPN+RI++
Sbjct: 67  YINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMI 126

Query: 138 HQP--SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP  SGG  GQASDIE HA++++KIK +LN +  K+CG+   ++E+  DRD+ MSA EA
Sbjct: 127 HQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCGRDLADLERDTDRDNFMSAEEA 186

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G++D++L +R  ++
Sbjct: 187 KEYGLIDQILENRASLQ 203


>gi|224147635|ref|XP_002336515.1| predicted protein [Populus trichocarpa]
 gi|222835812|gb|EEE74247.1| predicted protein [Populus trichocarpa]
          Length = 201

 Score =  268 bits (684), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 154/191 (80%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQ+ RGERS+DIYSRLL++R++F+ G++ D ++ L+CAQLLFLEAENP K I L
Sbjct: 7   LVPMVVEQSARGERSFDIYSRLLRDRVIFLNGEVNDVVSALVCAQLLFLEAENPDKPIHL 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGV+T+G+A+YDTMQFIK P+ T CMG A SMGS LL AGE G R ALPNA + +
Sbjct: 67  YINSPGGVITSGLAMYDTMQFIKSPVHTLCMGTARSMGSFLLMAGEPGHRMALPNASLHV 126

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG  GQASDI  HA+++++ K R+  +Y ++CG++YEEVE+ LDRD  M+A EA +
Sbjct: 127 HQPLGGVQGQASDIRIHAEEMLRTKDRVTRLYAQHCGRSYEEVERDLDRDRFMTAEEARE 186

Query: 198 WGVVDKVLMSR 208
           WG++DKVL  R
Sbjct: 187 WGLIDKVLDRR 197


>gi|116243153|sp|Q1Q8J2|CLPP_PSYCK RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
          Length = 215

 Score =  268 bits (684), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 159/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQ+ RGERS+DI+SRLL+ER++F+TGQ+EDHMA LI AQLLFLEAENP K+I 
Sbjct: 20  ALVPMVVEQSARGERSFDIFSRLLRERVIFLTGQVEDHMANLIVAQLLFLEAENPDKDIH 79

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG V+AG+AI+DTM FIKP +ST CMG A SMGS LL+AGEKG R+AL NAR++
Sbjct: 80  LYINSPGGSVSAGLAIFDTMNFIKPEVSTICMGGAYSMGSFLLAAGEKGKRYALANARVM 139

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG  GQA+DIE +A++I+K + RLNEI  +  G+  +++EK ++RD+ + A EA 
Sbjct: 140 IHQPSGGAQGQATDIEINAREILKTRARLNEILAERTGQPVDKIEKDVERDYWLDAKEAK 199

Query: 197 DWGVVDKVLMSR 208
           ++G++D+VL  R
Sbjct: 200 EYGLIDEVLERR 211


>gi|304387382|ref|ZP_07369574.1| ATP-dependent Clp protease proteolytic subunit [Neisseria
           meningitidis ATCC 13091]
 gi|304338633|gb|EFM04751.1| ATP-dependent Clp protease proteolytic subunit [Neisseria
           meningitidis ATCC 13091]
          Length = 209

 Score =  268 bits (684), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 122/197 (61%), Positives = 159/197 (80%), Gaps = 2/197 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFLE+ENP K+I  
Sbjct: 12  LVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFF 71

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG RFALPN+RI++
Sbjct: 72  YINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMI 131

Query: 138 HQP--SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP  SGG  GQASDIE HA++++KIK +LN +  K+CG+   ++E+  DRD+ MSA EA
Sbjct: 132 HQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCGRDLADLERDTDRDNFMSAEEA 191

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G++D++L +R  ++
Sbjct: 192 KEYGLIDQILENRASLQ 208


>gi|221065471|ref|ZP_03541576.1| Endopeptidase Clp [Comamonas testosteroni KF-1]
 gi|220710494|gb|EED65862.1| Endopeptidase Clp [Comamonas testosteroni KF-1]
          Length = 201

 Score =  268 bits (684), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 118/191 (61%), Positives = 154/191 (80%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQ+ RGERS+DIYSRLL++R++F+ G++ D ++ L+CAQLLFLEAENP K I L
Sbjct: 7   LVPMVVEQSARGERSFDIYSRLLRDRVIFLNGEVNDAVSALVCAQLLFLEAENPDKPIHL 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGV+T+G+A+YDTMQFIK P+ T CMG A SMGS LL AGE G R ALPNA + +
Sbjct: 67  YINSPGGVITSGLAMYDTMQFIKSPVHTLCMGTARSMGSFLLMAGEPGHRMALPNASLHV 126

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG  GQASDI  HA+++++ K R+  +Y ++CG++Y+EVE+ LDRD  M+A EA +
Sbjct: 127 HQPLGGVQGQASDIRIHAEEMLRTKDRVTRLYAQHCGRSYQEVERDLDRDRFMTAKEARE 186

Query: 198 WGVVDKVLMSR 208
           WG++DKVL  R
Sbjct: 187 WGLIDKVLDRR 197


>gi|325293013|ref|YP_004278877.1| ATP-dependent Clp protease, proteolytic subunit [Agrobacterium sp.
           H13-3]
 gi|325060866|gb|ADY64557.1| ATP-dependent Clp protease, proteolytic subunit [Agrobacterium sp.
           H13-3]
          Length = 203

 Score =  268 bits (684), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 118/194 (60%), Positives = 155/194 (79%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQ+ RGERS+DIYSRLL+ERI+F+ G++ D ++ L+CAQLLFLEAENP+K I L
Sbjct: 7   LVPMVVEQSARGERSFDIYSRLLRERIIFLNGEVNDAVSALVCAQLLFLEAENPKKPIHL 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G+A+YDTM++I+ P+ T CMG A SMGS LL AGE G R ALPNA IL+
Sbjct: 67  YINSPGGVVTSGLAMYDTMRYIRAPVHTLCMGTARSMGSFLLMAGEPGARAALPNASILI 126

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGGF GQASD+  HA++I + K R+  +Y ++C ++Y+E E  +DRD  M+  EA +
Sbjct: 127 HQPSGGFQGQASDMLIHAEEIRQTKHRMTRLYAEHCKRSYDEFEAAMDRDRFMTVEEALE 186

Query: 198 WGVVDKVLMSRIDI 211
           WG++D+VL  R D+
Sbjct: 187 WGLIDRVLDVREDV 200


>gi|93007058|ref|YP_581495.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Psychrobacter
           cryohalolentis K5]
 gi|92394736|gb|ABE76011.1| ATP-dependent Clp protease proteolytic subunit ClpP [Psychrobacter
           cryohalolentis K5]
          Length = 231

 Score =  267 bits (683), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 159/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQ+ RGERS+DI+SRLL+ER++F+TGQ+EDHMA LI AQLLFLEAENP K+I 
Sbjct: 36  ALVPMVVEQSARGERSFDIFSRLLRERVIFLTGQVEDHMANLIVAQLLFLEAENPDKDIH 95

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG V+AG+AI+DTM FIKP +ST CMG A SMGS LL+AGEKG R+AL NAR++
Sbjct: 96  LYINSPGGSVSAGLAIFDTMNFIKPEVSTICMGGAYSMGSFLLAAGEKGKRYALANARVM 155

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG  GQA+DIE +A++I+K + RLNEI  +  G+  +++EK ++RD+ + A EA 
Sbjct: 156 IHQPSGGAQGQATDIEINAREILKTRARLNEILAERTGQPVDKIEKDVERDYWLDAKEAK 215

Query: 197 DWGVVDKVLMSR 208
           ++G++D+VL  R
Sbjct: 216 EYGLIDEVLERR 227


>gi|153871192|ref|ZP_02000426.1| Peptidase S14, ClpP [Beggiatoa sp. PS]
 gi|152072341|gb|EDN69573.1| Peptidase S14, ClpP [Beggiatoa sp. PS]
          Length = 228

 Score =  267 bits (683), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 119/192 (61%), Positives = 159/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMVVEQ+ RGER+YDIYSRLLKER++F+ G +ED+ A L+ AQLLFLE+ENP+K+I 
Sbjct: 21  GLVPMVVEQSARGERAYDIYSRLLKERVIFLVGPVEDYTANLVVAQLLFLESENPEKDIH 80

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG V+AG+AIYDTMQFIKP +ST C+GQAASMG+LLLS G    R+ LP++RI+
Sbjct: 81  LYINSPGGSVSAGLAIYDTMQFIKPDVSTLCIGQAASMGALLLSGGADKKRYCLPHSRIM 140

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQA+DI+ HA++I+K++ RLNEI  K+ G+  E+++K  +RD+ M+A  A 
Sbjct: 141 IHQPLGGFQGQATDIDIHAREILKVRERLNEILAKHSGQPLEKIQKDTERDNFMAAETAV 200

Query: 197 DWGVVDKVLMSR 208
           ++G+VD VL +R
Sbjct: 201 EYGLVDAVLSTR 212


>gi|77165153|ref|YP_343678.1| endopeptidase Clp [Nitrosococcus oceani ATCC 19707]
 gi|254434725|ref|ZP_05048233.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Nitrosococcus
           oceani AFC27]
 gi|110816460|sp|Q3JAJ8|CLPP_NITOC RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|76883467|gb|ABA58148.1| ATP-dependent Clp protease proteolytic subunit ClpP [Nitrosococcus
           oceani ATCC 19707]
 gi|207091058|gb|EDZ68329.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Nitrosococcus
           oceani AFC27]
          Length = 203

 Score =  267 bits (683), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 157/194 (80%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQT RGER+YDIYSRLLKER+VF+ G +EDHMA L+ AQLLFLE+ENP K+I L
Sbjct: 8   LVPMVVEQTARGERAYDIYSRLLKERVVFLVGPVEDHMANLVVAQLLFLESENPDKDIHL 67

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAG++IYDTMQFIKP +ST C+GQAASMG++LL+ G  G R  LP++R+L+
Sbjct: 68  YINSPGGSVTAGLSIYDTMQFIKPDVSTLCVGQAASMGAVLLAGGAGGKRHCLPHSRLLI 127

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQA+DI+ HA++I+ ++ RLN I  K+ G+  E+++   DRD+ MSA+E+  
Sbjct: 128 HQPLGGFQGQATDIDIHAREILLVRERLNHILAKHTGQPIEKIQHDTDRDYFMSATESLA 187

Query: 198 WGVVDKVLMSRIDI 211
           +G+VD VL  R +I
Sbjct: 188 YGLVDSVLKQRAEI 201


>gi|257093849|ref|YP_003167490.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257046373|gb|ACV35561.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 209

 Score =  267 bits (683), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 156/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVPMV+EQ+ RGER+YDIYSRLLKER+VF+ G + D  A L+ AQLLFLEAENP K+I
Sbjct: 14  LGLVPMVIEQSGRGERAYDIYSRLLKERVVFLVGPVNDVTANLVVAQLLFLEAENPDKDI 73

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
             YINSPGG V+AG+++YDTMQFIKP +ST CMGQA SMG+ LL+AG +G RFALPN+R+
Sbjct: 74  HFYINSPGGSVSAGLSVYDTMQFIKPDVSTLCMGQACSMGAFLLAAGTRGKRFALPNSRV 133

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI  HA++I+ ++ +LNE+   + G+  E +E+  DRD+ +SA EA
Sbjct: 134 MIHQPMGGFQGQASDIAIHAKEILSLRAKLNELMALHTGQEIERIERDTDRDNFLSAQEA 193

Query: 196 CDWGVVDKVLMSR 208
            ++G++DKVL +R
Sbjct: 194 AEYGLIDKVLANR 206


>gi|167032910|ref|YP_001668141.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas putida
           GB-1]
 gi|189082463|sp|B0KJG6|CLPP_PSEPG RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166859398|gb|ABY97805.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Pseudomonas
           putida GB-1]
          Length = 213

 Score =  267 bits (683), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 119/192 (61%), Positives = 155/192 (80%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMV+EQ+ RGER+YDIYSRLLKER++F+ G +ED+MA L+ AQ+LFLEAENP K+I 
Sbjct: 18  GLVPMVIEQSARGERAYDIYSRLLKERVIFLVGPVEDYMANLVVAQMLFLEAENPDKDIH 77

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQA SMG+ LL+AG KG R  LPN+R++
Sbjct: 78  LYINSPGGSVTAGMSIYDTMQFIKPDVSTICIGQACSMGAFLLTAGAKGKRHCLPNSRVM 137

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQA+DI+ HAQ+I+ IK RLNE+   + G+  E +++  +RD+ MSAS A 
Sbjct: 138 IHQPLGGFQGQATDIQIHAQEILSIKARLNELLAYHTGQDLETIQRDTERDNFMSASRAA 197

Query: 197 DWGVVDKVLMSR 208
           ++G++D V   R
Sbjct: 198 EYGLIDSVYDKR 209


>gi|325144548|gb|EGC66847.1| endopeptidase Clp [Neisseria meningitidis M01-240013]
          Length = 204

 Score =  267 bits (682), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 157/193 (81%), Gaps = 2/193 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFLE+ENP K+I  
Sbjct: 7   LVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFF 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG RFALPN+RI++
Sbjct: 67  YINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMI 126

Query: 138 HQP--SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP  SGG  GQASDIE HA++++KIK +LN +  K+CG+   ++E+  DRD+ MSA EA
Sbjct: 127 HQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCGRDLADLERDTDRDNFMSAEEA 186

Query: 196 CDWGVVDKVLMSR 208
            ++G++D++L +R
Sbjct: 187 KEYGLIDQILENR 199


>gi|170740561|ref|YP_001769216.1| endopeptidase Clp [Methylobacterium sp. 4-46]
 gi|168194835|gb|ACA16782.1| Endopeptidase Clp [Methylobacterium sp. 4-46]
          Length = 211

 Score =  267 bits (682), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 124/197 (62%), Positives = 156/197 (79%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
           +  LVPMVVEQ++RGER++DIYSRLL+ERIVF TG ++D  A+L  AQLLFLEAENP+KE
Sbjct: 8   YASLVPMVVEQSSRGERAFDIYSRLLRERIVFFTGAVDDQTASLTVAQLLFLEAENPKKE 67

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           ISLYINSPGGVVT+G+AIYDTMQFI+ P+ST C+GQAASMGSLLL+AG  G RFA  NAR
Sbjct: 68  ISLYINSPGGVVTSGLAIYDTMQFIRCPVSTLCVGQAASMGSLLLAAGAPGQRFATANAR 127

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           I++HQP GGF GQA+DI  HA++   IKRR+ EIY ++ G+ Y  VE+ L+RD  +    
Sbjct: 128 IMVHQPIGGFQGQATDIMIHARETEAIKRRMTEIYARHTGQDYATVERALERDTFLDPEA 187

Query: 195 ACDWGVVDKVLMSRIDI 211
           A  +G++D VL  R +I
Sbjct: 188 ARAFGLIDGVLTGRPEI 204


>gi|226501814|ref|NP_001150578.1| LOC100284211 [Zea mays]
 gi|195640324|gb|ACG39630.1| ATP-dependent Clp protease proteolytic subunit [Zea mays]
          Length = 260

 Score =  267 bits (682), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 120/192 (62%), Positives = 156/192 (81%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMV+E T+RGER+YDI+SRLLKERIV + G I D  A+L+ AQLLFLE+ENP K + 
Sbjct: 36  GLVPMVIEHTSRGERAYDIFSRLLKERIVCIHGPITDDTASLVVAQLLFLESENPAKPVH 95

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGVVTAG+AIYDTMQ+I+ P++T C+GQAASM SLLL+AG  G R ALPNAR++
Sbjct: 96  LYINSPGGVVTAGLAIYDTMQYIRSPVTTLCIGQAASMASLLLAAGASGQRRALPNARVM 155

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG SGQASDI  HA++I+K++ RLN+IY K+ G+  + +E+ ++RD  M   EA 
Sbjct: 156 IHQPSGGASGQASDIAIHAKEILKVRDRLNKIYAKHTGQAIDRIEQCMERDMFMDPEEAH 215

Query: 197 DWGVVDKVLMSR 208
           DWG++D+V+  R
Sbjct: 216 DWGLIDEVIEHR 227


>gi|145642383|ref|ZP_01797943.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae R3021]
 gi|145272926|gb|EDK12812.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae 22.4-21]
          Length = 193

 Score =  267 bits (682), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 123/193 (63%), Positives = 157/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++PMVVEQT+RGERSYDIYSRLLKER++F++G++ED MA LI AQLLFLE+E+P K+I
Sbjct: 1   MSVIPMVVEQTSRGERSYDIYSRLLKERVIFLSGEVEDRMANLIVAQLLFLESEDPTKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           ++YINSPGG VTAGMAIYDTMQFIK  I T C+GQA SMG+ LL+ G  G R ALPNAR+
Sbjct: 61  NIYINSPGGSVTAGMAIYDTMQFIKSDIRTLCIGQACSMGAFLLAGGTAGKRAALPNARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI+ HAQ+I+KIK  LN+    + G++ E +EK  DRD+ MSA EA
Sbjct: 121 MIHQPLGGFRGQASDIQIHAQEILKIKHTLNDRLAFHTGQSIERIEKDTDRDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G+VD+VL+ R
Sbjct: 181 QAYGLVDEVLVKR 193


>gi|332112672|gb|EGJ12465.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Rubrivivax
           benzoatilyticus JA2]
          Length = 202

 Score =  266 bits (681), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 120/197 (60%), Positives = 157/197 (79%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E   LG+VPMV+EQ+ RGER+YDIYSRLL+ERIVF+ G + D +A L+CAQLLFLE+ENP
Sbjct: 5   ETTGLGMVPMVIEQSGRGERAYDIYSRLLRERIVFLVGPVNDQVANLVCAQLLFLESENP 64

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            K+ISLYINSPGG V+AG++I+DTM FIKP +ST CMG AASMGS LL AG KG RFALP
Sbjct: 65  DKDISLYINSPGGSVSAGLSIFDTMNFIKPEVSTLCMGMAASMGSFLLMAGAKGKRFALP 124

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+R+++HQPSGG  GQASDIE  A++I+K + +LN IY +  G++ E++   ++RD  +S
Sbjct: 125 NSRVMIHQPSGGAQGQASDIEIQAREIIKTREQLNRIYAERTGQSIEKIAADMERDMWLS 184

Query: 192 ASEACDWGVVDKVLMSR 208
             EA D+G++D+VL  R
Sbjct: 185 PGEAKDYGLIDQVLEKR 201


>gi|299529913|ref|ZP_07043341.1| ATP-dependent Clp protease proteolytic subunit [Comamonas
           testosteroni S44]
 gi|298722085|gb|EFI63014.1| ATP-dependent Clp protease proteolytic subunit [Comamonas
           testosteroni S44]
          Length = 201

 Score =  266 bits (681), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 154/191 (80%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQ+ RGERS+DIYSRLL++R++F+ G++ D ++ L+CAQLLFLEAENP K I L
Sbjct: 7   LVPMVVEQSARGERSFDIYSRLLRDRVIFLNGEVNDAVSALVCAQLLFLEAENPDKPIHL 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGV+T+G+A+YDTMQFIK P+ T CMG A SMGS LL AGE G R A+PNA + +
Sbjct: 67  YINSPGGVITSGLAMYDTMQFIKSPVHTLCMGTARSMGSFLLMAGEPGHRMAMPNASLHV 126

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG  GQASDI  HA+++++ K R+  +Y ++CG++Y+EVE+ LDRD  M+A EA +
Sbjct: 127 HQPLGGVRGQASDIRIHAEEMLRTKDRVTRLYAQHCGRSYQEVERDLDRDRFMTAKEARE 186

Query: 198 WGVVDKVLMSR 208
           WG++DKVL  R
Sbjct: 187 WGLIDKVLDRR 197


>gi|116793577|gb|ABK26796.1| unknown [Picea sitchensis]
          Length = 248

 Score =  266 bits (681), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 120/192 (62%), Positives = 160/192 (83%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GL+PMV+E T+RGER+YDI+SRLLKERI+ + G I D  A+++ AQLLFLE+ENPQK I+
Sbjct: 36  GLIPMVIEHTSRGERAYDIFSRLLKERIICINGPIADETASVVVAQLLFLESENPQKPIN 95

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           +YINSPGGVVTAG+AIYDTMQ+IK P++T C+GQAASMGSLLL+AG  G R ALPNAR++
Sbjct: 96  MYINSPGGVVTAGLAIYDTMQYIKSPVTTLCIGQAASMGSLLLAAGSHGERRALPNARVM 155

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG SGQASDI  HA++I+K + RLN +Y K+ G+T E++E+ ++RD  MS  EA 
Sbjct: 156 IHQPSGGASGQASDIAIHAKEILKTRERLNGLYAKHTGQTIEKIEQFMERDTFMSPDEAK 215

Query: 197 DWGVVDKVLMSR 208
           ++G++D+V+  R
Sbjct: 216 EFGLIDEVIEHR 227


>gi|224030041|gb|ACN34096.1| unknown [Zea mays]
          Length = 259

 Score =  266 bits (681), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 120/192 (62%), Positives = 156/192 (81%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMV+E T+RGER+YDI+SRLLKERIV + G I D  A+L+ AQLLFLE+ENP K + 
Sbjct: 35  GLVPMVIEHTSRGERAYDIFSRLLKERIVCIHGPITDDTASLVVAQLLFLESENPAKPVH 94

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGVVTAG+AIYDTMQ+I+ P++T C+GQAASM SLLL+AG  G R ALPNAR++
Sbjct: 95  LYINSPGGVVTAGLAIYDTMQYIRSPVTTLCIGQAASMASLLLAAGASGERRALPNARVM 154

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG SGQASDI  HA++I+K++ RLN+IY K+ G+  + +E+ ++RD  M   EA 
Sbjct: 155 IHQPSGGASGQASDIAIHAKEILKVRDRLNKIYAKHTGQAIDRIEQCMERDMFMDPEEAH 214

Query: 197 DWGVVDKVLMSR 208
           DWG++D+V+  R
Sbjct: 215 DWGLIDEVIEHR 226


>gi|212696598|ref|ZP_03304726.1| hypothetical protein ANHYDRO_01138 [Anaerococcus hydrogenalis DSM
           7454]
 gi|325847156|ref|ZP_08169955.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Anaerococcus hydrogenalis ACS-025-V-Sch4]
 gi|212676329|gb|EEB35936.1| hypothetical protein ANHYDRO_01138 [Anaerococcus hydrogenalis DSM
           7454]
 gi|325480936|gb|EGC83982.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Anaerococcus hydrogenalis ACS-025-V-Sch4]
          Length = 195

 Score =  266 bits (681), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 120/188 (63%), Positives = 157/188 (83%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQTNRGER+YDIYSRLLK+RI+F+TG +ED ++ +I AQLLFLE+++P K+I  
Sbjct: 7   LVPTVIEQTNRGERAYDIYSRLLKDRIIFLTGPVEDGVSDIIIAQLLFLESQDPNKDIQF 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVTAG+AIYDTM +IKP +ST C+GQAASMG++LLS+G KG RF+LPN+ IL+
Sbjct: 67  YINSPGGVVTAGLAIYDTMNYIKPDVSTICIGQAASMGAVLLSSGAKGKRFSLPNSNILI 126

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGG  GQASDI+  A+ I+KIK+RLN+I   N G+T E+++K  DRD  M A EA +
Sbjct: 127 HQPSGGAQGQASDIQIQAEQILKIKKRLNKILSDNTGQTIEKIQKDTDRDFSMDAYEAKE 186

Query: 198 WGVVDKVL 205
           +G++DKV+
Sbjct: 187 YGLIDKVI 194


>gi|149194680|ref|ZP_01871775.1| ATP-dependent Clp protease proteolytic subunit [Caminibacter
           mediatlanticus TB-2]
 gi|149135103|gb|EDM23584.1| ATP-dependent Clp protease proteolytic subunit [Caminibacter
           mediatlanticus TB-2]
          Length = 196

 Score =  266 bits (681), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 120/191 (62%), Positives = 156/191 (81%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           L+P V+E+T RGER+YDIYSRLLK+RI+ + G+I DH A+LI AQLLFLEAENP+K+I L
Sbjct: 4   LIPTVIEKTGRGERAYDIYSRLLKDRIIMLQGEINDHTASLIVAQLLFLEAENPEKDIYL 63

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G AIYDTM +IKP + T CMGQAASMG+ LLS+G KG RFALP+ARI++
Sbjct: 64  YINSPGGVVTSGFAIYDTMNYIKPDVVTICMGQAASMGAFLLSSGAKGKRFALPHARIMI 123

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG  GQA+DIE HA++I+++K+ LN+I  +N G++  ++EK  +RD  MSA EA  
Sbjct: 124 HQPLGGAQGQATDIEIHAKEILRMKKELNKILAENTGQSVRKIEKDTERDFFMSAEEAMK 183

Query: 198 WGVVDKVLMSR 208
           +G++DKVL  R
Sbjct: 184 YGLIDKVLKKR 194


>gi|301154977|emb|CBW14440.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Haemophilus parainfluenzae T3T1]
          Length = 188

 Score =  266 bits (681), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 155/188 (82%)

Query: 21  MVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYIN 80
           MVVEQT+RGERSYDIYSRLLKER++F++G++ED MA LI AQLLFLE+E+P+K+I++YIN
Sbjct: 1   MVVEQTSRGERSYDIYSRLLKERVIFLSGEVEDRMANLIVAQLLFLESEDPKKDINIYIN 60

Query: 81  SPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQP 140
           SPGG VTAGMAIYDTMQFIKP + T C+GQA SMG+ LL+ G  G R ALPNAR+++HQP
Sbjct: 61  SPGGSVTAGMAIYDTMQFIKPDVRTLCIGQACSMGAFLLAGGTAGKRAALPNARVMIHQP 120

Query: 141 SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGV 200
            GGF GQASDI+ HAQ+I+KIK+ LNE    + G++ E +EK  DRD+ MSA EA  +G+
Sbjct: 121 LGGFRGQASDIQIHAQEILKIKQTLNERLAFHTGQSIERIEKDTDRDNFMSAEEAKAYGL 180

Query: 201 VDKVLMSR 208
           VD VL+ R
Sbjct: 181 VDDVLIKR 188


>gi|255589435|ref|XP_002534960.1| ATP-dependent Clp protease proteolytic subunit, putative [Ricinus
           communis]
 gi|223524291|gb|EEF27423.1| ATP-dependent Clp protease proteolytic subunit, putative [Ricinus
           communis]
          Length = 435

 Score =  266 bits (680), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 122/205 (59%), Positives = 158/205 (77%)

Query: 4   EGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQL 63
           +G  ++  E   LG +PMV+EQ+ RGERSYDIYSRLLKER++F+ G + D  A L+ AQL
Sbjct: 228 KGMMQQRMEPQGLGYIPMVIEQSGRGERSYDIYSRLLKERVIFLVGPVNDMTANLVVAQL 287

Query: 64  LFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGE 123
           LFLEAENP K+ISLYINSPGG VTAGM+IYDTMQFIKP +ST C+GQAASMG+ LL+AG 
Sbjct: 288 LFLEAENPDKDISLYINSPGGSVTAGMSIYDTMQFIKPDVSTLCIGQAASMGAFLLTAGA 347

Query: 124 KGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKT 183
           KG RF LPN+R+++HQP GGF GQASDIE HA++I+ +K +LN I   + G+  + +   
Sbjct: 348 KGKRFCLPNSRVMIHQPLGGFQGQASDIEIHAKEILYLKDKLNGIMAHHTGQNIDTIAND 407

Query: 184 LDRDHIMSASEACDWGVVDKVLMSR 208
            DRD+ MSA  A  +G+VD+V+ +R
Sbjct: 408 TDRDNFMSADAAKAYGLVDQVIAAR 432


>gi|312796430|ref|YP_004029352.1| ATP-dependent endopeptidase clp proteolytic subunit clpP
           [Burkholderia rhizoxinica HKI 454]
 gi|312168205|emb|CBW75208.1| ATP-dependent endopeptidase clp proteolytic subunit clpP (EC
           3.4.21.92) [Burkholderia rhizoxinica HKI 454]
          Length = 238

 Score =  266 bits (680), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 123/202 (60%), Positives = 159/202 (78%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
           A +D E   LGLVPMVVE + RGER+YDIYSRLLKER+VF+ G++ D  A L+ AQLLFL
Sbjct: 36  APRDFEAQALGLVPMVVETSGRGERAYDIYSRLLKERLVFLVGEVNDQAANLVVAQLLFL 95

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP K+ISLYINSPGG V+AGMAIYDTMQFIKP ++T CMG AASMG+ LL+AG KG 
Sbjct: 96  ESENPDKDISLYINSPGGSVSAGMAIYDTMQFIKPDVTTLCMGLAASMGAFLLAAGAKGK 155

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R ALPNAR+++HQP GG  GQASDIE  A++I+ +K RLN +  ++ G+  E++++  DR
Sbjct: 156 RIALPNARVMIHQPLGGARGQASDIEIQAREILFLKERLNNLLAQHTGQPVEQIQRDTDR 215

Query: 187 DHIMSASEACDWGVVDKVLMSR 208
           D+ MSA +A  +G++D+VL  R
Sbjct: 216 DNFMSAEDAQAYGLIDQVLHKR 237


>gi|220903965|ref|YP_002479277.1| Endopeptidase Clp [Desulfovibrio desulfuricans subsp. desulfuricans
           str. ATCC 27774]
 gi|259585948|sp|B8IYM2|CLPP_DESDA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|219868264|gb|ACL48599.1| Endopeptidase Clp [Desulfovibrio desulfuricans subsp. desulfuricans
           str. ATCC 27774]
          Length = 202

 Score =  266 bits (680), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 168/202 (83%), Gaps = 1/202 (0%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+PMV+E T R ER+YDIYSRLLK+RIV +  ++ D +A+LICAQLLFLE+++P+KEI
Sbjct: 1   MSLIPMVIETTGRSERAYDIYSRLLKDRIVLLGSEVNDTVASLICAQLLFLESQDPEKEI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG VTAG+AIYDT++FI  P+ST CMG+AASMG+ LL+AG+ G+R+ALPN++I
Sbjct: 61  SLYINSPGGSVTAGLAIYDTLRFISAPVSTVCMGRAASMGAFLLAAGKPGLRYALPNSQI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPS G+ GQA+DIE HA++++++K RLN I  +N G+ Y+++ K  +RD+ ++  EA
Sbjct: 121 MIHQPSAGYQGQATDIEIHAKEVLRLKERLNRILAENTGRPYKDIVKATERDNFLTPEEA 180

Query: 196 CDWGVVDKVLMSRIDI-EEKSK 216
            D G++D+VL+SR D+ +EKS+
Sbjct: 181 KDLGIIDRVLVSRQDMAQEKSE 202


>gi|303250639|ref|ZP_07336836.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|302650627|gb|EFL80786.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
          Length = 196

 Score =  266 bits (680), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 156/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQT++GERSYDIYSRLLKERI+F+TGQ+EDHMA LI AQ+LFLEAE+P+K+I
Sbjct: 1   MALVPIVVEQTSKGERSYDIYSRLLKERIIFLTGQVEDHMANLIVAQMLFLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGVVTAG+AIY TM FIKP ++T C GQA SMG+ LLS G KG RFALPNAR+
Sbjct: 61  YLYINSPGGVVTAGLAIYATMNFIKPDVATLCTGQACSMGAFLLSGGAKGKRFALPNARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI+  AQ+I+K+K  L     ++ G+ +E+V    +RD+ MSA EA
Sbjct: 121 MIHQPLGGARGQATDIQIQAQEILKLKEMLTRKMAEHSGQPFEKVAADTERDNFMSAVEA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++DKVL  R
Sbjct: 181 MEYGLIDKVLTHR 193


>gi|113867496|ref|YP_725985.1| ATP-dependent Clp protease proteolytic subunit [Ralstonia eutropha
           H16]
 gi|194289504|ref|YP_002005411.1| ATP-dependent clp protease proteolytic subunit [Cupriavidus
           taiwanensis LMG 19424]
 gi|123033071|sp|Q0KBK4|CLPP_RALEH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|226706449|sp|B3R4W1|CLPP_CUPTR RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|113526272|emb|CAJ92617.1| Endopeptidase Clp (type 1) [Ralstonia eutropha H16]
 gi|193223339|emb|CAQ69344.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease
           [Cupriavidus taiwanensis LMG 19424]
          Length = 216

 Score =  266 bits (680), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 121/193 (62%), Positives = 154/193 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVPMVVEQ+ RGER+YDIYSRLLKER+VF+ G++ D  A L+ AQLLFLE+ENP K++
Sbjct: 23  LGLVPMVVEQSGRGERAYDIYSRLLKERVVFMVGEVNDQTANLVVAQLLFLESENPDKDV 82

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V+AG+AIYDTMQFIKP +ST CMG AASMG+ LL+AG KG R ALPN+RI
Sbjct: 83  SLYINSPGGSVSAGLAIYDTMQFIKPDVSTLCMGMAASMGAFLLAAGAKGKRSALPNSRI 142

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDIE  A++I+ ++ RLN I  +  G+  E++ +  DRD+ MS  +A
Sbjct: 143 MIHQPLGGARGQASDIEIQAREILYLRERLNTILSEVTGQPVEKIARDTDRDNFMSGDQA 202

Query: 196 CDWGVVDKVLMSR 208
            D+G++DKVL  R
Sbjct: 203 VDYGLIDKVLARR 215


>gi|114777030|ref|ZP_01452050.1| ATP-dependent Clp protease proteolytic subunit [Mariprofundus
           ferrooxydans PV-1]
 gi|114552551|gb|EAU55011.1| ATP-dependent Clp protease proteolytic subunit [Mariprofundus
           ferrooxydans PV-1]
          Length = 207

 Score =  266 bits (680), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 119/193 (61%), Positives = 161/193 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP VVEQT+RGER+YDI+SRLLKERIVF+ GQ++DH A LI AQLLFLE+E P K+I
Sbjct: 1   MNLVPTVVEQTSRGERAYDIFSRLLKERIVFLNGQVDDHTANLIIAQLLFLESEGPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGGVVT+G+AIYDTMQ+I+  +ST C+GQAASMG+ LL++G  G RF+LPN+RI
Sbjct: 61  YMYINSPGGVVTSGLAIYDTMQYIRCDVSTLCIGQAASMGAHLLASGAPGKRFSLPNSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DIE HA++I+ +K RLNE+  K+ G+  E++   ++RD+ ++A +A
Sbjct: 121 MIHQPLGGFQGQATDIEIHAREILSLKNRLNEMMAKHTGQPIEKLADDVERDYFLTADQA 180

Query: 196 CDWGVVDKVLMSR 208
           C++G+VDKVL SR
Sbjct: 181 CEYGLVDKVLSSR 193


>gi|325922708|ref|ZP_08184448.1| ATP-dependent Clp protease proteolytic subunit ClpP [Xanthomonas
           gardneri ATCC 19865]
 gi|325546825|gb|EGD17939.1| ATP-dependent Clp protease proteolytic subunit ClpP [Xanthomonas
           gardneri ATCC 19865]
          Length = 196

 Score =  266 bits (679), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 159/188 (84%)

Query: 21  MVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYIN 80
           MVVEQT+RGER+YDIYSRLLKER++F+ G I+DHMA +I AQLLFLEA+NP+K+IS+YIN
Sbjct: 1   MVVEQTSRGERAYDIYSRLLKERLIFLVGPIDDHMANVIVAQLLFLEADNPEKDISIYIN 60

Query: 81  SPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQP 140
           SPGGVVTAGMAIYDTMQ+IKP +ST C+GQAASMG+LLL++G  G R+ALPN+R+++HQP
Sbjct: 61  SPGGVVTAGMAIYDTMQYIKPDVSTICVGQAASMGALLLASGAAGKRYALPNSRVMIHQP 120

Query: 141 SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGV 200
            GGF GQA+DI+ HA++I+ ++ RLNEI  K+ G++ E + +  +RD+  SA +A  +G+
Sbjct: 121 LGGFQGQATDIDIHAREILTLRSRLNEILAKHTGQSLETIGRDTERDNFKSAVDAQAYGL 180

Query: 201 VDKVLMSR 208
           VD+VL  R
Sbjct: 181 VDQVLERR 188


>gi|225075320|ref|ZP_03718519.1| hypothetical protein NEIFLAOT_00323 [Neisseria flavescens
           NRL30031/H210]
 gi|224953495|gb|EEG34704.1| hypothetical protein NEIFLAOT_00323 [Neisseria flavescens
           NRL30031/H210]
          Length = 206

 Score =  266 bits (679), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 122/197 (61%), Positives = 159/197 (80%), Gaps = 2/197 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFLE+ENP K+I  
Sbjct: 9   LVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFF 68

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG RFALPN+RI++
Sbjct: 69  YINSPGGSVTAGMSIYDTMNFIKPHVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMI 128

Query: 138 HQP--SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP  SGG +GQASDIE HA++++KIK +LN +  K+C +   ++E+  DRD+ MSA EA
Sbjct: 129 HQPLISGGLAGQASDIEIHAKELLKIKEKLNRLLAKHCDRDLADLERDTDRDNYMSADEA 188

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G++D+VL +R  ++
Sbjct: 189 KEYGLIDQVLENRASLQ 205


>gi|119476204|ref|ZP_01616556.1| ATP-dependent Clp protease, proteolytic subunit ClpP [marine gamma
           proteobacterium HTCC2143]
 gi|119450831|gb|EAW32065.1| ATP-dependent Clp protease, proteolytic subunit ClpP [marine gamma
           proteobacterium HTCC2143]
          Length = 206

 Score =  265 bits (678), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 120/197 (60%), Positives = 158/197 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVPMVVEQT +GERSYDIYSRLLKER++F+ GQ+ED+MA LI AQLLFLE+ENP K+I
Sbjct: 9   LGLVPMVVEQTAKGERSYDIYSRLLKERVIFMVGQVEDNMANLIVAQLLFLESENPDKDI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAG++IYDTMQFI+P +ST C+GQAASMG+ LL+ G KG RF LPNAR 
Sbjct: 69  HLYINSPGGSVTAGLSIYDTMQFIRPDVSTMCIGQAASMGAFLLAGGAKGKRFILPNART 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA+DI+  A++I+ I+ RLN++  ++ G   E + +  +RD+ M+A ++
Sbjct: 129 MIHQPSGGAQGQATDIDIQAREILIIRERLNQLMAEHTGNDVETIRRDTERDNFMNADDS 188

Query: 196 CDWGVVDKVLMSRIDIE 212
             +G+VD+VL  R  +E
Sbjct: 189 KTYGLVDEVLRGRNSVE 205


>gi|241758856|ref|ZP_04756969.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Neisseria
           flavescens SK114]
 gi|319638311|ref|ZP_07993074.1| ATP-dependent Clp protease proteolytic subunit [Neisseria mucosa
           C102]
 gi|241321064|gb|EER57277.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Neisseria
           flavescens SK114]
 gi|317400584|gb|EFV81242.1| ATP-dependent Clp protease proteolytic subunit [Neisseria mucosa
           C102]
          Length = 206

 Score =  265 bits (678), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 122/197 (61%), Positives = 159/197 (80%), Gaps = 2/197 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFLE+ENP K+I  
Sbjct: 9   LVPTVIEQSGRGERAFDIYSRLLKERIVFLIGPVTDESANLVVAQLLFLESENPDKDIFF 68

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG RFALPN+RI++
Sbjct: 69  YINSPGGSVTAGMSIYDTMNFIKPHVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMI 128

Query: 138 HQP--SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP  SGG +GQASDIE HA++++KIK +LN +  K+C +   ++E+  DRD+ MSA EA
Sbjct: 129 HQPLISGGLAGQASDIEIHAKELLKIKEKLNRLLAKHCDRDLADLERDTDRDNYMSADEA 188

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G++D+VL +R  ++
Sbjct: 189 KEYGLIDQVLENRASLQ 205


>gi|257455804|ref|ZP_05621030.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Enhydrobacter
           aerosaccus SK60]
 gi|257446818|gb|EEV21835.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Enhydrobacter
           aerosaccus SK60]
          Length = 224

 Score =  265 bits (678), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 120/195 (61%), Positives = 160/195 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQ+ RGERS+DIYSRLL+ER+VF+ GQ+EDHMA LI AQLLFLEAENP+K+I 
Sbjct: 29  ALVPMVVEQSARGERSFDIYSRLLRERVVFLAGQVEDHMANLIVAQLLFLEAENPEKDIH 88

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG V+AG+A++DTM FI+P +ST CMG A SMGS LL+AGEKG R+AL NAR++
Sbjct: 89  LYINSPGGSVSAGLAVFDTMNFIQPQVSTICMGGAYSMGSFLLAAGEKGKRYALANARVM 148

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG  GQA+DIE +A++I+KI+ RLN+I  +  G+  E++ + ++RD+ + A EA 
Sbjct: 149 IHQPSGGAQGQATDIEINAREILKIRERLNKILAERTGQPLEKIARDVERDYWLDAQEAK 208

Query: 197 DWGVVDKVLMSRIDI 211
           ++G++D+VL  R  I
Sbjct: 209 EYGLIDEVLEKRPSI 223


>gi|224373739|ref|YP_002608111.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Nautilia
           profundicola AmH]
 gi|223589486|gb|ACM93222.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Nautilia
           profundicola AmH]
          Length = 196

 Score =  265 bits (678), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 118/191 (61%), Positives = 158/191 (82%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+E+T RGER+YDIYSRLLK+RI+ + G+I DH++++I AQ+LFLEAENP+K+I L
Sbjct: 4   LVPTVIEKTGRGERAYDIYSRLLKDRIIMLQGEINDHVSSIIVAQMLFLEAENPEKDIYL 63

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+GMAIYDTM +IKP + T CMGQAASMG+ LLS+G KG RFALP+ARI++
Sbjct: 64  YINSPGGVVTSGMAIYDTMNYIKPDVVTICMGQAASMGAFLLSSGAKGKRFALPHARIMI 123

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG  GQA+DIE HA++I+++K+ LN+I  +N G++  ++E+  +RD  MSA EA  
Sbjct: 124 HQPLGGAQGQATDIEIHAKEILRMKKELNKILAENTGQSVRKIERDTERDFFMSAEEAMK 183

Query: 198 WGVVDKVLMSR 208
           +G++DKVL  R
Sbjct: 184 YGLIDKVLKKR 194


>gi|121997404|ref|YP_001002191.1| ATP-dependent Clp protease proteolytic subunit [Halorhodospira
           halophila SL1]
 gi|226706517|sp|A1WUM7|CLPP_HALHL RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|121588809|gb|ABM61389.1| ATP-dependent Clp protease proteolytic subunit ClpP [Halorhodospira
           halophila SL1]
          Length = 210

 Score =  265 bits (678), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 162/202 (80%), Gaps = 1/202 (0%)

Query: 8   KKDSEDVF-LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
           ++ + D+F  GLVPMVVEQ+ RGER+YDI+SRLLKER++F+ G +ED+ A L+ AQLLFL
Sbjct: 5   QQSAPDIFNTGLVPMVVEQSARGERAYDIFSRLLKERVIFLVGPVEDYQANLLVAQLLFL 64

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP K++ LYINSPGG VTAG+AIYDTMQFIKP ++T C+GQAASMG+LLL+AG +G 
Sbjct: 65  ESENPDKDVHLYINSPGGSVTAGLAIYDTMQFIKPDVATLCVGQAASMGALLLAAGAEGK 124

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R ALPN+R+++HQP GGF GQA+DI+ HA++I+ ++ RLN I   + G+  E + +  DR
Sbjct: 125 RHALPNSRMMIHQPLGGFQGQATDIDIHAREILSMRDRLNTILAHHTGQDIETIRQDTDR 184

Query: 187 DHIMSASEACDWGVVDKVLMSR 208
           D+ M+A  A  +G++D+VL SR
Sbjct: 185 DNFMAAEAAAQYGLIDRVLTSR 206


>gi|303328063|ref|ZP_07358502.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Desulfovibrio
           sp. 3_1_syn3]
 gi|302861889|gb|EFL84824.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Desulfovibrio
           sp. 3_1_syn3]
          Length = 202

 Score =  265 bits (678), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 167/202 (82%), Gaps = 1/202 (0%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMV+E T R ER+YDIYSRLLK+RIV +  ++ D +A+LICAQLLFLE+++P+KEI
Sbjct: 1   MSLVPMVIETTGRSERAYDIYSRLLKDRIVLLGSEVNDAVASLICAQLLFLESQDPEKEI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           +LYINSPGG VTAG+AIYDTM++I  P++T CMG+AASMG+ LL+AGE GMRFALPN++I
Sbjct: 61  NLYINSPGGSVTAGLAIYDTMRYITSPVTTVCMGRAASMGAFLLAAGEPGMRFALPNSQI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGGF GQA+DIE HA++++++K RLN +  +N  + YE+V K  +RD+ ++  EA
Sbjct: 121 MIHQPSGGFQGQATDIEIHAREVLRLKERLNRMLAENTKRPYEDVVKATERDNFLTPEEA 180

Query: 196 CDWGVVDKVLMSRIDI-EEKSK 216
            + G++D+VL SR ++ +EKS+
Sbjct: 181 KELGIIDRVLASRREMAQEKSE 202


>gi|186475776|ref|YP_001857246.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           phymatum STM815]
 gi|184192235|gb|ACC70200.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           phymatum STM815]
          Length = 219

 Score =  265 bits (678), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 159/208 (76%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           ++ +    +D E   LGLVP+VVE + RGERSYDIYSRLLKER+VF+ G++ D  A L+ 
Sbjct: 11  LTSQSSRDRDLEAQALGLVPIVVETSGRGERSYDIYSRLLKERVVFLVGEVNDQTANLVI 70

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+IS YINSPGG V+AGMAIYDTMQFIKP +ST CMG AASMG+ LL+
Sbjct: 71  AQLLFLESENPDKDISFYINSPGGSVSAGMAIYDTMQFIKPDVSTLCMGLAASMGAFLLA 130

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RFALPNAR+++HQP GG  GQASDIE  A++I+ +K RLN++   + G+  E +
Sbjct: 131 AGAKGKRFALPNARVMIHQPLGGARGQASDIEIQAREILYLKERLNQLLSHHTGQPVERI 190

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           ++  DRD+ MS  +A  +G+VD+VL  R
Sbjct: 191 QRDTDRDNFMSGDDAQAYGLVDQVLHKR 218


>gi|260892392|ref|YP_003238489.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Ammonifex
           degensii KC4]
 gi|260864533|gb|ACX51639.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Ammonifex
           degensii KC4]
          Length = 200

 Score =  265 bits (678), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 161/191 (84%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+VVEQT+RGER+YDIYSRLLK+RI+F+ G I+DH+A L+ AQLLFLEAE+P+K+I L
Sbjct: 5   LVPIVVEQTSRGERAYDIYSRLLKDRIIFIGGPIDDHLANLVIAQLLFLEAEDPEKDIHL 64

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG+VTAGMAIYDTMQ+I+P +ST C+GQAASM + LL+AG KG R+ALP ARI+L
Sbjct: 65  YINSPGGLVTAGMAIYDTMQYIRPDVSTICLGQAASMAAFLLAAGAKGKRYALPYARIML 124

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQA+++E HA++I+++++ LNE+  K+ G+  E++ +  DRD  M+A +A D
Sbjct: 125 HQPLGGFQGQATEVEIHAREIMRMRQVLNELLSKHTGQPVEKIAQDTDRDFFMTAQQAKD 184

Query: 198 WGVVDKVLMSR 208
           +G++D+V+  R
Sbjct: 185 YGLIDEVITMR 195


>gi|149926126|ref|ZP_01914388.1| ATP-dependent Clp protease proteolytic subunit [Limnobacter sp.
           MED105]
 gi|149824944|gb|EDM84156.1| ATP-dependent Clp protease proteolytic subunit [Limnobacter sp.
           MED105]
          Length = 215

 Score =  265 bits (678), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 154/196 (78%)

Query: 19  VPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLY 78
           VPMV+EQ+ RGER+YDIYSRLLKER++F+ G I D MA +I AQ+LFLE+ENP K+I+LY
Sbjct: 19  VPMVIEQSGRGERAYDIYSRLLKERVIFLVGPINDQMANVIVAQMLFLESENPDKDIALY 78

Query: 79  INSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLH 138
           INSPGG V+AGMAIYDTMQFIKP +ST C G AASMG+ LLS+G KG RF+LPN+RI++H
Sbjct: 79  INSPGGSVSAGMAIYDTMQFIKPDVSTLCTGLAASMGAFLLSSGTKGKRFSLPNSRIMIH 138

Query: 139 QPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDW 198
           QP GG  GQASDIE HA++I+ ++ +LN I   N GKT EE+ +  DRD+ M A  A ++
Sbjct: 139 QPLGGVQGQASDIEIHAKEILYLREKLNGILADNTGKTIEEIARDTDRDNFMGADSAKEY 198

Query: 199 GVVDKVLMSRIDIEEK 214
           G++D VL  R+   +K
Sbjct: 199 GLIDDVLKHRVPPADK 214


>gi|126727090|ref|ZP_01742927.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Rhodobacterales bacterium HTCC2150]
 gi|126703518|gb|EBA02614.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Rhodobacterales bacterium HTCC2150]
          Length = 209

 Score =  265 bits (677), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 158/191 (82%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           ++P V E T+RG   YDI+SRLLKERI+FV+G + D MAT I AQLLFLEA+NP KEI++
Sbjct: 12  VIPTVEETTSRGSIRYDIFSRLLKERIIFVSGPVHDEMATTIVAQLLFLEADNPTKEIAM 71

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G++IYDTMQ+IKP +ST C+GQAASMGSLLL+AGE GMR++LPN+RI++
Sbjct: 72  YINSPGGVVTSGLSIYDTMQYIKPKVSTVCIGQAASMGSLLLAAGEPGMRYSLPNSRIMV 131

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGG+ GQA+DI  HA +  K+K RLN IYVK+ G+T ++V   L+RD+ MSA EA  
Sbjct: 132 HQPSGGYQGQATDIMIHAAETQKLKDRLNGIYVKHTGQTMKKVVDGLERDNFMSAEEAKS 191

Query: 198 WGVVDKVLMSR 208
           WG+VD+++ +R
Sbjct: 192 WGLVDEIVENR 202


>gi|34498013|ref|NP_902228.1| ATP-dependent Clp protease proteolytic subunit [Chromobacterium
           violaceum ATCC 12472]
 gi|60389718|sp|Q7NUY9|CLPP_CHRVO RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|34103868|gb|AAQ60228.1| ATP-dependent Clp protease proteolytic subunit [Chromobacterium
           violaceum ATCC 12472]
          Length = 210

 Score =  265 bits (677), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 157/199 (78%), Gaps = 3/199 (1%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVPMVVEQ+ RGER+YDIYSRLLKERIVF+ G + D  A L+ AQ+LFLE+ENP K+I
Sbjct: 10  LGLVPMVVEQSGRGERAYDIYSRLLKERIVFLVGPVTDESANLVVAQMLFLESENPDKDI 69

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
             YINSPGG +TAGM+IYDTM FIKP +ST C+GQAASMG+ LL+AG  G RFAL N+R+
Sbjct: 70  HFYINSPGGSITAGMSIYDTMNFIKPDVSTLCIGQAASMGAFLLAAGTHGKRFALENSRV 129

Query: 136 LLHQP---SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSA 192
           ++HQP    GG SGQ +DIE HA+++VK+K ++NE+  K+ G+T E V+   +RD+ MSA
Sbjct: 130 MIHQPLLYGGGLSGQVTDIEIHARELVKVKAKMNELLAKHSGQTLERVQSDTERDNFMSA 189

Query: 193 SEACDWGVVDKVLMSRIDI 211
            EA  +G++DKVL SR D+
Sbjct: 190 EEARAYGMIDKVLSSRRDV 208


>gi|256544468|ref|ZP_05471841.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Anaerococcus
           vaginalis ATCC 51170]
 gi|256399793|gb|EEU13397.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Anaerococcus
           vaginalis ATCC 51170]
          Length = 195

 Score =  265 bits (677), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 118/188 (62%), Positives = 157/188 (83%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQTNRGER+YDIYSRLLK+RI+F+TG +ED ++ +I AQLLFLE+++P K+I  
Sbjct: 7   LVPTVIEQTNRGERAYDIYSRLLKDRIIFLTGPVEDGVSDIIIAQLLFLESQDPNKDIQF 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVTAG+AIYDTM +IKP +ST C+GQAASMG++LLS+G KG RF+LPN+ IL+
Sbjct: 67  YINSPGGVVTAGLAIYDTMNYIKPDVSTICIGQAASMGAVLLSSGAKGKRFSLPNSNILI 126

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGG  GQASDI+  A+ I+K+K+RLN+I   N G++ E+++K  DRD  M A EA +
Sbjct: 127 HQPSGGAQGQASDIQIQAEQILKMKKRLNKILADNTGQSIEKIQKDTDRDFAMDAYEAKE 186

Query: 198 WGVVDKVL 205
           +G++DKV+
Sbjct: 187 YGLIDKVI 194


>gi|225848210|ref|YP_002728373.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225644423|gb|ACN99473.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 202

 Score =  265 bits (677), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 120/191 (62%), Positives = 157/191 (82%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+V+EQT RGER+YDIYSRLLK+RI+ +   I+DH+A LI AQLLFLEAE+P+K+I +
Sbjct: 8   LVPIVIEQTPRGERAYDIYSRLLKDRIILLGTPIDDHVANLIVAQLLFLEAEDPEKDIYM 67

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVTAG AIYDTM +IKP + T C+GQAASMG+ LLSAG KG R++LPNARI++
Sbjct: 68  YINSPGGVVTAGFAIYDTMNYIKPDVVTICIGQAASMGAFLLSAGAKGKRYSLPNARIMI 127

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQA+DIE HA++I+++KR LNE   K+ G+  E++E   +RD+ MSA EA +
Sbjct: 128 HQPLGGFQGQATDIEIHAREILRLKRMLNEYLAKHTGQPIEKIEADTERDYFMSAEEAKE 187

Query: 198 WGVVDKVLMSR 208
           +G++DKV+  R
Sbjct: 188 YGLIDKVIYKR 198


>gi|222087754|ref|YP_002546291.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Agrobacterium
           radiobacter K84]
 gi|221725202|gb|ACM28358.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Agrobacterium
           radiobacter K84]
          Length = 214

 Score =  265 bits (676), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 156/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMV+EQ++RGERS+DIYSRLL+ERI+F+ G++ D ++ L+CAQLLFLEAEN +K I
Sbjct: 12  MQLVPMVIEQSSRGERSFDIYSRLLRERIIFLNGEVNDTVSALVCAQLLFLEAENSRKPI 71

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGGVVT+G+A+YDTM++I+ P+ T CMG A SMGS LL AG+ G R ALPN+ I
Sbjct: 72  SLYINSPGGVVTSGLAMYDTMRYIRAPVHTLCMGTARSMGSFLLMAGQAGERSALPNSSI 131

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
            +HQP GGF GQASD+  HA ++ + K R+  +Y ++CG+TYEE E+ +DRDH M+A +A
Sbjct: 132 HIHQPLGGFQGQASDMLIHAAEMERTKHRMTRLYAEHCGRTYEEFERAMDRDHFMTAEQA 191

Query: 196 CDWGVVDKVLMSR 208
            +WG++D++L  R
Sbjct: 192 LEWGLIDRILQVR 204


>gi|171463607|ref|YP_001797720.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Polynucleobacter necessarius subsp. necessarius STIR1]
 gi|171193145|gb|ACB44106.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Polynucleobacter necessarius subsp. necessarius STIR1]
          Length = 209

 Score =  265 bits (676), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 159/208 (76%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           M +     ++ E   LGLVPMV+E + RGER+YDIYSRLL+ER++F+ G++ D  A L+ 
Sbjct: 1   MIYNHSQSENLEPKGLGLVPMVIETSGRGERAYDIYSRLLRERVIFLVGEVNDQTANLVI 60

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP KEISLYINSPGG V+AG+AIYDTMQFIKP +ST CMG AASMG+ LL 
Sbjct: 61  AQLLFLESENPDKEISLYINSPGGAVSAGLAIYDTMQFIKPHVSTLCMGMAASMGAFLLC 120

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AGE G R+ALPN+R+++HQP GG  GQASDIE  A++I+ ++ RLN+I     G++ E +
Sbjct: 121 AGENGKRYALPNSRVMIHQPLGGARGQASDIEIQAREILYLRERLNKILADRTGQSIETI 180

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
            K  DRD+ MSA +A D+G++DKV+  R
Sbjct: 181 AKDTDRDNFMSAEQARDYGLIDKVIEKR 208


>gi|307544936|ref|YP_003897415.1| ATP-dependent Clp protease proteolytic subunit [Halomonas elongata
           DSM 2581]
 gi|307216960|emb|CBV42230.1| ATP-dependent Clp protease proteolytic subunit [Halomonas elongata
           DSM 2581]
          Length = 206

 Score =  265 bits (676), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 155/192 (80%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMVVEQ+ RGERSYDIYSRLLKER++F+ G +ED+ A L+ AQLLFLE+ENP K+I 
Sbjct: 12  GLVPMVVEQSARGERSYDIYSRLLKERVIFLVGPVEDYTANLLVAQLLFLESENPDKDIH 71

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQAASMG+LLL+ G  G R+ LPN+R++
Sbjct: 72  LYINSPGGSVTAGMSIYDTMQFIKPDVSTVCIGQAASMGALLLAGGAHGKRYCLPNSRMM 131

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG+ GQASDIE H ++I+ I+ RLN+I   + G+ +E + K  DRD+ M+ ++A 
Sbjct: 132 IHQPLGGYQGQASDIEIHTREILGIRERLNQILAHHTGQKFETIAKDTDRDNFMNGAQAA 191

Query: 197 DWGVVDKVLMSR 208
           ++G++D VL  R
Sbjct: 192 EYGLIDAVLDKR 203


>gi|282883083|ref|ZP_06291683.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Peptoniphilus
           lacrimalis 315-B]
 gi|300813694|ref|ZP_07094016.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Peptoniphilus
           sp. oral taxon 836 str. F0141]
 gi|281297060|gb|EFA89556.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Peptoniphilus
           lacrimalis 315-B]
 gi|300512236|gb|EFK39414.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Peptoniphilus
           sp. oral taxon 836 str. F0141]
          Length = 194

 Score =  265 bits (676), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 119/193 (61%), Positives = 158/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQTNRGERSYDIYSRLLK+RI+F +G++ D MA LI AQLLFLE+E+P K+I
Sbjct: 1   MALVPMVVEQTNRGERSYDIYSRLLKDRIIFASGEVNDTMADLIVAQLLFLESEDPNKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG V+AG+AIYDTMQ+IKP +ST C+G AASMG++LLS+G KG RFALPN+ I
Sbjct: 61  QLYINSPGGSVSAGLAIYDTMQYIKPDVSTICIGMAASMGAILLSSGAKGKRFALPNSDI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  G A+DI+  A+ I+K ++ LN+I  KN G+  E++E+  DRD  + A+EA
Sbjct: 121 MIHQPSGGTQGMATDIQITAEKILKTRKSLNQILAKNTGQKLEKIERDADRDFWLDANEA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++DKV+ +R
Sbjct: 181 KEYGLIDKVIENR 193


>gi|261380957|ref|ZP_05985530.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Neisseria
           subflava NJ9703]
 gi|284796216|gb|EFC51563.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Neisseria
           subflava NJ9703]
          Length = 206

 Score =  265 bits (676), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 122/197 (61%), Positives = 158/197 (80%), Gaps = 2/197 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFLE+ENP K+I  
Sbjct: 9   LVPTVIEQSGRGERAFDIYSRLLKERIVFLIGPVTDESANLVVAQLLFLESENPDKDIFF 68

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG RFALPN+RI++
Sbjct: 69  YINSPGGSVTAGMSIYDTMNFIKPHVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMI 128

Query: 138 HQP--SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP  SGG +GQASDIE HA++++KIK +LN +  K+C +   ++E+  DRD+ MSA EA
Sbjct: 129 HQPLISGGLAGQASDIEIHAKELLKIKEKLNRLLAKHCDRDLADLERDTDRDNYMSADEA 188

Query: 196 CDWGVVDKVLMSRIDIE 212
             +G++D+VL +R  ++
Sbjct: 189 KKYGLIDQVLENRASLQ 205


>gi|304407481|ref|ZP_07389133.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Paenibacillus
           curdlanolyticus YK9]
 gi|304343432|gb|EFM09274.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Paenibacillus
           curdlanolyticus YK9]
          Length = 193

 Score =  265 bits (676), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 157/192 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGERSYDIYSRLLK+RI+F+   I+D +A  I AQLLFL A++P+K+I
Sbjct: 1   MNLVPIVVEQTNRGERSYDIYSRLLKDRIIFLGSAIDDDVANSIIAQLLFLAADDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAGM I+DTMQFIKP +ST C+G AASMGSLLL+AG KG RF+LPN+ +
Sbjct: 61  HLYINSPGGSVTAGMGIFDTMQFIKPDVSTICVGMAASMGSLLLTAGAKGKRFSLPNSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDI+ HA  I+K K++LN+IYV+  G+ YE++E+  DRD+ +SA EA
Sbjct: 121 MIHQPLGGVRGQASDIKIHADWIIKTKQKLNQIYVERTGQPYEKIERDTDRDNFLSAEEA 180

Query: 196 CDWGVVDKVLMS 207
             +G++DKV+ S
Sbjct: 181 VAYGLIDKVVTS 192


>gi|325983082|ref|YP_004295484.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Nitrosomonas
           sp. AL212]
 gi|325532601|gb|ADZ27322.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Nitrosomonas
           sp. AL212]
          Length = 213

 Score =  265 bits (676), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 161/202 (79%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D E   LGL+PMV+E + RGER+YDIYSRLLKER+VF+ G + +  A L+ AQ LFLE+
Sbjct: 9   RDMEPKNLGLIPMVIETSGRGERAYDIYSRLLKERVVFLVGPVTEASANLVVAQFLFLES 68

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           EN +K+I  YINSPGG+V+AG+A+YDTMQ+IKP +ST C+GQAASMG+LLL+AG KG R+
Sbjct: 69  ENSEKDIFFYINSPGGMVSAGLAVYDTMQYIKPDVSTLCIGQAASMGALLLTAGAKGKRY 128

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
            LPN+R+++HQP GGF GQASDIE HA++I+ +K RLNEI  K+  +   ++EK  DRD+
Sbjct: 129 CLPNSRVMIHQPLGGFQGQASDIEIHAREILYLKSRLNEIMAKHTERPVSDLEKDTDRDN 188

Query: 189 IMSASEACDWGVVDKVLMSRID 210
            MSA+E+ ++G+VD VL SR D
Sbjct: 189 FMSATESVNYGLVDAVLSSRND 210


>gi|237755491|ref|ZP_04584113.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Sulfurihydrogenibium yellowstonense SS-5]
 gi|237692355|gb|EEP61341.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 201

 Score =  265 bits (676), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 118/191 (61%), Positives = 157/191 (82%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           L+P+V+EQT RGER+YDIYSRLLK+RI+ +   I+DH+A L+ AQLLFLE+E+P K+I +
Sbjct: 8   LIPIVIEQTPRGERAYDIYSRLLKDRIILLGTPIDDHIANLVVAQLLFLESEDPDKDIYM 67

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVTAG+AIYDTM +IKP + T CMGQAASMG+ LLSAG KG R++LPNARI++
Sbjct: 68  YINSPGGVVTAGLAIYDTMNYIKPDVVTICMGQAASMGAFLLSAGAKGKRYSLPNARIMI 127

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQA+DIE HA++I+++KR LNE   K+ G+  E++E   +RD+ MSA EA +
Sbjct: 128 HQPLGGFQGQATDIEIHAKEILRLKRMLNEYLAKHTGQPIEKIEADTERDYFMSAEEAKE 187

Query: 198 WGVVDKVLMSR 208
           +G++DKV+  R
Sbjct: 188 YGLIDKVIYKR 198


>gi|194366563|ref|YP_002029173.1| ATP-dependent Clp protease proteolytic subunit [Stenotrophomonas
           maltophilia R551-3]
 gi|194349367|gb|ACF52490.1| Endopeptidase Clp [Stenotrophomonas maltophilia R551-3]
          Length = 202

 Score =  265 bits (676), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 115/191 (60%), Positives = 156/191 (81%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           L+PMVVE++ RGERSYDIYSRLL+ERI+F+ G+++D ++ L+CAQLLFLE+ENP+K I L
Sbjct: 7   LIPMVVERSERGERSYDIYSRLLRERIIFLNGEVDDTVSALVCAQLLFLESENPEKPIHL 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGV+++G+A+YDTMQ+I  P+ T CMG A SMGS LL AGE G R AL NA + +
Sbjct: 67  YINSPGGVISSGLAMYDTMQYISAPVHTLCMGTARSMGSFLLMAGEPGHRAALANASLHV 126

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG  GQASDI  HA+++ + K+R+  +Y ++CG++ EEVE+TLDRD  MSA +AC+
Sbjct: 127 HQPLGGVQGQASDIFIHAEEMQRTKQRITRLYAQHCGRSVEEVEQTLDRDRFMSAEQACE 186

Query: 198 WGVVDKVLMSR 208
           WG++D+VL+ R
Sbjct: 187 WGLIDQVLLRR 197


>gi|51246390|ref|YP_066274.1| ATP-dependent Clp protease, proteolytic subunit (ClpP)
           [Desulfotalea psychrophila LSv54]
 gi|50877427|emb|CAG37267.1| probable ATP-dependent Clp protease, proteolytic subunit (ClpP)
           [Desulfotalea psychrophila LSv54]
          Length = 213

 Score =  265 bits (676), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 121/199 (60%), Positives = 161/199 (80%)

Query: 14  VFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQK 73
           V + L+PMVVEQT RGERSYDIYSRLLKERI+F+   + D +A +I AQLLFLEAE+P+K
Sbjct: 9   VIMNLIPMVVEQTPRGERSYDIYSRLLKERIIFLGSGVNDDVANVIVAQLLFLEAEDPEK 68

Query: 74  EISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNA 133
           +I+ YINSPGG VTAGMAIYDTMQ+IK  I+T CMGQAASMG++LL+AG  G R+ALPN+
Sbjct: 69  DITFYINSPGGSVTAGMAIYDTMQYIKCDIATLCMGQAASMGAVLLAAGTAGKRYALPNS 128

Query: 134 RILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSAS 193
           RI++HQP GGF GQA+DIE H ++I++I++ LN I   + GKT +++E   +RD+ MS+ 
Sbjct: 129 RIMIHQPLGGFQGQATDIEIHTKEILRIRKDLNNILAHHTGKTLKKIESDTERDNFMSSV 188

Query: 194 EACDWGVVDKVLMSRIDIE 212
           EA  +G++D+VL+ R D+E
Sbjct: 189 EAQKYGLIDEVLVKREDVE 207


>gi|238026973|ref|YP_002911204.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia glumae
           BGR1]
 gi|237876167|gb|ACR28500.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia glumae
           BGR1]
          Length = 217

 Score =  265 bits (676), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 123/202 (60%), Positives = 157/202 (77%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
           A +D E   LGLVP+VVE + RGERSYDIYSRLLKERIVF+ G++ D  A L+ AQLLFL
Sbjct: 15  APQDFETKALGLVPIVVETSGRGERSYDIYSRLLKERIVFMVGEVNDQTANLVVAQLLFL 74

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP K+ISLYINSPGG V+AG+AIYDTMQFIKP +ST CMG AASMG+ LLS+G KG 
Sbjct: 75  ESENPDKDISLYINSPGGSVSAGLAIYDTMQFIKPDVSTLCMGLAASMGAFLLSSGAKGK 134

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R+ALPNAR+++HQP GG  GQASDIE  A++I+ ++ RLN+I  +N G+  E + +  DR
Sbjct: 135 RYALPNARVMIHQPLGGARGQASDIEIQAREILYLRERLNKILAENTGQDVERIARDTDR 194

Query: 187 DHIMSASEACDWGVVDKVLMSR 208
           D+ MS+ +A  +G++D V   R
Sbjct: 195 DNFMSSDDAKAYGLIDHVSAKR 216


>gi|330817271|ref|YP_004360976.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           gladioli BSR3]
 gi|327369664|gb|AEA61020.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           gladioli BSR3]
          Length = 217

 Score =  265 bits (676), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 123/202 (60%), Positives = 156/202 (77%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
           A +D E   LGLVP+VVE + RGERSYDIYSRLLKERIVF+ G++ D  A L+ AQLLFL
Sbjct: 15  APQDFETKALGLVPIVVETSGRGERSYDIYSRLLKERIVFMVGEVNDQTANLVVAQLLFL 74

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP K+ISLYINSPGG V+AG+AIYDTMQFIKP +ST CMG AASMG+ LLS+G KG 
Sbjct: 75  ESENPDKDISLYINSPGGSVSAGLAIYDTMQFIKPDVSTLCMGLAASMGAFLLSSGAKGK 134

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R+ALPNAR+++HQP GG  GQASDIE  A++I+ ++ RLN+I   N G+  E + +  DR
Sbjct: 135 RYALPNARVMIHQPLGGARGQASDIEIQAREILYLRERLNKILADNTGQDVERIARDTDR 194

Query: 187 DHIMSASEACDWGVVDKVLMSR 208
           D+ MS+ +A  +G++D V   R
Sbjct: 195 DNFMSSDDAKAYGLIDHVTAKR 216


>gi|188996270|ref|YP_001930521.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188931337|gb|ACD65967.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 201

 Score =  265 bits (676), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 118/191 (61%), Positives = 157/191 (82%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           L+P+V+EQT RGER+YDIYSRLLK+RI+ +   I+DH+A L+ AQLLFLE+E+P K+I +
Sbjct: 8   LIPIVIEQTPRGERAYDIYSRLLKDRIILLGTPIDDHIANLVVAQLLFLESEDPDKDIYM 67

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVTAG+AIYDTM +IKP + T CMGQAASMG+ LLSAG KG R++LPNARI++
Sbjct: 68  YINSPGGVVTAGLAIYDTMNYIKPDVVTICMGQAASMGAFLLSAGAKGKRYSLPNARIMI 127

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQA+DIE HA++I+++KR LNE   K+ G+  E++E   +RD+ MSA EA +
Sbjct: 128 HQPLGGFQGQATDIEIHAREILRLKRMLNEYLAKHTGQPIEKIEADTERDYFMSAEEAKE 187

Query: 198 WGVVDKVLMSR 208
           +G++DKV+  R
Sbjct: 188 YGLIDKVIYKR 198


>gi|148553517|ref|YP_001261099.1| ATP-dependent Clp protease proteolytic subunit [Sphingomonas
           wittichii RW1]
 gi|148498707|gb|ABQ66961.1| Endopeptidase Clp [Sphingomonas wittichii RW1]
          Length = 218

 Score =  265 bits (676), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 119/192 (61%), Positives = 157/192 (81%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVP+V+EQ+NRGERS+DIYSRLL+ERI+FVTGQ+EDHMA+LI AQLLFLE+ENP+K+I 
Sbjct: 17  ALVPVVIEQSNRGERSFDIYSRLLRERIIFVTGQVEDHMASLITAQLLFLESENPKKDIF 76

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           +YINSPGGVVTAG+AI+DTMQ+I+P + T C+GQAASMGS LL+AGE GMR AL N+RI+
Sbjct: 77  MYINSPGGVVTAGLAIHDTMQYIRPRVGTVCIGQAASMGSFLLAAGEPGMRVALTNSRIM 136

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG  G A+DIE  A++I++++ RLN +Y K   +  E +E  +DRD  + A EA 
Sbjct: 137 VHQPSGGAQGMAADIEIQAREILRMRHRLNSLYAKYTKQPIEAIEAAMDRDKFLEADEAK 196

Query: 197 DWGVVDKVLMSR 208
            +G++D+V   R
Sbjct: 197 AFGLIDEVFDKR 208


>gi|88810607|ref|ZP_01125864.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Nitrococcus
           mobilis Nb-231]
 gi|88792237|gb|EAR23347.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Nitrococcus
           mobilis Nb-231]
          Length = 214

 Score =  265 bits (676), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 158/203 (77%)

Query: 6   CAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLF 65
            + +  E +  GLVPMVVEQT RGER+YDIYSRLLKER++F+ G +EDH A L+ AQLLF
Sbjct: 4   SSDRRHEPMATGLVPMVVEQTARGERAYDIYSRLLKERVIFLVGPVEDHQANLLIAQLLF 63

Query: 66  LEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKG 125
           LE+ENP K+I LYINSPGGVV+AG+AIYDTMQF+KP +ST C+GQAASMG+LLL+ G  G
Sbjct: 64  LESENPDKDIHLYINSPGGVVSAGLAIYDTMQFVKPDVSTVCLGQAASMGALLLTGGAAG 123

Query: 126 MRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD 185
            R+ LPN+RI++HQP GGF GQA+D+E HA++I+ ++ RLN+I  ++ G+  E +++  +
Sbjct: 124 KRYCLPNSRIMIHQPLGGFQGQATDVEIHAREILAMRERLNQILAQHTGQDIETIQQDTE 183

Query: 186 RDHIMSASEACDWGVVDKVLMSR 208
           RD+ M    A  +G+VD VL  R
Sbjct: 184 RDNFMGPEAAQSYGIVDGVLRDR 206


>gi|222055723|ref|YP_002538085.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Geobacter sp.
           FRC-32]
 gi|254763790|sp|B9M0Y1|CLPP_GEOSF RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|221565012|gb|ACM20984.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Geobacter sp.
           FRC-32]
          Length = 199

 Score =  264 bits (675), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 157/188 (83%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+VVEQT RGERSYDIYSRLLK+RI+F+ G I+D ++ L+ AQLLFLEAE+P K+I L
Sbjct: 2   LVPIVVEQTGRGERSYDIYSRLLKDRIIFLGGAIDDTVSNLVIAQLLFLEAEDPDKDIHL 61

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVTAGMAIYDTM++IK P+ST C+GQAASMG+ LLS GEKG RF+L N+RI++
Sbjct: 62  YINSPGGVVTAGMAIYDTMRYIKAPVSTICVGQAASMGAFLLSGGEKGKRFSLANSRIMI 121

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQA+DI  HAQ+I+++K++LNE+  ++ G+T E++E   +RD+ MS  +A  
Sbjct: 122 HQPLGGFQGQATDIHIHAQEILRMKKKLNELLAEHSGQTVEKIEADTERDYFMSGEDAKT 181

Query: 198 WGVVDKVL 205
           +G++D ++
Sbjct: 182 YGIIDSII 189


>gi|160947717|ref|ZP_02094884.1| hypothetical protein PEPMIC_01652 [Parvimonas micra ATCC 33270]
 gi|158446851|gb|EDP23846.1| hypothetical protein PEPMIC_01652 [Parvimonas micra ATCC 33270]
          Length = 192

 Score =  264 bits (675), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 157/190 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+PMVVEQTNRGERSYDIYSRLLKERI+F++G++ D MA LI AQLLFLE+E+P+K+I
Sbjct: 1   MALIPMVVEQTNRGERSYDIYSRLLKERIIFLSGEVNDQMADLIVAQLLFLESEDPKKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGG V+AG+AIYDTMQ+IKP +ST C+G+AASMG+ LL++G KG RFALPNA I
Sbjct: 61  QIYINSPGGSVSAGLAIYDTMQYIKPDVSTICIGRAASMGAFLLTSGAKGKRFALPNADI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA DI+  AQ I++++  LNEI  K  G++ +++EK  DRD  MSA EA
Sbjct: 121 MIHQPLGGAQGQAEDIKIQAQKILQVRATLNEILAKRTGQSLKKIEKDTDRDFYMSAYEA 180

Query: 196 CDWGVVDKVL 205
            ++G++D+V+
Sbjct: 181 KEYGIIDEVI 190


>gi|115459516|ref|NP_001053358.1| Os04g0525600 [Oryza sativa Japonica Group]
 gi|113564929|dbj|BAF15272.1| Os04g0525600 [Oryza sativa Japonica Group]
 gi|215768496|dbj|BAH00725.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 309

 Score =  264 bits (675), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 119/192 (61%), Positives = 156/192 (81%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMV+E T+RGER+YDI+SRLLKERIV + G I D  A+L+ AQLLFLE+ENP K + 
Sbjct: 85  GLVPMVIEHTSRGERAYDIFSRLLKERIVCIHGPITDDTASLVVAQLLFLESENPAKPVH 144

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGVVTAG+AIYDTMQ+I+ P++T C+GQAASM SLLL+AG +G R ALPNAR++
Sbjct: 145 LYINSPGGVVTAGLAIYDTMQYIRSPVTTLCIGQAASMASLLLAAGARGERRALPNARVM 204

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG SGQASDI  HA++I+K++ RLN+IY K+  +  + +E+ ++RD  M   EA 
Sbjct: 205 IHQPSGGASGQASDIAIHAKEILKVRDRLNKIYAKHTSQAIDRIEQCMERDMFMDPEEAH 264

Query: 197 DWGVVDKVLMSR 208
           DWG++D+V+  R
Sbjct: 265 DWGLIDEVIEHR 276


>gi|18203149|sp|Q9JZ38|CLPP_NEIMB RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|316984112|gb|EFV63090.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Neisseria
           meningitidis H44/76]
 gi|325140464|gb|EGC62985.1| endopeptidase Clp [Neisseria meningitidis CU385]
 gi|325200063|gb|ADY95518.1| endopeptidase Clp [Neisseria meningitidis H44/76]
 gi|325205915|gb|ADZ01368.1| endopeptidase Clp [Neisseria meningitidis M04-240196]
          Length = 204

 Score =  264 bits (675), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 121/193 (62%), Positives = 156/193 (80%), Gaps = 2/193 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFLE+ENP K+I  
Sbjct: 7   LVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFF 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG RFALPN+RI++
Sbjct: 67  YINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMI 126

Query: 138 HQP--SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP  SGG  GQASDIE HA++++KIK +LN +  K+C +   ++E+  DRD+ MSA EA
Sbjct: 127 HQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCDRDLADLERDTDRDNFMSAEEA 186

Query: 196 CDWGVVDKVLMSR 208
            ++G++D++L +R
Sbjct: 187 KEYGLIDQILENR 199


>gi|78066693|ref|YP_369462.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia sp.
           383]
 gi|167586932|ref|ZP_02379320.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           ubonensis Bu]
 gi|90101404|sp|Q39FE8|CLPP_BURS3 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|77967438|gb|ABB08818.1| ATP-dependent Clp protease proteolytic subunit ClpP [Burkholderia
           sp. 383]
          Length = 217

 Score =  264 bits (675), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 119/193 (61%), Positives = 156/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVP+VVE + RGERSYDIYSRLLKER+VF+ G++ D  A L+ AQLLFLE+ENP K+I
Sbjct: 24  LGLVPIVVETSGRGERSYDIYSRLLKERLVFMVGEVNDQTANLVVAQLLFLESENPDKDI 83

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V+AGMAIYDTMQFIKP +ST CMG AASMG+ LL++G KG RFALPN+R+
Sbjct: 84  SLYINSPGGSVSAGMAIYDTMQFIKPDVSTLCMGLAASMGAFLLASGAKGKRFALPNSRV 143

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDIE  A++I+ +K RLN++  ++ G+  E + +  DRD+ MS+ +A
Sbjct: 144 MIHQPLGGARGQASDIEIQAREILYLKERLNQLLAQHTGQDVERIARDTDRDNFMSSEDA 203

Query: 196 CDWGVVDKVLMSR 208
             +G++D+VL+ R
Sbjct: 204 KAYGLIDQVLLKR 216


>gi|86357052|ref|YP_468944.1| ATP-dependent Clp protease proteolytic subunit [Rhizobium etli CFN
           42]
 gi|116243105|sp|Q2KAB9|CLPP1_RHIEC RecName: Full=ATP-dependent Clp protease proteolytic subunit 1;
           AltName: Full=Endopeptidase Clp 1
 gi|86281154|gb|ABC90217.1| endopeptidase Clp, subunit 1 protein [Rhizobium etli CFN 42]
          Length = 202

 Score =  264 bits (675), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 159/193 (82%), Gaps = 1/193 (0%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMV+EQ++RGERS+DIYSRLL+ERI+F+ G++ D ++ L+CAQLLFLEA +P+K I+L
Sbjct: 7   LVPMVIEQSSRGERSFDIYSRLLRERIIFLNGEVNDTVSALVCAQLLFLEA-DPEKPINL 65

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VT+G+A+YDTM+FI+ P+ T CMG A SMGS LL AGE G R ALPNA IL+
Sbjct: 66  YINSPGGAVTSGLAMYDTMRFIRAPVHTLCMGTARSMGSFLLMAGEPGERAALPNASILI 125

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGGF GQASD+  HA++I+K K+R+  +Y ++CG++YE+ E+ +DRD  M+A EA +
Sbjct: 126 HQPSGGFQGQASDMLIHAEEILKTKQRMTRLYAEHCGRSYEDFERGMDRDRFMTAEEALE 185

Query: 198 WGVVDKVLMSRID 210
           WG+++++L  R D
Sbjct: 186 WGLIERILKVRED 198


>gi|82703457|ref|YP_413023.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Nitrosospira
           multiformis ATCC 25196]
 gi|110816459|sp|Q2Y6J0|CLPP_NITMU RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|82411522|gb|ABB75631.1| ATP-dependent Clp protease proteolytic subunit ClpP [Nitrosospira
           multiformis ATCC 25196]
          Length = 213

 Score =  264 bits (675), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 160/201 (79%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           +++ E   LGL+PMV+E + RGER+YDIYSRLL+ER++F+ G + +  A LI AQLLFLE
Sbjct: 8   QRNHEPQDLGLIPMVIETSGRGERAYDIYSRLLRERVIFLVGPVTEASANLIVAQLLFLE 67

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           +EN  K+I  YINSPGG+V+AGMA+YDTMQFIKP +ST C+GQAASMGSLLL+AG KG R
Sbjct: 68  SENADKDIHFYINSPGGLVSAGMAVYDTMQFIKPDVSTLCIGQAASMGSLLLAAGAKGKR 127

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F LPN+R+++HQP GGF GQASDIE HA++I+ +K RLNE+  K+ G++ E +E+  DRD
Sbjct: 128 FCLPNSRVMIHQPLGGFQGQASDIEIHAREILYLKNRLNELLSKHTGQSMETIERDTDRD 187

Query: 188 HIMSASEACDWGVVDKVLMSR 208
           + + A ++  +G+VD VL SR
Sbjct: 188 NFLGAEDSVKYGLVDAVLTSR 208


>gi|284097335|ref|ZP_06385465.1| Peptidase S14, ClpP [Candidatus Poribacteria sp. WGA-A3]
 gi|283831154|gb|EFC35134.1| Peptidase S14, ClpP [Candidatus Poribacteria sp. WGA-A3]
          Length = 203

 Score =  264 bits (675), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 115/189 (60%), Positives = 160/189 (84%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           L+PMV+E TNRGER+YDIYSRLLK+RI+F+   I+D  + LI AQLLFLEAE+P+K+I+L
Sbjct: 2   LIPMVIESTNRGERAYDIYSRLLKDRIIFLGAPIDDIFSNLIIAQLLFLEAEDPEKDINL 61

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM IYDTMQ++KPPI+T C+GQAASMG+LLL+AG +G R ALPNAR+++
Sbjct: 62  YINSPGGSVTAGMGIYDTMQYVKPPITTICLGQAASMGALLLAAGTQGKRHALPNARVMI 121

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQA++I+ HA++I+KI+ RLN+I  ++ G+  E++ +  +RD+ MS +EA D
Sbjct: 122 HQPMGGFQGQATEIDIHAREILKIRERLNQILSEHTGQALEKISQDTERDYFMSGTEAKD 181

Query: 198 WGVVDKVLM 206
           +G++D+V++
Sbjct: 182 YGLIDEVIV 190


>gi|254492068|ref|ZP_05105244.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Methylophaga
           thiooxidans DMS010]
 gi|224462732|gb|EEF79005.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Methylophaga
           thiooxydans DMS010]
          Length = 212

 Score =  264 bits (675), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 153/191 (80%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+VVEQT+RGERSYDIYSRLLKER++F+ G +ED MA LI AQLLFLE+ENP K+I L
Sbjct: 17  LVPIVVEQTSRGERSYDIYSRLLKERVIFLVGPVEDQMANLIVAQLLFLESENPDKDIHL 76

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGMAIYDTMQF+KP +ST C+GQAASMG++LL+ G +G R  LPN+RI++
Sbjct: 77  YINSPGGAVTAGMAIYDTMQFVKPNVSTLCIGQAASMGAVLLAGGAEGKRHCLPNSRIMV 136

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQASD + HA++I+ I+ RLN I   + G+  E + +  DRD+ M+  +A +
Sbjct: 137 HQPLGGFQGQASDFDIHAKEILSIRDRLNGILAHHTGQDIEAIRRDTDRDNFMNGEQALE 196

Query: 198 WGVVDKVLMSR 208
           +G++D VL SR
Sbjct: 197 YGLIDSVLTSR 207


>gi|258514515|ref|YP_003190737.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Desulfotomaculum acetoxidans DSM 771]
 gi|257778220|gb|ACV62114.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Desulfotomaculum acetoxidans DSM 771]
          Length = 194

 Score =  264 bits (675), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 120/191 (62%), Positives = 158/191 (82%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+VVEQTNRGERSYDIYSRLLK+RI+F+ G IED+ A LI AQLLFLEAE+P+K+I L
Sbjct: 4   LVPIVVEQTNRGERSYDIYSRLLKDRIIFIGGPIEDYTANLIIAQLLFLEAEDPEKDIHL 63

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVTAGMAIYDTMQ+IKPP+ST C+GQAASMGS LL+AG  G RFALP ARI++
Sbjct: 64  YINSPGGVVTAGMAIYDTMQYIKPPVSTICLGQAASMGSFLLAAGAPGKRFALPYARIMI 123

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGG  GQA+DI  HA++I+++K  LN++  K+  +  +++ +  +RD  MSA +A +
Sbjct: 124 HQPSGGMQGQATDIGIHAKEILRMKEILNKLLSKHTKQPLDKITRDSERDFFMSAEDAKE 183

Query: 198 WGVVDKVLMSR 208
           +G++D+++  +
Sbjct: 184 YGIIDQIVTRK 194


>gi|20129427|ref|NP_609388.1| CG5045 [Drosophila melanogaster]
 gi|7297671|gb|AAF52923.1| CG5045 [Drosophila melanogaster]
 gi|21428864|gb|AAM50151.1| GH10833p [Drosophila melanogaster]
 gi|220944040|gb|ACL84563.1| CG5045-PA [synthetic construct]
 gi|220954028|gb|ACL89557.1| CG5045-PA [synthetic construct]
 gi|223966793|emb|CAR93133.1| CG5045-PA [Drosophila melanogaster]
          Length = 253

 Score =  264 bits (674), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 121/200 (60%), Positives = 158/200 (79%)

Query: 6   CAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLF 65
           C  + +    + L+PMVVEQT RGER+YDI+SRLLKERI+ + G I D +++ + AQLLF
Sbjct: 17  CGGRANSVRNINLIPMVVEQTGRGERAYDIFSRLLKERIICLMGNITDDISSTVVAQLLF 76

Query: 66  LEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKG 125
           L++EN  K I LYINSPGGVVTAG+AIYDTMQ++KPPI+T+C+GQA SMGSLLL+AG  G
Sbjct: 77  LQSENVNKPIHLYINSPGGVVTAGLAIYDTMQYVKPPIATWCVGQACSMGSLLLAAGAPG 136

Query: 126 MRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD 185
           MR++LPNARI++HQPSGG  GQA+DI  HA++I+KIKR+L  IYVK+   TYEE+   ++
Sbjct: 137 MRYSLPNARIMIHQPSGGAQGQATDILIHAEEIIKIKRQLTNIYVKHAKNTYEEMSGRME 196

Query: 186 RDHIMSASEACDWGVVDKVL 205
           RDH M+  EA   G++D VL
Sbjct: 197 RDHFMTPEEAKVLGIIDHVL 216


>gi|294670412|ref|ZP_06735294.1| hypothetical protein NEIELOOT_02131 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307876|gb|EFE49119.1| hypothetical protein NEIELOOT_02131 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 211

 Score =  264 bits (674), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 159/195 (81%), Gaps = 2/195 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           L+P V+EQ+ RGER++DIYSRLLKERI+F+ G + DH A L+ AQ+LFLE+ENP K+I  
Sbjct: 10  LIPTVIEQSGRGERAFDIYSRLLKERIIFLVGPVTDHTANLVVAQMLFLESENPDKDIFF 69

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YI+SPGG VTAGM+++DTM FIKP +ST C+GQAASMG+ LLSAG KG RFALPN+RI++
Sbjct: 70  YIDSPGGSVTAGMSVFDTMNFIKPDVSTLCLGQAASMGAFLLSAGAKGKRFALPNSRIMI 129

Query: 138 HQP--SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP  SGG  GQASDIE HA++++K+K++LNE+  K+ G+  E+VE+  DRD+ MS+  A
Sbjct: 130 HQPLISGGLGGQASDIEIHARELIKLKQKLNELLAKHTGQPLEKVERDTDRDNFMSSEAA 189

Query: 196 CDWGVVDKVLMSRID 210
            ++G++D+V+ +R D
Sbjct: 190 KEYGLIDEVIATRAD 204


>gi|195952528|ref|YP_002120818.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Hydrogenobaculum sp. Y04AAS1]
 gi|195932140|gb|ACG56840.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Hydrogenobaculum sp. Y04AAS1]
          Length = 205

 Score =  264 bits (674), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 159/200 (79%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           KD + +   LVP+VVEQT RGER+YDIYSRLL++RIV +   I+DH+A LI AQLLFLEA
Sbjct: 5   KDYQKIIDQLVPIVVEQTPRGERAYDIYSRLLQDRIVILGFPIDDHVANLIVAQLLFLEA 64

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ++P+K+I +YINSPGG VTAG+AIYDTMQ+IKP ++T C+GQAASMG++LL+AG KG RF
Sbjct: 65  QDPEKDIQMYINSPGGSVTAGLAIYDTMQYIKPDVTTICIGQAASMGAVLLAAGTKGKRF 124

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           ALPNARI++HQP GG  GQA+DI  HA++I +IK  LN I     GK   ++EK +DRD+
Sbjct: 125 ALPNARIMIHQPLGGVQGQATDILIHAEEIKRIKHILNTILANATGKNLRQIEKDVDRDY 184

Query: 189 IMSASEACDWGVVDKVLMSR 208
            MSA EA ++G++DKV+  R
Sbjct: 185 FMSAEEAKNYGLIDKVITKR 204


>gi|114330232|ref|YP_746454.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Nitrosomonas
           eutropha C91]
 gi|122314709|sp|Q0AJI2|CLPP_NITEC RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|114307246|gb|ABI58489.1| ATP-dependent Clp protease proteolytic subunit ClpP [Nitrosomonas
           eutropha C91]
          Length = 214

 Score =  264 bits (674), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 119/193 (61%), Positives = 155/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGL+PMV+E + RGER+YDIYSRLL+ERI+F+ G + +  A L+ AQLLFLE+EN +K+I
Sbjct: 17  LGLIPMVIESSGRGERAYDIYSRLLRERIIFLVGPVTETSANLVIAQLLFLESENSEKDI 76

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG+VTAG+A+YDTMQFIKP +ST C+GQAASMG+LLL+AG KG R+ LPN+R+
Sbjct: 77  SLYINSPGGLVTAGLAVYDTMQFIKPDVSTLCIGQAASMGALLLTAGAKGKRYCLPNSRV 136

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDIE HA++I+ +K RLNEI  K+  +T   +EK  DRD+ + A  A
Sbjct: 137 MIHQPLGGFQGQASDIEIHAKEILALKGRLNEILAKHTSQTIRTIEKDTDRDNFLGAEAA 196

Query: 196 CDWGVVDKVLMSR 208
             + +VD VL SR
Sbjct: 197 VKYSLVDAVLTSR 209


>gi|291614263|ref|YP_003524420.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Sideroxydans
           lithotrophicus ES-1]
 gi|291584375|gb|ADE12033.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Sideroxydans
           lithotrophicus ES-1]
          Length = 208

 Score =  264 bits (674), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 155/194 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +G++PMVVE + RGER+YDIYSRLLKER+VF+ G++ DH A LI AQ+LFLE+ENP K+I
Sbjct: 15  IGMIPMVVESSGRGERAYDIYSRLLKERVVFLVGEVNDHTANLIVAQMLFLESENPDKDI 74

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
             YINSPGG ++AGMAIYDTMQFIKP +ST C+G AASMG+ LL AG KG RFALPN+ +
Sbjct: 75  HFYINSPGGSISAGMAIYDTMQFIKPQVSTLCIGMAASMGAFLLQAGAKGKRFALPNSTV 134

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDIE HA+ I+ ++ RL  +  ++ G+T EE+ +  +RD+ +SA EA
Sbjct: 135 MIHQPLGGFRGQASDIEIHARYILSLRERLYALMAQHTGRTVEEIARDSERDNFLSAKEA 194

Query: 196 CDWGVVDKVLMSRI 209
            ++G+VD+VL  RI
Sbjct: 195 VEYGLVDQVLDKRI 208


>gi|221068424|ref|ZP_03544529.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Comamonas
           testosteroni KF-1]
 gi|220713447|gb|EED68815.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Comamonas
           testosteroni KF-1]
          Length = 202

 Score =  264 bits (674), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 117/193 (60%), Positives = 155/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG+VPMV+EQ+ RGERSYDIYSRLLKER++F+ G++ D  A L+ AQLLFLE+ENP K+I
Sbjct: 9   LGMVPMVIEQSGRGERSYDIYSRLLKERVIFLVGEVNDQTANLVVAQLLFLESENPDKDI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S YINSPGG VTAGMAI+DTM FIKP +ST C G AASMG+ LLSAG KG R+ALPNA++
Sbjct: 69  SFYINSPGGSVTAGMAIFDTMNFIKPDVSTLCTGMAASMGAFLLSAGAKGKRYALPNAQV 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE HA++I+K + RLN+I  +  G+  E+++   +RD+ +SA EA
Sbjct: 129 MIHQPLGGARGQATEIEIHAREILKTRERLNKILAERTGQPLEKIQNDTERDYFLSADEA 188

Query: 196 CDWGVVDKVLMSR 208
            D+G+VD+V+  R
Sbjct: 189 KDYGLVDQVISKR 201


>gi|38344435|emb|CAE05641.2| OSJNBa0038O10.7 [Oryza sativa Japonica Group]
 gi|116310954|emb|CAH67891.1| OSIGBa0153E02-OSIGBa0093I20.20 [Oryza sativa Indica Group]
 gi|125549084|gb|EAY94906.1| hypothetical protein OsI_16707 [Oryza sativa Indica Group]
          Length = 259

 Score =  264 bits (674), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 119/192 (61%), Positives = 156/192 (81%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMV+E T+RGER+YDI+SRLLKERIV + G I D  A+L+ AQLLFLE+ENP K + 
Sbjct: 35  GLVPMVIEHTSRGERAYDIFSRLLKERIVCIHGPITDDTASLVVAQLLFLESENPAKPVH 94

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGVVTAG+AIYDTMQ+I+ P++T C+GQAASM SLLL+AG +G R ALPNAR++
Sbjct: 95  LYINSPGGVVTAGLAIYDTMQYIRSPVTTLCIGQAASMASLLLAAGARGERRALPNARVM 154

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG SGQASDI  HA++I+K++ RLN+IY K+  +  + +E+ ++RD  M   EA 
Sbjct: 155 IHQPSGGASGQASDIAIHAKEILKVRDRLNKIYAKHTSQAIDRIEQCMERDMFMDPEEAH 214

Query: 197 DWGVVDKVLMSR 208
           DWG++D+V+  R
Sbjct: 215 DWGLIDEVIEHR 226


>gi|78357263|ref|YP_388712.1| ATP-dependent Clp protease proteolytic subunit [Desulfovibrio
           desulfuricans subsp. desulfuricans str. G20]
 gi|90101407|sp|Q30Z79|CLPP_DESDG RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|78219668|gb|ABB39017.1| ATP-dependent Clp protease proteolytic subunit ClpP [Desulfovibrio
           desulfuricans subsp. desulfuricans str. G20]
          Length = 200

 Score =  264 bits (674), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 116/198 (58%), Positives = 161/198 (81%)

Query: 19  VPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLY 78
           +PMV+E T R ER+YDIYSRLLK+RI+ +   ++D++A+LICAQLLFLE+ENP+KEI LY
Sbjct: 3   IPMVIESTGRAERAYDIYSRLLKDRIILLGTPVDDNVASLICAQLLFLESENPEKEIYLY 62

Query: 79  INSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLH 138
           INSPGGVVTAG+AIYDTMQ+I  P++T CMGQAASMG+ LL+AG+ GMRFALPN+RI++H
Sbjct: 63  INSPGGVVTAGLAIYDTMQYISAPVATLCMGQAASMGAFLLAAGQPGMRFALPNSRIMIH 122

Query: 139 QPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDW 198
           QP GG  GQA+DI+  A++I+++K RLNEI  ++ G+  E++ +  DRD+ M    A ++
Sbjct: 123 QPMGGAQGQATDIDIQAREILRLKDRLNEILSRHTGQPLEKIVEHTDRDYFMGPENAKNF 182

Query: 199 GVVDKVLMSRIDIEEKSK 216
           G++D++L SR D+E+  K
Sbjct: 183 GIIDRILTSRKDVEKDGK 200


>gi|94310823|ref|YP_584033.1| ATP-dependent Clp protease proteolytic subunit [Cupriavidus
           metallidurans CH34]
 gi|116243154|sp|Q1LM62|CLPP_RALME RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|93354675|gb|ABF08764.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Cupriavidus metallidurans CH34]
          Length = 216

 Score =  264 bits (674), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 119/193 (61%), Positives = 153/193 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVPMVVEQ+ RGER+YDIYSRLLKER+VF+ G++ D  A L+ AQLLFLE+ENP K++
Sbjct: 23  LGLVPMVVEQSGRGERAYDIYSRLLKERVVFMVGEVNDQTANLVVAQLLFLESENPDKDV 82

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V+AG+AIYDTMQFIKP + T CMG AASMG+ LL+AG KG R ALPN+RI
Sbjct: 83  SLYINSPGGSVSAGLAIYDTMQFIKPDVQTLCMGMAASMGAFLLAAGAKGKRSALPNSRI 142

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDIE  A++I+ ++ RLN I  +  G+  E++ +  DRD+ MS  +A
Sbjct: 143 MIHQPLGGARGQASDIEIQAREILYLRERLNSILSEVTGQPVEKIARDTDRDNFMSGDQA 202

Query: 196 CDWGVVDKVLMSR 208
            D+G++DKV+  R
Sbjct: 203 VDYGLIDKVITRR 215


>gi|112823618|gb|ABI25707.1| ATP-dependent Clp protease proteolytic subunit ClpP [Haemophilus
           somnus 129PT]
          Length = 188

 Score =  264 bits (674), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 122/188 (64%), Positives = 156/188 (82%)

Query: 21  MVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYIN 80
           MVVEQT+RGERSYDIYSRLLKER++F+TG++ED MA LI AQLLFLEAE+P K+I++YIN
Sbjct: 1   MVVEQTSRGERSYDIYSRLLKERVIFLTGEVEDRMANLIVAQLLFLEAEDPAKDINIYIN 60

Query: 81  SPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQP 140
           SPGG VTAGMAIYDTMQFIKP + T C+GQA SMG+ LL+ G  G R ALP+AR+++HQP
Sbjct: 61  SPGGSVTAGMAIYDTMQFIKPDVRTLCIGQACSMGAFLLAGGTAGKRAALPHARVMIHQP 120

Query: 141 SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGV 200
            GGF GQASDI+ HAQ+I+KIK+ LNE    + G++ E++E+  DRD+ MSA +A  +G+
Sbjct: 121 LGGFRGQASDIQIHAQEILKIKQTLNERLAFHTGQSIEQIEQDTDRDNFMSAEQAKLYGL 180

Query: 201 VDKVLMSR 208
           VD+VL+ R
Sbjct: 181 VDEVLIKR 188


>gi|226533042|ref|NP_001147355.1| ATP-dependent Clp protease proteolytic subunit [Zea mays]
 gi|194700894|gb|ACF84531.1| unknown [Zea mays]
 gi|195610476|gb|ACG27068.1| ATP-dependent Clp protease proteolytic subunit [Zea mays]
          Length = 260

 Score =  264 bits (674), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 119/192 (61%), Positives = 156/192 (81%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMV+E T+RGER+YDI+SRLLKERIV + G I D  A+L+ AQLLFLE+ENP K + 
Sbjct: 36  GLVPMVIEHTSRGERAYDIFSRLLKERIVCIHGPITDDTASLVVAQLLFLESENPAKPVH 95

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGVVTAG+AIYDTMQ+I+ P++T C+GQAASM SLLL+AG  G R ALPNAR++
Sbjct: 96  LYINSPGGVVTAGLAIYDTMQYIRSPVTTLCIGQAASMASLLLAAGASGERRALPNARVM 155

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG SGQASDI  HA++I+K++ RLN+IY K+ G+  + +E+ ++RD  M   EA 
Sbjct: 156 IHQPSGGASGQASDIAIHAKEILKVRDRLNKIYAKHTGQAIDRIEQCMERDMFMDPEEAH 215

Query: 197 DWGVVDKVLMSR 208
           +WG++D+V+  R
Sbjct: 216 EWGLIDEVIEHR 227


>gi|73541074|ref|YP_295594.1| ATP-dependent Clp protease proteolytic subunit [Ralstonia eutropha
           JMP134]
 gi|124013825|sp|Q472D3|CLPP_RALEJ RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|72118487|gb|AAZ60750.1| ATP-dependent Clp protease proteolytic subunit ClpP [Ralstonia
           eutropha JMP134]
          Length = 216

 Score =  264 bits (674), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 119/193 (61%), Positives = 153/193 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVPMVVEQ+ RGER+YDIYSRLLKER+VF+ G++ D  A L+ AQLLFLE+ENP K+I
Sbjct: 23  LGLVPMVVEQSGRGERAYDIYSRLLKERVVFLVGEVNDQTANLVVAQLLFLESENPDKDI 82

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V+AG+AIYDTMQF+KP + T CMG AASMG+ LL+AG KG R ALPN+RI
Sbjct: 83  SLYINSPGGSVSAGLAIYDTMQFVKPDVQTLCMGMAASMGAFLLAAGAKGKRSALPNSRI 142

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDIE  A++I+ ++ RLN I  +  G+  E++ +  DRD+ MS  +A
Sbjct: 143 MIHQPLGGARGQASDIEIQAREILYLRERLNSILSEVTGQPVEKIARDTDRDNFMSGDQA 202

Query: 196 CDWGVVDKVLMSR 208
            D+G++DKV+  R
Sbjct: 203 VDYGLIDKVIARR 215


>gi|194761774|ref|XP_001963100.1| GF15771 [Drosophila ananassae]
 gi|190616797|gb|EDV32321.1| GF15771 [Drosophila ananassae]
          Length = 252

 Score =  263 bits (673), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 121/200 (60%), Positives = 159/200 (79%)

Query: 6   CAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLF 65
           CA + S    + L+PMVVEQT RGER+YDI+SRLLKERI+ + G I D +++ + AQLLF
Sbjct: 17  CAGRTSLVRNINLIPMVVEQTGRGERAYDIFSRLLKERIICLMGNITDDISSTVVAQLLF 76

Query: 66  LEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKG 125
           L++EN  K I LYINSPGGVVTAG+AIYDTMQ++KPPI+T+C+GQA SMGSLLL+AG  G
Sbjct: 77  LQSENVNKPIHLYINSPGGVVTAGLAIYDTMQYVKPPIATWCVGQACSMGSLLLAAGAPG 136

Query: 126 MRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD 185
           MR++LPNARI++HQPSGG  GQA+DI  HA++I+KIKR+L  IYVK+   +Y+E+   ++
Sbjct: 137 MRYSLPNARIMIHQPSGGAQGQATDILIHAEEIIKIKRQLTSIYVKHAKNSYDEMCSRME 196

Query: 186 RDHIMSASEACDWGVVDKVL 205
           RDH M+  EA   G++D VL
Sbjct: 197 RDHFMTPEEAKTLGIIDHVL 216


>gi|302817596|ref|XP_002990473.1| hypothetical protein SELMODRAFT_131898 [Selaginella moellendorffii]
 gi|300141641|gb|EFJ08350.1| hypothetical protein SELMODRAFT_131898 [Selaginella moellendorffii]
          Length = 253

 Score =  263 bits (673), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 118/194 (60%), Positives = 160/194 (82%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
             GL+PMV+E T RGER+YDI+SRLLKERIV + G I D  A+L+ AQLL+LE+ENP K 
Sbjct: 26  LYGLIPMVIEHTARGERAYDIFSRLLKERIVCIHGPIADDTASLVVAQLLYLESENPLKP 85

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           I LYINSPGGVVTAG+AIYDTMQ+I+ P+ST C+GQAASMGSLLL+AGE G R +LPNAR
Sbjct: 86  IHLYINSPGGVVTAGLAIYDTMQYIRSPVSTLCVGQAASMGSLLLAAGEPGQRRSLPNAR 145

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           +++HQPSGG SGQASDI   A++I+ ++ RLN++Y K+ G + E+++++++RDH MS  E
Sbjct: 146 VMVHQPSGGASGQASDIAIQAREILDMRSRLNKLYAKHTGSSIEKIDQSMERDHFMSPEE 205

Query: 195 ACDWGVVDKVLMSR 208
           A ++G++D+V++ R
Sbjct: 206 AKEFGLIDEVIVQR 219


>gi|219872047|ref|YP_002476422.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           parasuis SH0165]
 gi|254763791|sp|B8F822|CLPP_HAEPS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|219692251|gb|ACL33474.1| ATP-dependent Clp protease proteolytic subunit ClpP [Haemophilus
           parasuis SH0165]
          Length = 193

 Score =  263 bits (673), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 157/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++PMVVEQ+++GER+YDIYSRLLKERI+F+ G +ED MA LI AQ+LFLEAE+P+K+I
Sbjct: 1   MAVIPMVVEQSSKGERAYDIYSRLLKERIIFLNGGVEDEMAKLIIAQMLFLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGVVTAG+AIYDTM FIKP +ST CMGQA SMG+ LLSAG KG RFALPN+R+
Sbjct: 61  YLYINSPGGVVTAGLAIYDTMNFIKPDVSTLCMGQACSMGAFLLSAGAKGKRFALPNSRV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG+ GQA+DI+ HAQ+I+K+K  L     ++C + +E+V +  +RD+ MSA EA
Sbjct: 121 MIHQPLGGYRGQATDIQIHAQEILKLKEMLTRKMAEHCSQPFEKVAQDTERDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G++D V+  R
Sbjct: 181 KAYGLIDDVVTKR 193


>gi|319794078|ref|YP_004155718.1| ATP-dependent clp protease, proteolytic subunit clpp [Variovorax
           paradoxus EPS]
 gi|315596541|gb|ADU37607.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Variovorax
           paradoxus EPS]
          Length = 202

 Score =  263 bits (673), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 119/193 (61%), Positives = 157/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG+VPMVVEQ+ RGERSYDIYSRLLKERIVF+ G++ D  A L+ AQLLFLE+ENP+K+I
Sbjct: 9   LGMVPMVVEQSGRGERSYDIYSRLLKERIVFLVGEVNDQTANLVVAQLLFLESENPEKDI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S YINSPGG V+AGMAIYDTMQFIKP +ST C+G AASMG+ LL+AGEKG RF+LPN+++
Sbjct: 69  SFYINSPGGSVSAGMAIYDTMQFIKPDVSTMCLGFAASMGAFLLAAGEKGKRFSLPNSKV 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQ  GG  GQA+DIE HA+DI++ K ++N I  +  G+  E+V+   +RD+ ++A EA
Sbjct: 129 MIHQVLGGARGQATDIEIHARDILRTKDQMNRILAERTGQPLEKVKTDTERDYFLTADEA 188

Query: 196 CDWGVVDKVLMSR 208
            D+G+VD+V+  R
Sbjct: 189 KDYGLVDQVVAKR 201


>gi|134295958|ref|YP_001119693.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           vietnamiensis G4]
 gi|166201808|sp|A4JF05|CLPP_BURVG RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|134139115|gb|ABO54858.1| ATP-dependent Clp protease proteolytic subunit ClpP [Burkholderia
           vietnamiensis G4]
          Length = 217

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 119/193 (61%), Positives = 155/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVP+VVE + RGERSYDIYSRLLKER+VF+ G++ D  A L+ AQLLFLE+ENP K+I
Sbjct: 24  LGLVPIVVETSGRGERSYDIYSRLLKERLVFMVGEVNDQTANLVVAQLLFLESENPDKDI 83

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V+AGMAIYDTMQFIKP +ST CMG AASMG+ LL++G KG RFALPN+R+
Sbjct: 84  SLYINSPGGSVSAGMAIYDTMQFIKPDVSTLCMGLAASMGAFLLASGAKGKRFALPNSRV 143

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDIE  A++I+ +K RLN +  ++ G+  E + +  DRD+ MS+ +A
Sbjct: 144 MIHQPLGGARGQASDIEIQAREILYLKERLNNLLAQHTGQDVERIARDTDRDNFMSSDDA 203

Query: 196 CDWGVVDKVLMSR 208
             +G++D+VL+ R
Sbjct: 204 KAYGLIDQVLLKR 216


>gi|195434156|ref|XP_002065069.1| GK15263 [Drosophila willistoni]
 gi|194161154|gb|EDW76055.1| GK15263 [Drosophila willistoni]
          Length = 255

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 160/200 (80%)

Query: 6   CAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLF 65
           CA + +    + L+PMVVEQT RGER+YDI+SRLLKERI+ + G I D +++ + AQLLF
Sbjct: 17  CASRANSVRGINLIPMVVEQTGRGERAYDIFSRLLKERIICLMGNITDDISSTVVAQLLF 76

Query: 66  LEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKG 125
           L++EN  K I LYINSPGGVVTAG+AIYDTMQ++KPPI+T+C+GQA SMGSLLL+AG  G
Sbjct: 77  LQSENVNKPIHLYINSPGGVVTAGLAIYDTMQYVKPPIATWCVGQACSMGSLLLAAGAPG 136

Query: 126 MRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD 185
           MR++LPNARI++HQPSGG  GQA+DI  HA++I+KIKR+L  IYVK+   +Y+E+ + ++
Sbjct: 137 MRYSLPNARIMIHQPSGGAQGQATDILIHAEEIIKIKRQLTAIYVKHAKNSYDEMCQRME 196

Query: 186 RDHIMSASEACDWGVVDKVL 205
           RDH M+  EA   G++D VL
Sbjct: 197 RDHFMTPEEAKTLGIIDHVL 216


>gi|320354136|ref|YP_004195475.1| ATP-dependent Clp protease proteolytic subunit ClpP [Desulfobulbus
           propionicus DSM 2032]
 gi|320122638|gb|ADW18184.1| ATP-dependent Clp protease proteolytic subunit ClpP [Desulfobulbus
           propionicus DSM 2032]
          Length = 200

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 115/193 (59%), Positives = 162/193 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQ+ RGER++DIYSRLLKERI+F+  Q+ D +A+L+ AQLLFLEAE+P K+I
Sbjct: 1   MNLVPMVVEQSPRGERAFDIYSRLLKERIIFLGTQVNDDVASLVVAQLLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           + YINSPGG VTAGMAIYDTMQ+I+  ++T CMGQAASMG+LLL++G  G RFALPN+RI
Sbjct: 61  TFYINSPGGSVTAGMAIYDTMQYIRCDVATLCMGQAASMGALLLASGAAGKRFALPNSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG+ GQA+DI+ HA++I++++  LN I  ++ GK+ ++++   +RD+ MSA+EA
Sbjct: 121 MIHQPMGGYQGQATDIDIHAREILRMRHDLNTILARHTGKSMKKIQADTERDNFMSATEA 180

Query: 196 CDWGVVDKVLMSR 208
           C++G++DKVL +R
Sbjct: 181 CEYGIIDKVLTNR 193


>gi|255019392|ref|ZP_05291501.1| ATP-dependent Clp protease proteolytic subunit [Acidithiobacillus
           caldus ATCC 51756]
 gi|254971164|gb|EET28617.1| ATP-dependent Clp protease proteolytic subunit [Acidithiobacillus
           caldus ATCC 51756]
          Length = 214

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 128/198 (64%), Positives = 165/198 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG VPMV+EQT RGER++DIYSRLLKER++F+ G +ED MA L+ AQLLFLEAENP K+I
Sbjct: 16  LGYVPMVIEQTGRGERAFDIYSRLLKERVIFLVGPVEDLMANLVVAQLLFLEAENPDKDI 75

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           +LYINSPGG VTAG+AIYDTMQFI+P +ST C+GQAASMG++LL+AG  G R+ALPNARI
Sbjct: 76  ALYINSPGGSVTAGLAIYDTMQFIRPAVSTVCIGQAASMGAVLLAAGAAGKRYALPNARI 135

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           +LHQPSGG+ G A DIE HA++I++I++RLNEI V++ G++ + +E+ LDRD  MSA EA
Sbjct: 136 MLHQPSGGYQGVAHDIEIHAKEILRIRQRLNEILVEHTGQSQQRIEQDLDRDFFMSAQEA 195

Query: 196 CDWGVVDKVLMSRIDIEE 213
            D+ +VD V+  R D E+
Sbjct: 196 KDYHLVDSVITHRGDNED 213


>gi|107028898|ref|YP_625993.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           cenocepacia AU 1054]
 gi|115351962|ref|YP_773801.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           ambifaria AMMD]
 gi|116689944|ref|YP_835567.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           cenocepacia HI2424]
 gi|170702050|ref|ZP_02892966.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           ambifaria IOP40-10]
 gi|170733282|ref|YP_001765229.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           cenocepacia MC0-3]
 gi|171320790|ref|ZP_02909797.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           ambifaria MEX-5]
 gi|172060888|ref|YP_001808540.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           ambifaria MC40-6]
 gi|206560359|ref|YP_002231123.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           cenocepacia J2315]
 gi|116243129|sp|Q1BH85|CLPP_BURCA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|122322952|sp|Q0BEF6|CLPP_BURCM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166201802|sp|A0K847|CLPP_BURCH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|105898062|gb|ABF81020.1| ATP-dependent Clp protease proteolytic subunit ClpP [Burkholderia
           cenocepacia AU 1054]
 gi|115281950|gb|ABI87467.1| ATP-dependent Clp protease proteolytic subunit ClpP [Burkholderia
           ambifaria AMMD]
 gi|116648033|gb|ABK08674.1| ATP-dependent Clp protease proteolytic subunit ClpP [Burkholderia
           cenocepacia HI2424]
 gi|169816524|gb|ACA91107.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           cenocepacia MC0-3]
 gi|170133036|gb|EDT01448.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           ambifaria IOP40-10]
 gi|171093960|gb|EDT39074.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           ambifaria MEX-5]
 gi|171993405|gb|ACB64324.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           ambifaria MC40-6]
 gi|198036400|emb|CAR52296.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           cenocepacia J2315]
          Length = 217

 Score =  263 bits (672), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 119/193 (61%), Positives = 155/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVP+VVE + RGERSYDIYSRLLKER+VF+ G++ D  A L+ AQLLFLE+ENP K+I
Sbjct: 24  LGLVPIVVETSGRGERSYDIYSRLLKERLVFMVGEVNDQTANLVVAQLLFLESENPDKDI 83

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V+AGMAIYDTMQFIKP +ST CMG AASMG+ LL++G KG RFALPN+R+
Sbjct: 84  SLYINSPGGSVSAGMAIYDTMQFIKPDVSTLCMGLAASMGAFLLASGAKGKRFALPNSRV 143

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDIE  A++I+ +K RLN +  ++ G+  E + +  DRD+ MS+ +A
Sbjct: 144 MIHQPLGGARGQASDIEIQAREILYLKERLNNLLAQHTGQDVERIARDTDRDNFMSSEDA 203

Query: 196 CDWGVVDKVLMSR 208
             +G++D+VL+ R
Sbjct: 204 KAYGLIDQVLLKR 216


>gi|28870881|ref|NP_793500.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|213968834|ref|ZP_03396975.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Pseudomonas
           syringae pv. tomato T1]
 gi|28854130|gb|AAO57195.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|213926437|gb|EEB59991.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Pseudomonas
           syringae pv. tomato T1]
          Length = 216

 Score =  263 bits (672), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 117/192 (60%), Positives = 154/192 (80%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMV+EQ+ RGER+YDIYSRLLKER++F+ G +ED+MA LI AQLLFLEAENP K+I 
Sbjct: 21  GLVPMVIEQSARGERAYDIYSRLLKERVIFMVGPVEDYMANLIAAQLLFLEAENPDKDIH 80

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQA SMG+ LL+ G +G R  LPN+R++
Sbjct: 81  LYINSPGGSVTAGMSIYDTMQFIKPDVSTICIGQACSMGAFLLAGGAEGKRHCLPNSRMM 140

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI+ HA++I+ I+ RLN +   + G++ E +E+  +RD+ MSA  A 
Sbjct: 141 IHQPLGGFQGQASDIDIHAKEILHIRHRLNSLLAHHTGQSLETIERDTERDNFMSAERAA 200

Query: 197 DWGVVDKVLMSR 208
           ++G++D V+  R
Sbjct: 201 EYGLIDSVINKR 212


>gi|302804055|ref|XP_002983780.1| hypothetical protein SELMODRAFT_48156 [Selaginella moellendorffii]
 gi|300148617|gb|EFJ15276.1| hypothetical protein SELMODRAFT_48156 [Selaginella moellendorffii]
          Length = 206

 Score =  263 bits (672), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 118/194 (60%), Positives = 160/194 (82%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
             GL+PMV+E T RGER+YDI+SRLLKERIV + G I D  A+L+ AQLL+LE+ENP K 
Sbjct: 3   LYGLIPMVIEHTARGERAYDIFSRLLKERIVCIHGPIADDTASLVVAQLLYLESENPLKP 62

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           I LYINSPGGVVTAG+AIYDTMQ+I+ P+ST C+GQAASMGSLLL+AGE G R +LPNAR
Sbjct: 63  IHLYINSPGGVVTAGLAIYDTMQYIRSPVSTLCVGQAASMGSLLLAAGEPGQRRSLPNAR 122

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           +++HQPSGG SGQASDI   A++I+ ++ RLN++Y K+ G + E+++++++RDH MS  E
Sbjct: 123 VMVHQPSGGASGQASDIAIQAREILDMRSRLNKLYAKHTGSSIEKIDQSMERDHFMSPEE 182

Query: 195 ACDWGVVDKVLMSR 208
           A ++G++D+V++ R
Sbjct: 183 AKEFGLIDEVIVQR 196


>gi|261401252|ref|ZP_05987377.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Neisseria
           lactamica ATCC 23970]
 gi|269208735|gb|EEZ75190.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Neisseria
           lactamica ATCC 23970]
          Length = 206

 Score =  263 bits (672), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 121/196 (61%), Positives = 157/196 (80%), Gaps = 2/196 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFLE+ENP K+I  
Sbjct: 9   LVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFF 68

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAG KG RFALPN+RI++
Sbjct: 69  YINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGGKGKRFALPNSRIMI 128

Query: 138 HQP--SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP  SGG  GQASDIE HA++++KIK +LN +  K+C +   ++E+  DRD+ MSA EA
Sbjct: 129 HQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCDRDLADLERDTDRDNFMSAEEA 188

Query: 196 CDWGVVDKVLMSRIDI 211
            ++G++D+VL +R+ +
Sbjct: 189 KEYGLIDQVLENRVSL 204


>gi|313668450|ref|YP_004048734.1| endopeptidase [Neisseria lactamica ST-640]
 gi|309379242|emb|CBX22199.1| unnamed protein product [Neisseria lactamica Y92-1009]
 gi|313005912|emb|CBN87368.1| endopeptidase [Neisseria lactamica 020-06]
          Length = 206

 Score =  263 bits (672), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 157/197 (79%), Gaps = 2/197 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFLE+ENP K+I  
Sbjct: 9   LVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFF 68

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAG KG RFALPN+RI++
Sbjct: 69  YINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGGKGKRFALPNSRIMI 128

Query: 138 HQP--SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP  SGG  GQASDIE HA++++KIK +LN +  K+C +   ++E+  DRD+ MSA EA
Sbjct: 129 HQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCNRDLADLERDTDRDNFMSAEEA 188

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G++D+VL +R  ++
Sbjct: 189 KEYGLIDQVLENRASLQ 205


>gi|195146760|ref|XP_002014352.1| GL19149 [Drosophila persimilis]
 gi|194106305|gb|EDW28348.1| GL19149 [Drosophila persimilis]
          Length = 253

 Score =  263 bits (672), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 158/200 (79%)

Query: 6   CAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLF 65
           C    +    + L+PMVVEQT RGER+YDI+SRLLKERI+ + G I D +++ + AQLLF
Sbjct: 17  CVTGTTSSRSINLIPMVVEQTGRGERAYDIFSRLLKERIICLMGNITDDISSTVVAQLLF 76

Query: 66  LEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKG 125
           L++EN  K I LYINSPGGVVTAG+AIYDTMQ++KPPI+T+C+GQA SMGSLLL+AG  G
Sbjct: 77  LQSENVNKPIHLYINSPGGVVTAGLAIYDTMQYVKPPIATWCVGQACSMGSLLLAAGAPG 136

Query: 126 MRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD 185
           MR++LPNARI++HQPSGG  GQA+DI  HA++I+KIKR+L  IYVK+   +YEE+ + ++
Sbjct: 137 MRYSLPNARIMIHQPSGGAQGQATDILIHAEEIIKIKRQLTSIYVKHAKNSYEEMCQRME 196

Query: 186 RDHIMSASEACDWGVVDKVL 205
           RDH M+  EA   G++D VL
Sbjct: 197 RDHFMTPDEAKILGIIDHVL 216


>gi|66044992|ref|YP_234833.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           syringae pv. syringae B728a]
 gi|71733685|ref|YP_273935.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|237803596|ref|ZP_04591181.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           syringae pv. oryzae str. 1_6]
 gi|257483815|ref|ZP_05637856.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           syringae pv. tabaci ATCC 11528]
 gi|289627504|ref|ZP_06460458.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           syringae pv. aesculi str. NCPPB3681]
 gi|289649945|ref|ZP_06481288.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           syringae pv. aesculi str. 2250]
 gi|289679415|ref|ZP_06500305.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           syringae pv. syringae FF5]
 gi|298486263|ref|ZP_07004326.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|301384120|ref|ZP_07232538.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           syringae pv. tomato Max13]
 gi|302059517|ref|ZP_07251058.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           syringae pv. tomato K40]
 gi|302135032|ref|ZP_07261022.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           syringae pv. tomato NCPPB 1108]
 gi|302187983|ref|ZP_07264656.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           syringae pv. syringae 642]
 gi|38257468|sp|Q87YR6|CLPP_PSESM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|81308384|sp|Q4ZVM7|CLPP_PSEU2 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|110816461|sp|Q48KZ0|CLPP_PSE14 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|63255699|gb|AAY36795.1| Peptidase S14, ClpP [Pseudomonas syringae pv. syringae B728a]
 gi|71554238|gb|AAZ33449.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|298159270|gb|EFI00328.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|320325361|gb|EFW81428.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           syringae pv. glycinea str. B076]
 gi|320327654|gb|EFW83662.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           syringae pv. glycinea str. race 4]
 gi|330868375|gb|EGH03084.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           syringae pv. aesculi str. 0893_23]
 gi|330878772|gb|EGH12921.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           syringae pv. morsprunorum str. M302280PT]
 gi|330882125|gb|EGH16274.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           syringae pv. glycinea str. race 4]
 gi|330889997|gb|EGH22658.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           syringae pv. mori str. 301020]
 gi|330897794|gb|EGH29213.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           syringae pv. japonica str. M301072PT]
 gi|330939706|gb|EGH43001.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           syringae pv. pisi str. 1704B]
 gi|330952797|gb|EGH53057.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           syringae Cit 7]
 gi|330959387|gb|EGH59647.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           syringae pv. maculicola str. ES4326]
 gi|330963320|gb|EGH63580.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           syringae pv. actinidiae str. M302091]
 gi|330972589|gb|EGH72655.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           syringae pv. aceris str. M302273PT]
 gi|330985639|gb|EGH83742.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           syringae pv. lachrymans str. M301315]
 gi|331012679|gb|EGH92735.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           syringae pv. tabaci ATCC 11528]
 gi|331019229|gb|EGH99285.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           syringae pv. lachrymans str. M302278PT]
 gi|331025578|gb|EGI05634.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           syringae pv. oryzae str. 1_6]
          Length = 213

 Score =  263 bits (672), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 117/192 (60%), Positives = 154/192 (80%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMV+EQ+ RGER+YDIYSRLLKER++F+ G +ED+MA LI AQLLFLEAENP K+I 
Sbjct: 18  GLVPMVIEQSARGERAYDIYSRLLKERVIFMVGPVEDYMANLIAAQLLFLEAENPDKDIH 77

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQA SMG+ LL+ G +G R  LPN+R++
Sbjct: 78  LYINSPGGSVTAGMSIYDTMQFIKPDVSTICIGQACSMGAFLLAGGAEGKRHCLPNSRMM 137

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI+ HA++I+ I+ RLN +   + G++ E +E+  +RD+ MSA  A 
Sbjct: 138 IHQPLGGFQGQASDIDIHAKEILHIRHRLNSLLAHHTGQSLETIERDTERDNFMSAERAA 197

Query: 197 DWGVVDKVLMSR 208
           ++G++D V+  R
Sbjct: 198 EYGLIDSVINKR 209


>gi|317050717|ref|YP_004111833.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Desulfurispirillum indicum S5]
 gi|316945801|gb|ADU65277.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Desulfurispirillum indicum S5]
          Length = 196

 Score =  263 bits (672), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 120/191 (62%), Positives = 160/191 (83%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+VVEQT RGERSYDIYSRLLK+RIVF+  QI+D ++ +I AQLLFLEAE+P+K+I L
Sbjct: 3   LVPIVVEQTARGERSYDIYSRLLKDRIVFLGTQIDDQISNVIIAQLLFLEAEDPEKDIFL 62

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVTAGMAIYDTMQ+I+P +ST C+GQAASMG++LL+AGEKG RFALP++RI++
Sbjct: 63  YINSPGGVVTAGMAIYDTMQYIRPKVSTICVGQAASMGAVLLAAGEKGKRFALPHSRIMI 122

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG  GQA+DIE  A++I++IK  LN+I V++ G   E++++  DRD  M+  +A  
Sbjct: 123 HQPLGGAQGQATDIEIQAREILRIKEMLNDILVRHTGADLEKIQRDTDRDFFMTGEQARA 182

Query: 198 WGVVDKVLMSR 208
           +G++D+V+ SR
Sbjct: 183 YGIIDEVIQSR 193


>gi|194859835|ref|XP_001969460.1| GG10114 [Drosophila erecta]
 gi|190661327|gb|EDV58519.1| GG10114 [Drosophila erecta]
          Length = 253

 Score =  263 bits (672), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 121/200 (60%), Positives = 158/200 (79%)

Query: 6   CAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLF 65
           C  + +    + L+PMVVEQT RGER+YDI+SRLLKERI+ + G I D +++ + AQLLF
Sbjct: 17  CVSRANSVRNINLIPMVVEQTGRGERAYDIFSRLLKERIICLMGNITDDISSTVVAQLLF 76

Query: 66  LEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKG 125
           L++EN  K I LYINSPGGVVTAG+AIYDTMQ++KPPI+T+C+GQA SMGSLLL+AG  G
Sbjct: 77  LQSENVNKPIHLYINSPGGVVTAGLAIYDTMQYVKPPIATWCVGQACSMGSLLLAAGAPG 136

Query: 126 MRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD 185
           MR++LPNARI++HQPSGG  GQA+DI  HA++I+KIKR+L  IYVK+   TYEE+   ++
Sbjct: 137 MRYSLPNARIMIHQPSGGAQGQATDILIHAEEIIKIKRQLTNIYVKHAKNTYEEMCGRME 196

Query: 186 RDHIMSASEACDWGVVDKVL 205
           RDH M+  EA   G++D VL
Sbjct: 197 RDHFMTPEEAKVLGIIDHVL 216


>gi|60389557|sp|Q6AK59|CLPP_DESPS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
          Length = 203

 Score =  263 bits (672), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 120/197 (60%), Positives = 160/197 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+PMVVEQT RGERSYDIYSRLLKERI+F+   + D +A +I AQLLFLEAE+P+K+I
Sbjct: 1   MNLIPMVVEQTPRGERSYDIYSRLLKERIIFLGSGVNDDVANVIVAQLLFLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           + YINSPGG VTAGMAIYDTMQ+IK  I+T CMGQAASMG++LL+AG  G R+ALPN+RI
Sbjct: 61  TFYINSPGGSVTAGMAIYDTMQYIKCDIATLCMGQAASMGAVLLAAGTAGKRYALPNSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DIE H ++I++I++ LN I   + GKT +++E   +RD+ MS+ EA
Sbjct: 121 MIHQPLGGFQGQATDIEIHTKEILRIRKDLNNILAHHTGKTLKKIESDTERDNFMSSVEA 180

Query: 196 CDWGVVDKVLMSRIDIE 212
             +G++D+VL+ R D+E
Sbjct: 181 QKYGLIDEVLVKREDVE 197


>gi|221215056|ref|ZP_03588023.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           multivorans CGD1]
 gi|221164992|gb|EED97471.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           multivorans CGD1]
          Length = 208

 Score =  263 bits (672), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 119/193 (61%), Positives = 155/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVP+VVE + RGERSYDIYSRLLKER+VF+ G++ D  A L+ AQLLFLE+ENP K+I
Sbjct: 15  LGLVPIVVETSGRGERSYDIYSRLLKERLVFMVGEVNDQTANLVVAQLLFLESENPDKDI 74

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V+AGMAIYDTMQFIKP +ST CMG AASMG+ LL++G KG RFALPN+R+
Sbjct: 75  SLYINSPGGSVSAGMAIYDTMQFIKPDVSTLCMGLAASMGAFLLASGAKGKRFALPNSRV 134

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDIE  A++I+ +K RLN +  ++ G+  E + +  DRD+ MS+ +A
Sbjct: 135 MIHQPLGGARGQASDIEIQAREILYLKERLNHLLAQHTGQDVERIARDTDRDNFMSSEDA 194

Query: 196 CDWGVVDKVLMSR 208
             +G++D+VL+ R
Sbjct: 195 KAYGLIDQVLLKR 207


>gi|198461900|ref|XP_001352265.2| GA18618 [Drosophila pseudoobscura pseudoobscura]
 gi|198142480|gb|EAL29303.2| GA18618 [Drosophila pseudoobscura pseudoobscura]
          Length = 253

 Score =  263 bits (672), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 158/200 (79%)

Query: 6   CAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLF 65
           C    +    + L+PMVVEQT RGER+YDI+SRLLKERI+ + G I D +++ + AQLLF
Sbjct: 17  CVTGTTSSRSINLIPMVVEQTGRGERAYDIFSRLLKERIICLMGNITDDISSTVVAQLLF 76

Query: 66  LEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKG 125
           L++EN  K I LYINSPGGVVTAG+AIYDTMQ++KPPI+T+C+GQA SMGSLLL+AG  G
Sbjct: 77  LQSENVNKPIHLYINSPGGVVTAGLAIYDTMQYVKPPIATWCVGQACSMGSLLLAAGAPG 136

Query: 126 MRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD 185
           MR++LPNARI++HQPSGG  GQA+DI  HA++I+KIKR+L  IYVK+   +YEE+ + ++
Sbjct: 137 MRYSLPNARIMIHQPSGGAQGQATDILIHAEEIIKIKRQLTSIYVKHAKNSYEEMCQRME 196

Query: 186 RDHIMSASEACDWGVVDKVL 205
           RDH M+  EA   G++D VL
Sbjct: 197 RDHFMTPDEAKVLGIIDHVL 216


>gi|161524522|ref|YP_001579534.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           multivorans ATCC 17616]
 gi|189350722|ref|YP_001946350.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           multivorans ATCC 17616]
 gi|221198217|ref|ZP_03571263.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           multivorans CGD2M]
 gi|221209201|ref|ZP_03582193.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           multivorans CGD2]
 gi|254252156|ref|ZP_04945474.1| Peptidase S14 [Burkholderia dolosa AUO158]
 gi|124894765|gb|EAY68645.1| Peptidase S14 [Burkholderia dolosa AUO158]
 gi|160341951|gb|ABX15037.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           multivorans ATCC 17616]
 gi|189334744|dbj|BAG43814.1| ATP-dependent Clp protease [Burkholderia multivorans ATCC 17616]
 gi|221170939|gb|EEE03394.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           multivorans CGD2]
 gi|221182149|gb|EEE14550.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           multivorans CGD2M]
 gi|325518991|gb|EGC98514.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia sp.
           TJI49]
          Length = 217

 Score =  263 bits (672), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 119/193 (61%), Positives = 155/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVP+VVE + RGERSYDIYSRLLKER+VF+ G++ D  A L+ AQLLFLE+ENP K+I
Sbjct: 24  LGLVPIVVETSGRGERSYDIYSRLLKERLVFMVGEVNDQTANLVVAQLLFLESENPDKDI 83

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V+AGMAIYDTMQFIKP +ST CMG AASMG+ LL++G KG RFALPN+R+
Sbjct: 84  SLYINSPGGSVSAGMAIYDTMQFIKPDVSTLCMGLAASMGAFLLASGAKGKRFALPNSRV 143

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDIE  A++I+ +K RLN +  ++ G+  E + +  DRD+ MS+ +A
Sbjct: 144 MIHQPLGGARGQASDIEIQAREILYLKERLNHLLAQHTGQDVERIARDTDRDNFMSSEDA 203

Query: 196 CDWGVVDKVLMSR 208
             +G++D+VL+ R
Sbjct: 204 KAYGLIDQVLLKR 216


>gi|322418659|ref|YP_004197882.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Geobacter sp.
           M18]
 gi|320125046|gb|ADW12606.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Geobacter sp.
           M18]
          Length = 199

 Score =  263 bits (672), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 117/192 (60%), Positives = 158/192 (82%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+VVEQT RGERSYDIYSRLLK+RI+F+ G I+D++A L+ AQLLFLEAE+P K+I L
Sbjct: 2   LVPIVVEQTGRGERSYDIYSRLLKDRIIFLGGGIDDNVANLVIAQLLFLEAEDPDKDIHL 61

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVTAGMAIYDTM++IK P+ST C+GQAASMG+ LLS GEKG RF+L N+RI++
Sbjct: 62  YINSPGGVVTAGMAIYDTMRYIKAPVSTICIGQAASMGAFLLSGGEKGKRFSLANSRIMI 121

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQA+DI  HA++I+++K +LNE+  ++ G+++E+V    +RD+ MS  EA  
Sbjct: 122 HQPLGGFQGQATDIHIHAKEILRMKDQLNELLAEHTGQSFEKVAADTERDYFMSGEEAKS 181

Query: 198 WGVVDKVLMSRI 209
           +G++D ++   +
Sbjct: 182 YGIIDAIVTRNV 193


>gi|195473623|ref|XP_002089092.1| GE18928 [Drosophila yakuba]
 gi|194175193|gb|EDW88804.1| GE18928 [Drosophila yakuba]
          Length = 253

 Score =  263 bits (672), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 121/200 (60%), Positives = 158/200 (79%)

Query: 6   CAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLF 65
           C  + +    + L+PMVVEQT RGER+YDI+SRLLKERI+ + G I D +++ + AQLLF
Sbjct: 17  CGSRANSVRNINLIPMVVEQTGRGERAYDIFSRLLKERIICLMGNITDDISSTVVAQLLF 76

Query: 66  LEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKG 125
           L++EN  K I LYINSPGGVVTAG+AIYDTMQ++KPPI+T+C+GQA SMGSLLL+AG  G
Sbjct: 77  LQSENVNKPIHLYINSPGGVVTAGLAIYDTMQYVKPPIATWCVGQACSMGSLLLAAGAPG 136

Query: 126 MRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD 185
           MR++LPNARI++HQPSGG  GQA+DI  HA++I+KIKR+L  IYVK+   TYEE+   ++
Sbjct: 137 MRYSLPNARIMIHQPSGGAQGQATDILIHAEEIIKIKRQLTNIYVKHAKNTYEEMCGRME 196

Query: 186 RDHIMSASEACDWGVVDKVL 205
           RDH M+  EA   G++D VL
Sbjct: 197 RDHFMTPEEAKVLGIIDHVL 216


>gi|152978444|ref|YP_001344073.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           succinogenes 130Z]
 gi|171704240|sp|A6VME1|CLPP_ACTSZ RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|150840167|gb|ABR74138.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Actinobacillus succinogenes 130Z]
          Length = 194

 Score =  263 bits (672), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/193 (64%), Positives = 159/193 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMV+EQT+RGERSYDIYSRLLKER++F++G++ED+MA LI AQLLFLE+E+P K+I
Sbjct: 1   MALVPMVIEQTSRGERSYDIYSRLLKERVIFLSGEVEDNMANLIVAQLLFLESEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           +LYINSPGG VTAGMAIYDTMQFIKP + T C+GQA SMG+ LL+ G  G R ALPNAR+
Sbjct: 61  NLYINSPGGSVTAGMAIYDTMQFIKPDVRTLCIGQACSMGAFLLAGGAAGKRAALPNARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI+ HAQ+I+KIK  LNE    + G+  E++EK  DRD+ MSA EA
Sbjct: 121 MIHQPLGGFRGQASDIQIHAQEILKIKHTLNERLAFHSGQPLEQIEKDTDRDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++D VL+ R
Sbjct: 181 QNYGLIDSVLVKR 193


>gi|163857103|ref|YP_001631401.1| ATP-dependent Clp protease proteolytic subunit [Bordetella petrii
           DSM 12804]
 gi|226706441|sp|A9IR54|CLPP_BORPD RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|163260831|emb|CAP43133.1| ATP-dependent Clp protease proteolytic subunit [Bordetella petrii]
          Length = 217

 Score =  263 bits (672), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 119/193 (61%), Positives = 153/193 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG +PMV+EQ+ RGER+YDIYSRLL+ER++F+ G + D+ A LI AQLLFLE+ENP K+I
Sbjct: 22  LGYIPMVIEQSGRGERAYDIYSRLLRERLIFLVGPVNDNTANLIVAQLLFLESENPDKDI 81

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V AGMAIYDTMQF+KP +ST C G AASMG+ LL+AG+KG RF LPN+RI
Sbjct: 82  SLYINSPGGSVYAGMAIYDTMQFVKPDVSTLCTGLAASMGAFLLAAGKKGKRFTLPNSRI 141

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQASDI+  A++I+ ++ RLN I  +N G+  E +    +RD+ MSA +A
Sbjct: 142 MIHQPSGGAQGQASDIQIQAREILDLRERLNRILAENTGQPVERIAVDTERDNFMSAEDA 201

Query: 196 CDWGVVDKVLMSR 208
             +G+VDKVL SR
Sbjct: 202 VSYGLVDKVLASR 214


>gi|317407024|gb|EFV87052.1| ATP-dependent Clp protease proteolytic subunit [Achromobacter
           xylosoxidans C54]
          Length = 201

 Score =  263 bits (671), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 116/191 (60%), Positives = 156/191 (81%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQ+ RGERS+DIYSRLL+ERI+F++G++ D ++ L+CAQLLFLEAENP K I +
Sbjct: 7   LVPMVVEQSGRGERSFDIYSRLLRERIIFLSGEVNDAVSALVCAQLLFLEAENPGKPIHM 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGV+T+G+A+YDTMQFIK P+ T CMG A SMGS LL AGE G R AL NA + +
Sbjct: 67  YINSPGGVITSGLAMYDTMQFIKSPVHTLCMGTARSMGSFLLMAGEPGKRAALANASLHV 126

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQASD+  HA+++ + K+R+  +Y ++CG++YE+VE++LDRD  M+A EA +
Sbjct: 127 HQPLGGFQGQASDMLIHAEEMQRTKQRIIRLYAEHCGRSYEDVERSLDRDRYMTAEEAVE 186

Query: 198 WGVVDKVLMSR 208
           WG++D V+ +R
Sbjct: 187 WGLIDHVMDAR 197


>gi|325479715|gb|EGC82805.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 197

 Score =  263 bits (671), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 158/191 (82%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP VVEQTNRGER+YDIYSRLLK+RI+F++G++ D ++ +I AQLLFLE+E+P K+I  
Sbjct: 7   LVPTVVEQTNRGERAYDIYSRLLKDRIIFLSGEVRDEISDIIIAQLLFLESEDPDKDIQF 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G+AIYDTM +IKP +ST C+GQAASM ++LLS+G KG RF+LP++ I++
Sbjct: 67  YINSPGGVVTSGLAIYDTMNYIKPDVSTICIGQAASMAAVLLSSGAKGKRFSLPSSNIMI 126

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGG  GQASDI   A+ I+KIK RLN+I   N G++ +++EK  DRD  MSA+EA +
Sbjct: 127 HQPSGGAQGQASDIVIQAEQIIKIKERLNKILSDNTGQSLKKIEKDTDRDFAMSAAEALE 186

Query: 198 WGVVDKVLMSR 208
           +G++DKV+ S+
Sbjct: 187 YGLIDKVIESK 197


>gi|78043074|ref|YP_359188.1| ATP-dependent Clp protease proteolytic subunit [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|90101405|sp|Q3AF96|CLPP_CARHZ RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|77995189|gb|ABB14088.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Carboxydothermus hydrogenoformans Z-2901]
          Length = 195

 Score =  263 bits (671), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 116/191 (60%), Positives = 161/191 (84%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+V+EQT+RGERSYDI+SRLLK+R +F+ G I+DH+A L+ AQ+LFLEAE+P+K+I L
Sbjct: 4   LVPIVIEQTSRGERSYDIWSRLLKDRTIFIGGPIDDHVANLVIAQMLFLEAEDPEKDIHL 63

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGV+TAGMAIYDTMQ+IKP +ST C+GQAASMG+ LL+AG KG RF+LP ARI++
Sbjct: 64  YINSPGGVITAGMAIYDTMQYIKPDVSTICIGQAASMGAFLLAAGAKGKRFSLPYARIMI 123

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG  GQA+DI+ HA++I++++  LNE+  K+ G+  E++E+  +RD  MSA+EA +
Sbjct: 124 HQPLGGVQGQATDIDIHAREILRMRDMLNELLTKHTGQPKEKIERDTERDFFMSAAEAKE 183

Query: 198 WGVVDKVLMSR 208
           +G++D+V+  R
Sbjct: 184 YGIIDEVITVR 194


>gi|30248062|ref|NP_840132.1| Clp protease [Nitrosomonas europaea ATCC 19718]
 gi|60389763|sp|Q82Y57|CLPP_NITEU RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|30179947|emb|CAD83942.1| Clp protease [Nitrosomonas europaea ATCC 19718]
          Length = 214

 Score =  263 bits (671), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 117/193 (60%), Positives = 156/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGL+PMV+E + RGER+YDIYSRLL+ERI+F+ G + +  A L+ AQLLFLE+EN +K+I
Sbjct: 17  LGLIPMVIETSGRGERAYDIYSRLLRERIIFLVGPVTETSANLVIAQLLFLESENSEKDI 76

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG+VTAG+A+YDT+QFIKP +ST C+GQAASMG+ LL+AG KG R+ LPN+R+
Sbjct: 77  FLYINSPGGLVTAGLAVYDTIQFIKPDVSTLCVGQAASMGAFLLTAGAKGKRYCLPNSRV 136

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDIE HA++I+ +K RLNEI  K+ G+T + +E+  DRD+ + A  A
Sbjct: 137 MIHQPLGGFQGQASDIEIHAKEILALKSRLNEIMAKHTGQTVKAIERDTDRDNFLGAEAA 196

Query: 196 CDWGVVDKVLMSR 208
             +G+VD VL SR
Sbjct: 197 VKYGLVDAVLTSR 209


>gi|163781838|ref|ZP_02176838.1| ATP-dependent Clp protease proteolytic subunit [Hydrogenivirga sp.
           128-5-R1-1]
 gi|159883058|gb|EDP76562.1| ATP-dependent Clp protease proteolytic subunit [Hydrogenivirga sp.
           128-5-R1-1]
          Length = 201

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 162/199 (81%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           D ++V   LVP+V+EQT RGER+YDIYSRLL++RIV +   I+DH+A LI AQLLFLE++
Sbjct: 2   DIKEVTNQLVPIVIEQTPRGERAYDIYSRLLQDRIVLLGFPIDDHVANLIVAQLLFLESQ 61

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           +P K+I LYINSPGG VTAGMA+YDTMQ+IKP + T C+GQAASMG++LL+AG KG R+A
Sbjct: 62  DPDKDIYLYINSPGGSVTAGMAVYDTMQYIKPDVVTICIGQAASMGAVLLAAGAKGKRYA 121

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LP++RI++HQP GG  GQA+DI  HA++I +IKR LNEI  K+ G+  E++EK ++RD+ 
Sbjct: 122 LPHSRIMIHQPLGGIQGQATDIIIHAEEIKRIKRMLNEILAKHTGQDLEKIEKDVERDYF 181

Query: 190 MSASEACDWGVVDKVLMSR 208
           MSA EA D+GV+DKV+  R
Sbjct: 182 MSAEEAKDYGVIDKVIEKR 200


>gi|148263972|ref|YP_001230678.1| ATP-dependent Clp protease proteolytic subunit [Geobacter
           uraniireducens Rf4]
 gi|189082459|sp|A5GFA0|CLPP_GEOUR RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|146397472|gb|ABQ26105.1| ATP-dependent Clp protease proteolytic subunit ClpP [Geobacter
           uraniireducens Rf4]
          Length = 199

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 157/188 (83%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+VVEQT RGERSYDIYSRLLK+RIVF+ G I+D ++ L+ AQLLFLEAE+P K+I L
Sbjct: 2   LVPIVVEQTGRGERSYDIYSRLLKDRIVFLGGAIDDAISNLVIAQLLFLEAEDPDKDIHL 61

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVTAGMAIYDTM++IK P+ST C+GQAASMG+ LLS GEKG RF+L N+RI++
Sbjct: 62  YINSPGGVVTAGMAIYDTMRYIKAPVSTICVGQAASMGAFLLSGGEKGKRFSLTNSRIMI 121

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQA+DI  HAQ+I+++K++LNE+  ++ G+  E++E   +RD+ MS  +A +
Sbjct: 122 HQPLGGFQGQATDIHIHAQEILRMKKKLNELMAEHTGQPVEKLEADTERDYFMSGEDAKN 181

Query: 198 WGVVDKVL 205
           +G++D ++
Sbjct: 182 YGIIDSII 189


>gi|294788594|ref|ZP_06753836.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Simonsiella
           muelleri ATCC 29453]
 gi|294483471|gb|EFG31156.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Simonsiella
           muelleri ATCC 29453]
          Length = 206

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 155/193 (80%), Gaps = 2/193 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           L+P V+EQ+ RGER++DIYSRLLKERI+F+ G + DH A L+ AQLLFLE+ENP K+I  
Sbjct: 10  LIPTVIEQSGRGERAFDIYSRLLKERIIFLVGPVNDHTANLVVAQLLFLESENPDKDIYF 69

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG V+AGM+I+DTM FIKP + T C+GQAASMG+ LLSAG KG RFALPN+RI++
Sbjct: 70  YINSPGGSVSAGMSIFDTMNFIKPDVQTLCLGQAASMGAFLLSAGAKGKRFALPNSRIMI 129

Query: 138 HQP--SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP  SGG  GQASDIE HA++++K+K +LN +  K+ G+  E++E+  DRD+ MSA  A
Sbjct: 130 HQPLISGGLGGQASDIEIHARELIKLKEKLNNLLAKHTGQPLEKIERDTDRDNFMSAQTA 189

Query: 196 CDWGVVDKVLMSR 208
            ++G++DKV+ +R
Sbjct: 190 MEYGLIDKVITNR 202


>gi|264677387|ref|YP_003277293.1| ATP-dependent Clp protease proteolytic subunit [Comamonas
           testosteroni CNB-2]
 gi|299533085|ref|ZP_07046471.1| ATP-dependent Clp protease, proteolytic subunit [Comamonas
           testosteroni S44]
 gi|262207899|gb|ACY31997.1| ATP-dependent Clp protease, proteolytic subunit [Comamonas
           testosteroni CNB-2]
 gi|298718970|gb|EFI59941.1| ATP-dependent Clp protease, proteolytic subunit [Comamonas
           testosteroni S44]
          Length = 202

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 155/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG+VPMV+EQ+ RGERSYDIYSRLLKER++F+ G++ D  A L+ AQLLFLE+ENP K+I
Sbjct: 9   LGMVPMVIEQSGRGERSYDIYSRLLKERVIFLVGEVNDQTANLVVAQLLFLESENPDKDI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S YINSPGG VTAGMAI+DTM FIKP +ST C G AASMG+ LLSAG KG R+ALPNA++
Sbjct: 69  SFYINSPGGSVTAGMAIFDTMNFIKPDVSTLCTGMAASMGAFLLSAGAKGKRYALPNAQV 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE HA++I+K + RLN+I  +  G+  E+++   +RD+ +SA EA
Sbjct: 129 MIHQPLGGARGQATEIEIHAREIIKTRERLNKILAERTGQPLEKIQNDTERDYFLSADEA 188

Query: 196 CDWGVVDKVLMSR 208
            ++G+VD+V+  R
Sbjct: 189 KEYGLVDQVISKR 201


>gi|284047883|ref|YP_003398222.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Acidaminococcus fermentans DSM 20731]
 gi|283952104|gb|ADB46907.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Acidaminococcus fermentans DSM 20731]
          Length = 197

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 159/190 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +  VP+VVEQT++GERSYDIYSRLLK+RI+FVTG+IEDHMA LI AQLLFLE+E+P K++
Sbjct: 1   MSYVPIVVEQTSKGERSYDIYSRLLKDRIIFVTGEIEDHMANLIIAQLLFLESEDPDKDV 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG V+AG+AIYDTMQ+I+P +ST C+G AASM S+LL+AG KG R+ALP++R+
Sbjct: 61  HLYINSPGGSVSAGLAIYDTMQYIRPDVSTICVGMAASMASVLLAAGTKGKRYALPHSRV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DIE HA++I++I+  +N+I   + G+T E++    +RDH M+A EA
Sbjct: 121 MIHQPLGGAQGQATDIEIHAREILRIREEMNQILASHTGQTPEQIRLDTERDHFMTAEEA 180

Query: 196 CDWGVVDKVL 205
            ++G++D+V+
Sbjct: 181 ANYGLIDQVV 190


>gi|90407420|ref|ZP_01215604.1| ATP-dependent Clp protease proteolytic subunit [Psychromonas sp.
           CNPT3]
 gi|90311451|gb|EAS39552.1| ATP-dependent Clp protease proteolytic subunit [Psychromonas sp.
           CNPT3]
          Length = 207

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 154/191 (80%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           L+PMVVEQT +GERSYDIYSRLLKER++F+TGQ+ED MA +I AQLLFLE+E+P+K+IS+
Sbjct: 16  LIPMVVEQTAKGERSYDIYSRLLKERVIFLTGQVEDQMANVITAQLLFLESESPEKDISI 75

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG ++AGMAIYDTMQFIKP +ST CMG AASMG+ LL++G  G R  LPNA++++
Sbjct: 76  YINSPGGSISAGMAIYDTMQFIKPDVSTVCMGMAASMGAFLLASGAPGKRHCLPNAKVMI 135

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQASD E HA++I+  K+ +NE+   + G+  + V K  DRD+ M A+EA +
Sbjct: 136 HQPLGGFQGQASDFEIHAKEILATKKLMNELLAFHTGQDIDVVTKDTDRDNFMRANEALE 195

Query: 198 WGVVDKVLMSR 208
           +G+VD +L  R
Sbjct: 196 YGIVDSILTKR 206


>gi|195578155|ref|XP_002078931.1| GD23683 [Drosophila simulans]
 gi|194190940|gb|EDX04516.1| GD23683 [Drosophila simulans]
          Length = 253

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 121/200 (60%), Positives = 158/200 (79%)

Query: 6   CAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLF 65
           C  + +    + L+PMVVEQT RGER+YDI+SRLLKERI+ + G I D +++ + AQLLF
Sbjct: 17  CGGRANSVRNINLIPMVVEQTGRGERAYDIFSRLLKERIICLMGNITDDISSTVVAQLLF 76

Query: 66  LEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKG 125
           L++EN  K I LYINSPGGVVTAG+AIYDTMQ++KPPI+T+C+GQA SMGSLLL+AG  G
Sbjct: 77  LQSENVNKPIHLYINSPGGVVTAGLAIYDTMQYVKPPIATWCVGQACSMGSLLLAAGAPG 136

Query: 126 MRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD 185
           MR++LPNARI++HQPSGG  GQA+DI  HA++I+KIKR+L  IYVK+   TYEE+   ++
Sbjct: 137 MRYSLPNARIMIHQPSGGAQGQATDILIHAEEIIKIKRQLTNIYVKHAKNTYEEMCGRME 196

Query: 186 RDHIMSASEACDWGVVDKVL 205
           RDH M+  EA   G++D VL
Sbjct: 197 RDHFMTPEEAKVLGIIDHVL 216


>gi|329120061|ref|ZP_08248731.1| ATP-dependent Clp protease, protease subunit [Neisseria
           bacilliformis ATCC BAA-1200]
 gi|327463592|gb|EGF09910.1| ATP-dependent Clp protease, protease subunit [Neisseria
           bacilliformis ATCC BAA-1200]
          Length = 211

 Score =  262 bits (670), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 115/195 (58%), Positives = 158/195 (81%), Gaps = 2/195 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           L+P V+EQ+ RGER++DIYSRLLKERI+F+ G + DH A L+ AQ+LFLE+ENP K+I  
Sbjct: 10  LIPTVIEQSGRGERAFDIYSRLLKERIIFLIGPVNDHTANLVVAQMLFLESENPDKDIFF 69

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+++DTM FIKP +ST C+GQAASMG+ LLSAG KG RFALP++R+++
Sbjct: 70  YINSPGGSVTAGMSVFDTMNFIKPDVSTLCLGQAASMGAFLLSAGAKGKRFALPHSRVMI 129

Query: 138 HQP--SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP  SGG  GQASDIE HA++++K+K+ LNE+  K+ G+  E++E+  DRD+ MSA  A
Sbjct: 130 HQPLISGGLGGQASDIEIHARELIKLKQTLNELLAKHTGQPIEKIERDTDRDNFMSAQAA 189

Query: 196 CDWGVVDKVLMSRID 210
            ++G++D+V+ +R D
Sbjct: 190 KEYGLIDQVIATRAD 204


>gi|195339773|ref|XP_002036491.1| GM18225 [Drosophila sechellia]
 gi|116811667|emb|CAL26000.1| CG5045 [Drosophila simulans]
 gi|194130371|gb|EDW52414.1| GM18225 [Drosophila sechellia]
          Length = 253

 Score =  262 bits (670), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 121/200 (60%), Positives = 158/200 (79%)

Query: 6   CAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLF 65
           C  + +    + L+PMVVEQT RGER+YDI+SRLLKERI+ + G I D +++ + AQLLF
Sbjct: 17  CGGRANSVRNINLIPMVVEQTGRGERAYDIFSRLLKERIICLMGNITDDISSTVVAQLLF 76

Query: 66  LEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKG 125
           L++EN  K I LYINSPGGVVTAG+AIYDTMQ++KPPI+T+C+GQA SMGSLLL+AG  G
Sbjct: 77  LQSENVNKPIHLYINSPGGVVTAGLAIYDTMQYVKPPIATWCVGQACSMGSLLLAAGAPG 136

Query: 126 MRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD 185
           MR++LPNARI++HQPSGG  GQA+DI  HA++I+KIKR+L  IYVK+   TYEE+   ++
Sbjct: 137 MRYSLPNARIMIHQPSGGAQGQATDILIHAEEIIKIKRQLTNIYVKHAKNTYEEMCGRME 196

Query: 186 RDHIMSASEACDWGVVDKVL 205
           RDH M+  EA   G++D VL
Sbjct: 197 RDHFMTPEEAKVLGIIDHVL 216


>gi|116811645|emb|CAL25989.1| CG5045 [Drosophila melanogaster]
 gi|116811649|emb|CAL25991.1| CG5045 [Drosophila melanogaster]
 gi|116811651|emb|CAL25992.1| CG5045 [Drosophila melanogaster]
 gi|116811653|emb|CAL25993.1| CG5045 [Drosophila melanogaster]
 gi|116811655|emb|CAL25994.1| CG5045 [Drosophila melanogaster]
 gi|116811657|emb|CAL25995.1| CG5045 [Drosophila melanogaster]
 gi|116811659|emb|CAL25996.1| CG5045 [Drosophila melanogaster]
 gi|116811661|emb|CAL25997.1| CG5045 [Drosophila melanogaster]
 gi|116811663|emb|CAL25998.1| CG5045 [Drosophila melanogaster]
 gi|116811665|emb|CAL25999.1| CG5045 [Drosophila melanogaster]
 gi|223966785|emb|CAR93129.1| CG5045-PA [Drosophila melanogaster]
 gi|223966787|emb|CAR93130.1| CG5045-PA [Drosophila melanogaster]
 gi|223966789|emb|CAR93131.1| CG5045-PA [Drosophila melanogaster]
 gi|223966791|emb|CAR93132.1| CG5045-PA [Drosophila melanogaster]
 gi|223966795|emb|CAR93134.1| CG5045-PA [Drosophila melanogaster]
 gi|223966797|emb|CAR93135.1| CG5045-PA [Drosophila melanogaster]
 gi|223966799|emb|CAR93136.1| CG5045-PA [Drosophila melanogaster]
 gi|223966801|emb|CAR93137.1| CG5045-PA [Drosophila melanogaster]
 gi|223966803|emb|CAR93138.1| CG5045-PA [Drosophila melanogaster]
          Length = 253

 Score =  262 bits (670), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 121/200 (60%), Positives = 158/200 (79%)

Query: 6   CAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLF 65
           C  + +    + L+PMVVEQT RGER+YDI+SRLLKERI+ + G I D +++ + AQLLF
Sbjct: 17  CGGRANSVRNINLIPMVVEQTGRGERAYDIFSRLLKERIICLMGNITDDISSTVVAQLLF 76

Query: 66  LEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKG 125
           L++EN  K I LYINSPGGVVTAG+AIYDTMQ++KPPI+T+C+GQA SMGSLLL+AG  G
Sbjct: 77  LQSENVNKPIHLYINSPGGVVTAGLAIYDTMQYVKPPIATWCVGQACSMGSLLLAAGAPG 136

Query: 126 MRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD 185
           MR++LPNARI++HQPSGG  GQA+DI  HA++I+KIKR+L  IYVK+   TYEE+   ++
Sbjct: 137 MRYSLPNARIMIHQPSGGAQGQATDILIHAEEIIKIKRQLTNIYVKHAKNTYEEMCGRME 196

Query: 186 RDHIMSASEACDWGVVDKVL 205
           RDH M+  EA   G++D VL
Sbjct: 197 RDHFMTPEEAKVLGIIDHVL 216


>gi|119945201|ref|YP_942881.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Psychromonas
           ingrahamii 37]
 gi|259585963|sp|A1SUW7|CLPP_PSYIN RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|119863805|gb|ABM03282.1| ATP-dependent Clp protease proteolytic subunit ClpP [Psychromonas
           ingrahamii 37]
          Length = 207

 Score =  262 bits (670), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 157/199 (78%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           +++ +   L+PMVVEQT +GERSYDIYSRLLKER++F+TG +EDH+A +I AQLLFLE+E
Sbjct: 8   NTDPISNALIPMVVEQTAKGERSYDIYSRLLKERVIFLTGPVEDHVANVIAAQLLFLESE 67

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           +P+K+I +YINSPGG ++AGMAIYDTMQFIKP +ST CMG AASMG+ LL++G  G R  
Sbjct: 68  SPEKDIFIYINSPGGSISAGMAIYDTMQFIKPDVSTVCMGMAASMGAFLLASGAPGKRHC 127

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPNA++++HQP GGF GQASD E HA++I+  K R+NE+   + GK  E + +  DRD+ 
Sbjct: 128 LPNAKVMIHQPLGGFQGQASDFEIHAKEILATKHRMNELLAFHTGKDIEIIAQDTDRDNF 187

Query: 190 MSASEACDWGVVDKVLMSR 208
           M ASEA ++G+VD VL  R
Sbjct: 188 MRASEAVEYGIVDSVLTHR 206


>gi|326502578|dbj|BAJ95352.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326506866|dbj|BAJ91474.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 300

 Score =  262 bits (670), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 120/192 (62%), Positives = 159/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMVVE T+RGER+YDI+SRLLKERIV + G I D  A+L+ AQLLFLE+ENP K IS
Sbjct: 71  GLVPMVVETTSRGERAYDIFSRLLKERIVCIHGPIADETASLVVAQLLFLESENPLKPIS 130

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGVVTAG+AIYDTMQ+I+ P++T C+GQAASMGSLLL+AG +G R ALPNAR++
Sbjct: 131 LYINSPGGVVTAGLAIYDTMQYIRCPVNTICIGQAASMGSLLLAAGARGERRALPNARVM 190

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG  GQA+DI   A++I+K++ RLN+IY K+ G+  +++E+ ++RD  M   EA 
Sbjct: 191 IHQPSGGAQGQATDIAIQAKEILKLRDRLNKIYAKHTGQNIDKIEQCMERDLFMDPEEAR 250

Query: 197 DWGVVDKVLMSR 208
           +WG++D+V+ +R
Sbjct: 251 EWGLIDEVIENR 262


>gi|116811647|emb|CAL25990.1| CG5045 [Drosophila melanogaster]
          Length = 253

 Score =  262 bits (670), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 121/200 (60%), Positives = 158/200 (79%)

Query: 6   CAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLF 65
           C  + +    + L+PMVVEQT RGER+YDI+SRLLKERI+ + G I D +++ + AQLLF
Sbjct: 17  CGGRANSVRNINLIPMVVEQTGRGERAYDIFSRLLKERIICLMGNITDDISSTVVAQLLF 76

Query: 66  LEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKG 125
           L++EN  K I LYINSPGGVVTAG+AIYDTMQ++KPPI+T+C+GQA SMGSLLL+AG  G
Sbjct: 77  LQSENVNKPIHLYINSPGGVVTAGLAIYDTMQYVKPPIATWCVGQACSMGSLLLAAGAPG 136

Query: 126 MRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD 185
           MR++LPNARI++HQPSGG  GQA+DI  HA++I+KIKR+L  IYVK+   TYEE+   ++
Sbjct: 137 MRYSLPNARIMIHQPSGGAQGQATDILIHAEEIIKIKRQLTNIYVKHAKNTYEEMCGRME 196

Query: 186 RDHIMSASEACDWGVVDKVL 205
           RDH M+  EA   G++D VL
Sbjct: 197 RDHFMTPEEAKVLGIIDHVL 216


>gi|326492708|dbj|BAJ90210.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 285

 Score =  262 bits (670), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 120/192 (62%), Positives = 159/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMVVE T+RGER+YDI+SRLLKERIV + G I D  A+L+ AQLLFLE+ENP K IS
Sbjct: 56  GLVPMVVETTSRGERAYDIFSRLLKERIVCIHGPIADETASLVVAQLLFLESENPLKPIS 115

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGVVTAG+AIYDTMQ+I+ P++T C+GQAASMGSLLL+AG +G R ALPNAR++
Sbjct: 116 LYINSPGGVVTAGLAIYDTMQYIRCPVNTICIGQAASMGSLLLAAGARGERRALPNARVM 175

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG  GQA+DI   A++I+K++ RLN+IY K+ G+  +++E+ ++RD  M   EA 
Sbjct: 176 IHQPSGGAQGQATDIAIQAKEILKLRDRLNKIYAKHTGQNIDKIEQCMERDLFMDPEEAR 235

Query: 197 DWGVVDKVLMSR 208
           +WG++D+V+ +R
Sbjct: 236 EWGLIDEVIENR 247


>gi|167855227|ref|ZP_02477997.1| bifunctional indole-3-glycerol phosphate
           synthase/phosphoribosylanthranilate isomerase
           [Haemophilus parasuis 29755]
 gi|167853680|gb|EDS24924.1| bifunctional indole-3-glycerol phosphate
           synthase/phosphoribosylanthranilate isomerase
           [Haemophilus parasuis 29755]
          Length = 193

 Score =  262 bits (670), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 117/193 (60%), Positives = 157/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++PMVVEQ+++GER+YDIYSRLLKERI+F+ G +ED MA LI AQ+LFLEAE+P+K+I
Sbjct: 1   MAVIPMVVEQSSKGERAYDIYSRLLKERIIFLNGGVEDEMAKLIIAQMLFLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGVVTAG+AIYDTM FIKP +ST CMGQA SMG+ LLS+G KG RFALPN+R+
Sbjct: 61  YLYINSPGGVVTAGLAIYDTMNFIKPDVSTLCMGQACSMGAFLLSSGAKGKRFALPNSRV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG+ GQA+DI+ HAQ+I+K+K  L     ++C + +E+V +  +RD+ MSA EA
Sbjct: 121 MIHQPLGGYRGQATDIQIHAQEILKLKEMLTRKMAEHCSQPFEKVAQDTERDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G++D V+  R
Sbjct: 181 KAYGLIDDVVTKR 193


>gi|326519674|dbj|BAK00210.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 256

 Score =  262 bits (670), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 120/192 (62%), Positives = 155/192 (80%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMV+E T+RGER+YDI+SRLLKERIV + G I D  A+L+ AQLLFLE+ENP K I 
Sbjct: 30  GLVPMVIEHTSRGERAYDIFSRLLKERIVCIHGPIADDTASLVVAQLLFLESENPAKPIH 89

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGVVTAG+AIYDTMQ+I+ P++T C+GQAASMGSLLL+AG  G R ALPNAR++
Sbjct: 90  LYINSPGGVVTAGLAIYDTMQYIRSPVTTLCIGQAASMGSLLLAAGAPGERRALPNARVM 149

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG SGQASDI   A++I+K++ RLN+IY K+ G+  + +E+ ++RD  M   EA 
Sbjct: 150 IHQPSGGASGQASDIAIQAKEILKVRDRLNKIYAKHTGQAIDRIEQCMERDMFMDPVEAH 209

Query: 197 DWGVVDKVLMSR 208
            WG++D+V+  R
Sbjct: 210 AWGLIDEVIEHR 221


>gi|303248988|ref|ZP_07335234.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Desulfovibrio
           fructosovorans JJ]
 gi|302489637|gb|EFL49575.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Desulfovibrio
           fructosovorans JJ]
          Length = 204

 Score =  262 bits (669), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 117/190 (61%), Positives = 155/190 (81%)

Query: 19  VPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLY 78
           VP+V+E T R ER+YDIYSRLLK+RI+ +   ++D++A LICAQLLFLE+E+P+KEISLY
Sbjct: 4   VPIVIETTGRSERAYDIYSRLLKDRIILLGSAVDDYVANLICAQLLFLESEDPEKEISLY 63

Query: 79  INSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLH 138
           INSPGGVV+AG+AIYDTMQ++ PP+ST CMGQAASMG+LLL AG  G R+ALP++RI++H
Sbjct: 64  INSPGGVVSAGLAIYDTMQYVMPPVSTLCMGQAASMGALLLCAGATGTRYALPHSRIMIH 123

Query: 139 QPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDW 198
           QPSGGF GQA+DIE HA++  + +  LNEI  K+ G+  E+++   +RD+ MSA EA  +
Sbjct: 124 QPSGGFQGQATDIEIHARETRRTREALNEIMAKHTGQPIEKIQVDTERDNFMSAEEAVAY 183

Query: 199 GVVDKVLMSR 208
           G+VDKV  SR
Sbjct: 184 GLVDKVFASR 193


>gi|296134054|ref|YP_003641301.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Thermincola
           sp. JR]
 gi|296032632|gb|ADG83400.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Thermincola
           potens JR]
          Length = 194

 Score =  262 bits (669), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 156/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGER+YDIYSRLLK+RI+F+ G I+D +A L+ AQ+LFLEAE+P K+I
Sbjct: 1   MNLVPIVVEQTNRGERAYDIYSRLLKDRIIFIGGPIDDMVANLVIAQMLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGGVVTAGMAIYDTMQ+IKP +ST CMGQAASMGS LL+AG KG R+ALP  RI
Sbjct: 61  HIYINSPGGVVTAGMAIYDTMQYIKPDVSTICMGQAASMGSFLLAAGTKGKRYALPYTRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI+ HA++I+++K  LNE+  K+ G+  E + +  +RD  MSA EA
Sbjct: 121 MIHQPLGGVQGQATDIDIHAKEILRMKSVLNELLAKHTGQPVEVIARDTERDFFMSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G+VD+V+  R
Sbjct: 181 RKYGIVDEVISVR 193


>gi|308070425|ref|YP_003872030.1| ATP-dependent Clp protease proteolytic subunit (Endopeptidase Clp)
           [Paenibacillus polymyxa E681]
 gi|310643606|ref|YP_003948364.1| ATP-dependent clp protease proteolytic subunit [Paenibacillus
           polymyxa SC2]
 gi|305859704|gb|ADM71492.1| ATP-dependent Clp protease proteolytic subunit (Endopeptidase Clp)
           [Paenibacillus polymyxa E681]
 gi|309248556|gb|ADO58123.1| ATP-dependent Clp protease proteolytic subunit [Paenibacillus
           polymyxa SC2]
          Length = 211

 Score =  262 bits (669), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 122/204 (59%), Positives = 159/204 (77%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            K+   V + LVPMVVEQTNRGERSYDIYSRLLK+RI+F++G I+D +A L+ AQLLFL 
Sbjct: 8   NKEKRLVVMSLVPMVVEQTNRGERSYDIYSRLLKDRIIFLSGPIDDDVANLVIAQLLFLS 67

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AE+P+K+I+LYINSPGG VTAGM IYDTMQFIKP +ST C+G AASMGSLLL+AG  G R
Sbjct: 68  AEDPEKDINLYINSPGGSVTAGMGIYDTMQFIKPDVSTICVGMAASMGSLLLTAGAPGKR 127

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           +AL N+ +++HQP GG  GQASD+  HA  I+K + +LN+IYV+  G+  E++E+  DRD
Sbjct: 128 YALTNSEVMIHQPLGGIQGQASDMLIHADWIIKTRAKLNQIYVERTGQPLEKIERDTDRD 187

Query: 188 HIMSASEACDWGVVDKVLMSRIDI 211
             M A EA  +G++D+VL   I++
Sbjct: 188 FFMEAEEAKAYGIIDQVLSKPINL 211


>gi|239815493|ref|YP_002944403.1| ATP-dependent Clp protease proteolytic subunit [Variovorax
           paradoxus S110]
 gi|259491242|sp|C5CJT4|CLPP_VARPS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|239802070|gb|ACS19137.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Variovorax
           paradoxus S110]
          Length = 202

 Score =  262 bits (669), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 117/193 (60%), Positives = 156/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG++PMV+EQ+ RGERSYDIYSRLLKERI+F+ G++ D  A L+ AQLLFLE+ENP K+I
Sbjct: 9   LGMIPMVIEQSGRGERSYDIYSRLLKERIIFLVGEVNDQTANLVVAQLLFLESENPDKDI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S YINSPGG V+AGMAIYDTMQFIKP +ST C+G AASMG+ LL+AGEKG RF+LPN++I
Sbjct: 69  SFYINSPGGSVSAGMAIYDTMQFIKPDVSTMCIGFAASMGAFLLAAGEKGKRFSLPNSKI 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQ  GG  GQA+DIE HA+DI++ K ++N I  +  G+  E+V+   +RD+ ++A EA
Sbjct: 129 MIHQVLGGARGQATDIEIHARDILRTKDQMNRILAERTGQPLEKVKSDTERDYFLTADEA 188

Query: 196 CDWGVVDKVLMSR 208
            D+G+VD+V+  R
Sbjct: 189 KDYGLVDQVIAKR 201


>gi|33592842|ref|NP_880486.1| ATP-dependent Clp protease proteolytic subunit [Bordetella
           pertussis Tohama I]
 gi|33596622|ref|NP_884265.1| ATP-dependent Clp protease proteolytic subunit [Bordetella
           parapertussis 12822]
 gi|33601237|ref|NP_888797.1| ATP-dependent Clp protease proteolytic subunit [Bordetella
           bronchiseptica RB50]
 gi|67460369|sp|Q7VXI7|CLPP_BORPE RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|67460372|sp|Q7W8X2|CLPP_BORPA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|67460374|sp|Q7WK83|CLPP_BORBR RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|33572490|emb|CAE42062.1| ATP-dependent Clp protease proteolytic subunit [Bordetella
           pertussis Tohama I]
 gi|33573323|emb|CAE37306.1| ATP-dependent Clp protease proteolytic subunit [Bordetella
           parapertussis]
 gi|33575672|emb|CAE32750.1| ATP-dependent Clp protease proteolytic subunit [Bordetella
           bronchiseptica RB50]
          Length = 217

 Score =  262 bits (669), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 152/193 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG +PMV+EQ+ RGER+YDIYSRLL+ER++F+ G + D+ A L+ AQLLFLE+ENP K+I
Sbjct: 22  LGYIPMVIEQSGRGERAYDIYSRLLRERLIFLVGPVNDNTANLVVAQLLFLESENPDKDI 81

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S YINSPGG V AGMAIYDTMQFIKP +ST C G AASMG+ LL+AG+KG RF LPN+RI
Sbjct: 82  SFYINSPGGSVYAGMAIYDTMQFIKPDVSTLCTGLAASMGAFLLAAGKKGKRFTLPNSRI 141

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQASDI+  A++I+ ++ RLN I  +N G+  E +    +RD+ MSA +A
Sbjct: 142 MIHQPSGGAQGQASDIQIQAREILDLRERLNRILAENTGQPVERIAVDTERDNFMSAEDA 201

Query: 196 CDWGVVDKVLMSR 208
             +G+VDKVL SR
Sbjct: 202 VSYGLVDKVLTSR 214


>gi|322515314|ref|ZP_08068311.1| ATP-dependent Clp protease, protease subunit [Actinobacillus ureae
           ATCC 25976]
 gi|322118690|gb|EFX90902.1| ATP-dependent Clp protease, protease subunit [Actinobacillus ureae
           ATCC 25976]
          Length = 217

 Score =  262 bits (669), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 119/193 (61%), Positives = 156/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++PMVVEQT++GERSYDIYSRLLKERI+F+ G++EDHMA LI AQLLFLE+E+P+K+I
Sbjct: 22  MAVIPMVVEQTSKGERSYDIYSRLLKERIIFLNGEVEDHMANLIVAQLLFLESEDPEKDI 81

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGVVTAG+AIYDTM FIKP ++T C GQA SMG+ LLS G KG RFALP+AR+
Sbjct: 82  YLYINSPGGVVTAGLAIYDTMNFIKPDVATLCTGQACSMGAFLLSGGAKGKRFALPHARV 141

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI+  AQ+I+K+K  L +    + G+ +E+V    +RD+ MSA EA
Sbjct: 142 MIHQPLGGARGQATDIQIQAQEILKLKEMLTKRMAGHSGQPFEKVAADTERDNFMSAFEA 201

Query: 196 CDWGVVDKVLMSR 208
            ++G++DKVL  R
Sbjct: 202 AEYGLIDKVLTHR 214


>gi|17546430|ref|NP_519832.1| ATP-dependent Clp protease proteolytic subunit [Ralstonia
           solanacearum GMI1000]
 gi|83745913|ref|ZP_00942970.1| ATP-dependent Clp protease proteolytic subunit [Ralstonia
           solanacearum UW551]
 gi|207724193|ref|YP_002254591.1| atp-atp-dependent clp protease proteolytic subunit (endopeptidase
           clp) protein [Ralstonia solanacearum MolK2]
 gi|207743049|ref|YP_002259441.1| atp-atp-dependent clp protease proteolytic subunit (endopeptidase
           clp) protein [Ralstonia solanacearum IPO1609]
 gi|300691404|ref|YP_003752399.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease
           [Ralstonia solanacearum PSI07]
 gi|300703972|ref|YP_003745574.1| proteolytic subunit of clpa-clpp ATP-dependent serine protease
           [Ralstonia solanacearum CFBP2957]
 gi|22653696|sp|Q8XYP7|CLPP_RALSO RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|17428728|emb|CAD15413.1| probable atp-atp-dependent clp protease proteolytic subunit
           (endopeptidase clp). transmembrane protein [Ralstonia
           solanacearum GMI1000]
 gi|83727603|gb|EAP74724.1| ATP-dependent Clp protease proteolytic subunit [Ralstonia
           solanacearum UW551]
 gi|206589403|emb|CAQ36365.1| atp-atp-dependent clp protease proteolytic subunit (endopeptidase
           clp) protein [Ralstonia solanacearum MolK2]
 gi|206594446|emb|CAQ61373.1| atp-atp-dependent clp protease proteolytic subunit (endopeptidase
           clp) protein [Ralstonia solanacearum IPO1609]
 gi|299066731|emb|CBJ37925.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease
           [Ralstonia solanacearum CMR15]
 gi|299071635|emb|CBJ42959.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease
           [Ralstonia solanacearum CFBP2957]
 gi|299078464|emb|CBJ51116.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease
           [Ralstonia solanacearum PSI07]
          Length = 217

 Score =  262 bits (669), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 117/193 (60%), Positives = 155/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVPMVVEQ+ RGER+YDIYSRLLKER++F+ G++ D  A L+ AQLLFLE+ENP K+I
Sbjct: 23  LGLVPMVVEQSGRGERAYDIYSRLLKERVIFMVGEVNDQTANLVVAQLLFLESENPDKDI 82

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V+AG+A+YDTMQF+KP +ST CMG AASMG+ LL+AG KG R+ALPN+RI
Sbjct: 83  SLYINSPGGSVSAGLAMYDTMQFVKPDVSTLCMGMAASMGAFLLAAGAKGKRYALPNSRI 142

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDIE  A++I+ ++ RLN I  +  G+  +++ +  DRD+ MS  +A
Sbjct: 143 MIHQPLGGARGQASDIEIQAREILYLRERLNTILSEVTGQPVDKIARDTDRDNFMSGDQA 202

Query: 196 CDWGVVDKVLMSR 208
            ++G++DKVL  R
Sbjct: 203 KEYGLIDKVLARR 215


>gi|83644978|ref|YP_433413.1| ATP-dependent Clp protease proteolytic subunit ClpP [Hahella
           chejuensis KCTC 2396]
 gi|83633021|gb|ABC28988.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Hahella
           chejuensis KCTC 2396]
          Length = 213

 Score =  261 bits (668), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 153/194 (78%), Gaps = 1/194 (0%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT RGERSYDIYSRLLKERI+F+ GQ+EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 18  ALVPMVVEQTARGERSYDIYSRLLKERIIFLVGQVEDHMANLVVAQLLFLESENPDKDIH 77

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAG++IYDTMQFIKP +ST C+GQAASMG+LLLS G  G R+ LP++R++
Sbjct: 78  LYINSPGGSVTAGLSIYDTMQFIKPDVSTMCIGQAASMGALLLSGGAAGKRYCLPHSRVM 137

Query: 137 LHQP-SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           +HQP  GG  GQASDIE HA++I+ ++ +LN I  K+ G+  E + +  DRD  M A  A
Sbjct: 138 IHQPLLGGLQGQASDIEIHAKEILLLREKLNNILSKHTGQDIETIARDTDRDKFMDAEMA 197

Query: 196 CDWGVVDKVLMSRI 209
            ++G++D VL  R+
Sbjct: 198 KNYGLIDSVLDKRV 211


>gi|145589117|ref|YP_001155714.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|145047523|gb|ABP34150.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 209

 Score =  261 bits (668), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 155/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVPMV+E + RGER+YDIYSRLL+ER+VF+ G++ D  A L+ AQLLFLE+ENP K+I
Sbjct: 16  LGLVPMVIETSGRGERAYDIYSRLLRERVVFLVGEVNDQTANLVIAQLLFLESENPDKDI 75

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V+AG+AIYDTMQFIKP +ST CMG AASMG+ LL AGEKG R+ALPN+R+
Sbjct: 76  SLYINSPGGSVSAGLAIYDTMQFIKPHVSTLCMGMAASMGAFLLCAGEKGKRYALPNSRV 135

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDIE  A++I+ ++ RLN+I     G++ + + K  DRD+ MSA +A
Sbjct: 136 MIHQPLGGARGQASDIEIQAREILYLRERLNKILADRTGQSIDTIAKDTDRDNFMSAEQA 195

Query: 196 CDWGVVDKVLMSR 208
            ++G++DKV+  R
Sbjct: 196 REYGLIDKVIEKR 208


>gi|115447465|ref|NP_001047512.1| Os02g0634500 [Oryza sativa Japonica Group]
 gi|49388184|dbj|BAD25310.1| unknown protein [Oryza sativa Japonica Group]
 gi|113537043|dbj|BAF09426.1| Os02g0634500 [Oryza sativa Japonica Group]
 gi|215692767|dbj|BAG88235.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 298

 Score =  261 bits (668), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 158/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
            GLVPMV+E T+RGER+YDI+SRLLKERIV + G I D  A+L+ AQLLFLE+ENP K +
Sbjct: 71  FGLVPMVIETTSRGERAYDIFSRLLKERIVLIHGPIADETASLVVAQLLFLESENPLKPV 130

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGVVTAG+AIYDTMQ+I+ P++T C+GQAASMGSLLL+AG +G R ALPNAR+
Sbjct: 131 HLYINSPGGVVTAGLAIYDTMQYIRCPVTTLCIGQAASMGSLLLAAGARGERRALPNARV 190

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA+DI   A++I+K++ RLN+IY K+ G+  +++E+ ++RD  M   EA
Sbjct: 191 MIHQPSGGAQGQATDIAIQAKEILKLRDRLNKIYQKHTGQEIDKIEQCMERDLFMDPEEA 250

Query: 196 CDWGVVDKVLMSR 208
            DWG++D+V+ +R
Sbjct: 251 RDWGLIDEVIENR 263


>gi|315634780|ref|ZP_07890062.1| ATP-dependent Clp protease proteolytic subunit [Aggregatibacter
           segnis ATCC 33393]
 gi|315476332|gb|EFU67082.1| ATP-dependent Clp protease proteolytic subunit [Aggregatibacter
           segnis ATCC 33393]
          Length = 193

 Score =  261 bits (668), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 119/193 (61%), Positives = 157/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++PMVV+QT+RGER+YDIYSRLLK+R++F++G++ED+MA LI AQLLFLE+E+P K+I
Sbjct: 1   MSVIPMVVDQTSRGERAYDIYSRLLKDRVIFLSGEVEDNMANLIVAQLLFLESEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           +LYINSPGG VTAGMAIYDTMQFIKP + T C+GQA SMG+ LL+ G  G R ALP+AR+
Sbjct: 61  NLYINSPGGSVTAGMAIYDTMQFIKPDVRTLCVGQACSMGAFLLAGGAPGKRGALPHARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI+ HAQ+I+KIK  LNE    + G+  E +EK  DRD+ MSA EA
Sbjct: 121 MIHQPLGGFRGQASDIQIHAQEILKIKGTLNERLAFHTGQPIETIEKDTDRDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++D+V   R
Sbjct: 181 KNYGLIDEVFTKR 193


>gi|125582984|gb|EAZ23915.1| hypothetical protein OsJ_07636 [Oryza sativa Japonica Group]
          Length = 318

 Score =  261 bits (668), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 158/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
            GLVPMV+E T+RGER+YDI+SRLLKERIV + G I D  A+L+ AQLLFLE+ENP K +
Sbjct: 71  FGLVPMVIETTSRGERAYDIFSRLLKERIVLIHGPIADETASLVVAQLLFLESENPLKPV 130

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGVVTAG+AIYDTMQ+I+ P++T C+GQAASMGSLLL+AG +G R ALPNAR+
Sbjct: 131 HLYINSPGGVVTAGLAIYDTMQYIRCPVTTLCIGQAASMGSLLLAAGARGERRALPNARV 190

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA+DI   A++I+K++ RLN+IY K+ G+  +++E+ ++RD  M   EA
Sbjct: 191 MIHQPSGGAQGQATDIAIQAKEILKLRDRLNKIYQKHTGQEIDKIEQCMERDLFMDPEEA 250

Query: 196 CDWGVVDKVLMSR 208
            DWG++D+V+ +R
Sbjct: 251 RDWGLIDEVIENR 263


>gi|125540417|gb|EAY86812.1| hypothetical protein OsI_08189 [Oryza sativa Indica Group]
          Length = 318

 Score =  261 bits (668), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 158/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
            GLVPMV+E T+RGER+YDI+SRLLKERIV + G I D  A+L+ AQLLFLE+ENP K +
Sbjct: 71  FGLVPMVIETTSRGERAYDIFSRLLKERIVLIHGPIADETASLVVAQLLFLESENPLKPV 130

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGVVTAG+AIYDTMQ+I+ P++T C+GQAASMGSLLL+AG +G R ALPNAR+
Sbjct: 131 HLYINSPGGVVTAGLAIYDTMQYIRCPVTTLCIGQAASMGSLLLAAGARGERRALPNARV 190

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA+DI   A++I+K++ RLN+IY K+ G+  +++E+ ++RD  M   EA
Sbjct: 191 MIHQPSGGAQGQATDIAIQAKEILKLRDRLNKIYQKHTGQEIDKIEQCMERDLFMDPEEA 250

Query: 196 CDWGVVDKVLMSR 208
            DWG++D+V+ +R
Sbjct: 251 RDWGLIDEVIENR 263


>gi|134300401|ref|YP_001113897.1| ATP-dependent Clp protease proteolytic subunit [Desulfotomaculum
           reducens MI-1]
 gi|172044337|sp|A4J7L9|CLPP_DESRM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|134053101|gb|ABO51072.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Desulfotomaculum reducens MI-1]
          Length = 195

 Score =  261 bits (668), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 157/192 (81%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVP+VVEQTNRGER+YDIYSRLLK+RI+F+ G I+DH+A L+ AQ LFLEAE+P+K+I 
Sbjct: 3   GLVPIVVEQTNRGERAYDIYSRLLKDRIIFIGGPIDDHIANLVIAQFLFLEAEDPEKDIH 62

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGVVTAG+AIYDTMQ+IKP +ST C+GQAASMGS LL+AG  G R+ALP ARI+
Sbjct: 63  LYINSPGGVVTAGLAIYDTMQYIKPAVSTICLGQAASMGSFLLAAGAPGKRYALPMARIM 122

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG  GQA+DI+ HA++I+++K  LN+    + G+  E++ +  +RD+ MSA EA 
Sbjct: 123 IHQPLGGVQGQATDIDIHAKEILRMKDLLNDRLAHHTGQPLEQITRDTERDYFMSAEEAK 182

Query: 197 DWGVVDKVLMSR 208
            +G++D+V+  R
Sbjct: 183 KYGLIDEVMPYR 194


>gi|167562414|ref|ZP_02355330.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           oklahomensis EO147]
 gi|167569597|ref|ZP_02362471.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           oklahomensis C6786]
          Length = 207

 Score =  261 bits (668), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 121/202 (59%), Positives = 157/202 (77%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
           A +D E   LGLVP+VVE + RGERSYDIYSRLLKERIVF+ G++ D  A L+ AQLLFL
Sbjct: 5   APRDFEAQALGLVPIVVETSGRGERSYDIYSRLLKERIVFMVGEVNDQTANLVVAQLLFL 64

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP K+ISLYINSPGG V+AGMAIYDTMQF+KP +ST CMG AASMG+ LL++G KG 
Sbjct: 65  ESENPDKDISLYINSPGGSVSAGMAIYDTMQFVKPDVSTLCMGLAASMGAFLLASGAKGK 124

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R+ALPNAR+++HQP GG  GQASDIE  A++I+ +K RLN +  ++ G+  E + +  DR
Sbjct: 125 RYALPNARVMIHQPLGGARGQASDIEIQAREILYLKDRLNHLLAQHTGQDVERIARDTDR 184

Query: 187 DHIMSASEACDWGVVDKVLMSR 208
           D+ MS+ +A  +G++D V + R
Sbjct: 185 DNFMSSEDAKAYGLIDHVSIKR 206


>gi|94987236|ref|YP_595169.1| protease subunit of ATP-dependent Clp proteases [Lawsonia
           intracellularis PHE/MN1-00]
 gi|116243147|sp|Q1MQ79|CLPP_LAWIP RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|94731485|emb|CAJ54848.1| Protease subunit of ATP-dependent Clp proteases [Lawsonia
           intracellularis PHE/MN1-00]
          Length = 209

 Score =  261 bits (668), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 114/201 (56%), Positives = 167/201 (83%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           +D+F   VP+VVE   R ER+YDIYSRLLK+RIV +  ++ D +A+LICAQLLFLE+++P
Sbjct: 2   DDIFNMTVPIVVENNGRNERAYDIYSRLLKDRIVLLGTEVNDQVASLICAQLLFLESQDP 61

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
           +KEI LYINSPGG VTAG+AIYDTM +I P ++T CMG+AASMG+LLL+AGEK MR+ALP
Sbjct: 62  EKEIYLYINSPGGSVTAGLAIYDTMNYITPNVATVCMGRAASMGALLLAAGEKNMRYALP 121

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+++++HQP GG+ GQA+DI+ HA++I+++++RLNEI ++  G++ E+V +  +RD+ M+
Sbjct: 122 NSQVMIHQPLGGYQGQATDIDIHAREILRMRQRLNEILMEQTGQSLEKVAQDTERDYFMT 181

Query: 192 ASEACDWGVVDKVLMSRIDIE 212
           A +A  +G++DKVL+SR D++
Sbjct: 182 AEDAKAYGLIDKVLVSRKDLD 202


>gi|148652118|ref|YP_001279211.1| ATP-dependent Clp protease proteolytic subunit [Psychrobacter sp.
           PRwf-1]
 gi|148571202|gb|ABQ93261.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Psychrobacter
           sp. PRwf-1]
          Length = 240

 Score =  261 bits (668), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 159/192 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQ+ RGERS+DIYSRLL+ER++F+TGQ+ED+MA LI AQ+LFLEAENP+K+I 
Sbjct: 44  ALVPMVVEQSARGERSFDIYSRLLRERVIFLTGQVEDNMANLIVAQMLFLEAENPEKDIH 103

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG V+AG+A++DTM FIKP +ST CMG A SMGS LL+AG+KG R+AL N+R++
Sbjct: 104 LYINSPGGSVSAGLAMFDTMNFIKPDVSTICMGGAYSMGSFLLAAGQKGKRYALANSRVM 163

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG  GQA+DIE +A++I+KI+ RLN I  +  G+  E++E+ ++RD+ + A EA 
Sbjct: 164 IHQPSGGAQGQATDIEINAREILKIRDRLNRILAERTGQPLEKIERDVERDYWLDAQEAK 223

Query: 197 DWGVVDKVLMSR 208
            +G+VD+VL  R
Sbjct: 224 AYGLVDEVLERR 235


>gi|115311358|sp|Q2SK36|CLPP_HAHCH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
          Length = 204

 Score =  261 bits (668), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 153/194 (78%), Gaps = 1/194 (0%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT RGERSYDIYSRLLKERI+F+ GQ+EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 9   ALVPMVVEQTARGERSYDIYSRLLKERIIFLVGQVEDHMANLVVAQLLFLESENPDKDIH 68

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAG++IYDTMQFIKP +ST C+GQAASMG+LLLS G  G R+ LP++R++
Sbjct: 69  LYINSPGGSVTAGLSIYDTMQFIKPDVSTMCIGQAASMGALLLSGGAAGKRYCLPHSRVM 128

Query: 137 LHQP-SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           +HQP  GG  GQASDIE HA++I+ ++ +LN I  K+ G+  E + +  DRD  M A  A
Sbjct: 129 IHQPLLGGLQGQASDIEIHAKEILLLREKLNNILSKHTGQDIETIARDTDRDKFMDAEMA 188

Query: 196 CDWGVVDKVLMSRI 209
            ++G++D VL  R+
Sbjct: 189 KNYGLIDSVLDKRV 202


>gi|294340353|emb|CAZ88734.1| ATP-dependent Clp protease proteolytic subunit precursor
           (Endopeptidase Clp) (Caseinolytic protease) (Protease
           Ti) (Heat shock protein F21.5) [Thiomonas sp. 3As]
          Length = 202

 Score =  261 bits (668), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 155/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVPMV+EQ+ RGER+YDIYSRLL+ER++F+ G I D MA L+ AQLLFLE+ENP K+I
Sbjct: 9   LGLVPMVIEQSGRGERAYDIYSRLLRERVIFLVGPINDQMANLVVAQLLFLESENPDKDI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V+AGMAI+DTMQFIKP +ST C G AASMG+ L++AG KG R++LPN+RI
Sbjct: 69  SLYINSPGGSVSAGMAIFDTMQFIKPDVSTLCTGIAASMGAFLMAAGAKGKRYSLPNSRI 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA+DIE  A++I+ ++ RLN I  +  G+T E++    +RD  MSA EA
Sbjct: 129 MIHQPSGGAQGQATDIEIQAREILYLRERLNGILAERTGQTLEKIGIDTERDFFMSADEA 188

Query: 196 CDWGVVDKVLMSR 208
            D+G++D+V+  R
Sbjct: 189 KDYGLIDEVISKR 201


>gi|317153552|ref|YP_004121600.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Desulfovibrio
           aespoeensis Aspo-2]
 gi|316943803|gb|ADU62854.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Desulfovibrio
           aespoeensis Aspo-2]
          Length = 202

 Score =  261 bits (668), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 160/198 (80%)

Query: 19  VPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLY 78
           +PMV+E T R ER+YDIYSRLLK+RI+ ++  I+DH+A+LICAQLLFLE+E+P+KEI +Y
Sbjct: 4   IPMVIETTGRTERAYDIYSRLLKDRIILLSSAIDDHVASLICAQLLFLESEDPEKEIYMY 63

Query: 79  INSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLH 138
           INSPGGVV+AGMAIYDTMQ+I  P+ST C+GQAASMG+LLL+AG +GMR+ALP++RI++H
Sbjct: 64  INSPGGVVSAGMAIYDTMQYISAPVSTLCLGQAASMGALLLAAGAQGMRYALPHSRIMIH 123

Query: 139 QPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDW 198
           QP GG  GQASDI  HA++I++++  LN I   + G+  +++    +RD+ MS+ EA  +
Sbjct: 124 QPLGGTQGQASDIHIHAKEILRLRDELNGILAGHTGQKLDKIRDDTERDYFMSSEEAVKY 183

Query: 199 GVVDKVLMSRIDIEEKSK 216
           G++DKV+ SR D +E  K
Sbjct: 184 GLIDKVMHSRADAQEGRK 201


>gi|258404644|ref|YP_003197386.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Desulfohalobium retbaense DSM 5692]
 gi|257796871|gb|ACV67808.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Desulfohalobium retbaense DSM 5692]
          Length = 197

 Score =  261 bits (667), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 156/190 (82%)

Query: 19  VPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLY 78
           VP+V+E T RGER+YDIYSRLLK+RI+ +   I+D++A LICAQLLFLE+ENP KEI+ Y
Sbjct: 3   VPIVIESTGRGERAYDIYSRLLKDRIILLGTPIDDNVANLICAQLLFLESENPDKEINFY 62

Query: 79  INSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLH 138
           INSPGG VT+G+AIYDTMQ+I  P++T C+GQAASMG++LL+AGE GMR+ALP+ RI+LH
Sbjct: 63  INSPGGSVTSGLAIYDTMQYISAPVATLCLGQAASMGAVLLAAGEPGMRYALPHGRIMLH 122

Query: 139 QPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDW 198
           QP GGF GQA+DI+  A++I+++K  LN I  ++ G   E++E+  DRD+ M A+EA D+
Sbjct: 123 QPMGGFQGQATDIDIQAREILRLKSSLNSILSRHTGVELEKMERDTDRDYFMGATEAADY 182

Query: 199 GVVDKVLMSR 208
           GV+D+VL SR
Sbjct: 183 GVIDQVLASR 192


>gi|311107153|ref|YP_003980006.1| ATP-dependent Clp protease proteolytic subunit ClpP [Achromobacter
           xylosoxidans A8]
 gi|310761842|gb|ADP17291.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Achromobacter
           xylosoxidans A8]
          Length = 217

 Score =  261 bits (667), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 117/193 (60%), Positives = 153/193 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG +PMV+EQ+ RGER+YDIYSRLL+ER++F+ G + D  A L+ AQLLFLE+ENP K+I
Sbjct: 22  LGYIPMVIEQSGRGERAYDIYSRLLRERLIFLVGPVNDATANLVVAQLLFLESENPDKDI 81

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V AGMAI+DTMQF+KP +ST C G AASMG+ LL+AG+KG RF LPN+RI
Sbjct: 82  SLYINSPGGSVYAGMAIFDTMQFVKPDVSTLCTGLAASMGAFLLAAGKKGKRFTLPNSRI 141

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQASDI+  A++I+ ++ RLN I  +N G+T E +    +RD+ MSA +A
Sbjct: 142 MIHQPSGGAQGQASDIQIQAREILDLRERLNRILAENTGQTMERIGIDTERDNFMSAEDA 201

Query: 196 CDWGVVDKVLMSR 208
             +G+VDKV+ SR
Sbjct: 202 VSYGLVDKVMTSR 214


>gi|296136117|ref|YP_003643359.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Thiomonas
           intermedia K12]
 gi|295796239|gb|ADG31029.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Thiomonas
           intermedia K12]
          Length = 202

 Score =  261 bits (667), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 155/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVPMV+EQ+ RGER+YDIYSRLL+ER++F+ G I D MA L+ AQLLFLE+ENP K+I
Sbjct: 9   LGLVPMVIEQSGRGERAYDIYSRLLRERVIFLVGPINDQMANLVVAQLLFLESENPDKDI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V+AGMAI+DTMQFIKP +ST C G AASMG+ L++AG KG R++LPN+RI
Sbjct: 69  SLYINSPGGSVSAGMAIFDTMQFIKPDVSTLCTGIAASMGAFLMAAGAKGKRYSLPNSRI 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA+DIE  A++I+ ++ RLN I  +  G+T E++    +RD  MSA EA
Sbjct: 129 MIHQPSGGAQGQATDIEIQAREILYLRERLNGILAERTGQTLEKIGIDTERDFFMSAEEA 188

Query: 196 CDWGVVDKVLMSR 208
            D+G++D+V+  R
Sbjct: 189 KDYGLIDEVISKR 201


>gi|253575671|ref|ZP_04853007.1| clp protease [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251845009|gb|EES73021.1| clp protease [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 196

 Score =  261 bits (667), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 155/190 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQTNRGERSYDIYSRLLK+RI+F++  I+D +A L+ AQLLFL AE+P+K+I
Sbjct: 1   MSLVPMVVEQTNRGERSYDIYSRLLKDRIIFLSNAIDDEVANLVIAQLLFLAAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAGM IYDTMQ+IKP +ST C+G AASMGSLLL+AG  G R+ALPN+ +
Sbjct: 61  HLYINSPGGSVTAGMGIYDTMQYIKPDVSTICVGMAASMGSLLLTAGAPGKRYALPNSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI+ HA  I+K +++LN+IYV+  G+  E++E+  DRD  MSA EA
Sbjct: 121 MIHQPLGGVRGQATDIKIHADWIIKTRQKLNQIYVERTGQPLEKIERDTDRDFFMSAEEA 180

Query: 196 CDWGVVDKVL 205
             +G++D+V+
Sbjct: 181 KAYGIIDQVI 190


>gi|52425902|ref|YP_089039.1| ATP-dependent Clp protease proteolytic subunit [Mannheimia
           succiniciproducens MBEL55E]
 gi|60389529|sp|Q65RF6|CLPP_MANSM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|52307954|gb|AAU38454.1| ClpP protein [Mannheimia succiniciproducens MBEL55E]
          Length = 193

 Score =  261 bits (667), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 123/193 (63%), Positives = 161/193 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+PMVVEQT+RGERSYDIYSRLLKER++F++G++ED+MA LI AQLLFLE+ENP+K+I
Sbjct: 1   MALIPMVVEQTSRGERSYDIYSRLLKERVIFLSGEVEDNMANLIVAQLLFLESENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           +LYINSPGG VTAGMAIYDTMQFIKP + T C+GQA SMG+ LL+ G  G R ALP+AR+
Sbjct: 61  NLYINSPGGSVTAGMAIYDTMQFIKPDVRTLCVGQACSMGAFLLAGGAAGKRAALPHARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI+ HAQ+I+KIK+ LNE    + G+ +E +E+  DRD+ MSA +A
Sbjct: 121 MIHQPLGGFRGQASDIQIHAQEILKIKQTLNERLAFHTGQPFEVIERDTDRDNFMSAEDA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++D VL+ R
Sbjct: 181 KNYGLIDSVLVKR 193


>gi|323703643|ref|ZP_08115286.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Desulfotomaculum nigrificans DSM 574]
 gi|323531415|gb|EGB21311.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Desulfotomaculum nigrificans DSM 574]
          Length = 195

 Score =  261 bits (667), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 156/192 (81%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVP+VVEQTNRGER+YDIYSRLLK+RI+F+ G I+DH+A L+ AQ LFLEAE+P+K+I 
Sbjct: 3   ALVPIVVEQTNRGERAYDIYSRLLKDRIIFIGGPIDDHIANLVIAQFLFLEAEDPEKDIH 62

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGVVTAG+AIYDTMQ+IKP +ST C+GQAASMGS LL+AG KG R+ALP ARI+
Sbjct: 63  LYINSPGGVVTAGLAIYDTMQYIKPAVSTICLGQAASMGSFLLAAGAKGKRYALPQARIM 122

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG  GQA+DI+ HA++I++++  LNE    + G+  E++ +  +RD  MSA EA 
Sbjct: 123 IHQPLGGVQGQATDIDIHAREILRMREILNERLSHHTGQPLEKIARDTERDFFMSAEEAK 182

Query: 197 DWGVVDKVLMSR 208
            +G++D+V+  R
Sbjct: 183 KYGIIDEVMPYR 194


>gi|225713510|gb|ACO12601.1| ATP-dependent Clp protease proteolytic subunit, mitochondrial
           precursor [Lepeophtheirus salmonis]
          Length = 222

 Score =  261 bits (667), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 160/189 (84%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVP+VVEQT RGERSYDIYSRLLK+RI+ + GQ++D ++ L+ AQLLFL+AE+ +K I 
Sbjct: 24  GLVPIVVEQTGRGERSYDIYSRLLKDRIICLMGQVDDVISGLMVAQLLFLQAESGKKPIH 83

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           +YINSPGG VTAG+AIYDTMQ+I+PPI+T+C+GQA SMGSLLL+AG KGMR +LPN+RI+
Sbjct: 84  MYINSPGGSVTAGLAIYDTMQYIQPPIATWCVGQACSMGSLLLTAGTKGMRHSLPNSRIM 143

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSG   GQASDI+  AQ+I+ ++ RLN IYVK+ G+  + VEK++DRD+ MSA +A 
Sbjct: 144 VHQPSGQSHGQASDIQIQAQEILNLRARLNNIYVKHTGQPLDIVEKSMDRDNFMSADDAL 203

Query: 197 DWGVVDKVL 205
            +G++DKVL
Sbjct: 204 KFGLIDKVL 212


>gi|255528525|ref|ZP_05395307.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           carboxidivorans P7]
 gi|296184877|ref|ZP_06853288.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           carboxidivorans P7]
 gi|255507783|gb|EET84241.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           carboxidivorans P7]
 gi|296050659|gb|EFG90082.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           carboxidivorans P7]
          Length = 194

 Score =  261 bits (667), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 157/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGERSYDIYSRLLK+R+V +T ++ D  A+L+ AQLLFLEAE+P K+I
Sbjct: 1   MSLVPVVVEQTNRGERSYDIYSRLLKDRVVMLTEEVNDVTASLVVAQLLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +TAGMAIYDTMQ+IKP +ST C+G AASMG+ LL+AG KG R ALPNA I
Sbjct: 61  YLYINSPGGSITAGMAIYDTMQYIKPDVSTICIGMAASMGAFLLNAGAKGKRVALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI  HA+ I+KIK++LN I+ +  G+  E +EK  +RD+ MSA EA
Sbjct: 121 MIHQPLGGFQGQATDIGIHAERILKIKKKLNTIFSERTGQPLETIEKDTERDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++D++++ +
Sbjct: 181 KEYGLIDEIMVKK 193


>gi|251791978|ref|YP_003006698.1| ATP-dependent Clp protease proteolytic subunit [Aggregatibacter
           aphrophilus NJ8700]
 gi|247533365|gb|ACS96611.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Aggregatibacter aphrophilus NJ8700]
          Length = 193

 Score =  261 bits (667), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 119/193 (61%), Positives = 156/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++PMVV+QT+RGER+YDIYSRLLK+R++F++G++ED+MA LI AQLLFLE+E+P K+I
Sbjct: 1   MSVIPMVVDQTSRGERAYDIYSRLLKDRVIFLSGEVEDNMANLIVAQLLFLESEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           +LYINSPGG VTAGMAIYDTMQFIKP + T C+GQA SMG+ LL+ G  G R  LP+AR+
Sbjct: 61  NLYINSPGGSVTAGMAIYDTMQFIKPDVRTLCVGQACSMGAFLLAGGAPGKRGVLPHARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI+ HAQ+I+KIK  LNE    + G+  E +EK  DRD+ MSA EA
Sbjct: 121 MIHQPLGGFRGQASDIQIHAQEILKIKSTLNERLAFHTGQPIETIEKDTDRDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G+VD+V   R
Sbjct: 181 QNYGLVDEVFTKR 193


>gi|239907453|ref|YP_002954194.1| ATP-dependent Clp protease proteolytic subunit [Desulfovibrio
           magneticus RS-1]
 gi|259585949|sp|C4XH03|CLPP_DESMR RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|239797319|dbj|BAH76308.1| ATP-dependent Clp protease proteolytic subunit [Desulfovibrio
           magneticus RS-1]
          Length = 202

 Score =  261 bits (667), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 161/199 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +  +P+V+E T R ER+YDIYSRLL++RI+ +   ++D++A LICAQLLFLE+E+P+KEI
Sbjct: 1   MATIPIVIETTGRTERAYDIYSRLLRDRIILLGSAVDDYVANLICAQLLFLESEDPEKEI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGGVV+AG+AIYDTMQ++ PP+ST C+GQAASMG+LLL AG  GMR+ALP++RI
Sbjct: 61  FMYINSPGGVVSAGLAIYDTMQYVMPPVSTLCLGQAASMGALLLCAGATGMRYALPHSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG+ GQA+DIE HA++  + +  LNEI  K+ G++ E ++   +RD+ MSA EA
Sbjct: 121 MIHQPSGGYQGQATDIEIHAKETRRTRETLNEIMAKHTGQSMERIQVDTERDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSRIDIEEK 214
             +G++DKVL SR  +E+K
Sbjct: 181 VAYGLIDKVLTSRERLEKK 199


>gi|91783520|ref|YP_558726.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           xenovorans LB400]
 gi|187923896|ref|YP_001895538.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           phytofirmans PsJN]
 gi|296157827|ref|ZP_06840661.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           sp. Ch1-1]
 gi|116243110|sp|Q13Z15|CLPP2_BURXL RecName: Full=ATP-dependent Clp protease proteolytic subunit 2;
           AltName: Full=Endopeptidase Clp 2
 gi|91687474|gb|ABE30674.1| ATP-dependent Clp protease proteolytic subunit ClpP [Burkholderia
           xenovorans LB400]
 gi|187715090|gb|ACD16314.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           phytofirmans PsJN]
 gi|295892073|gb|EFG71857.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           sp. Ch1-1]
          Length = 217

 Score =  261 bits (666), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 121/202 (59%), Positives = 154/202 (76%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
           + +D E   LGLVP+VVE + RGERSYDIYSRLLKERIVF+ G++ D  A L+ AQ+LFL
Sbjct: 15  SSRDLEAQALGLVPIVVETSGRGERSYDIYSRLLKERIVFLVGEVNDQTANLVVAQMLFL 74

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP K+IS YINSPGG V+AGMAIYDTMQFIKP +ST CMG AASMG+ LL+AG KG 
Sbjct: 75  ESENPDKDISFYINSPGGSVSAGMAIYDTMQFIKPDVSTLCMGLAASMGAFLLAAGAKGK 134

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RFALPN+R+++HQP GG  GQASDIE  A++I+ +K RLN +   + G+  E + +  DR
Sbjct: 135 RFALPNSRVMIHQPLGGARGQASDIEIQAREILYLKERLNHLLAHHTGQPVERIARDTDR 194

Query: 187 DHIMSASEACDWGVVDKVLMSR 208
           D+ MS  +A  +G+VD+V   R
Sbjct: 195 DNFMSGDDAQAYGLVDQVAHKR 216


>gi|147677139|ref|YP_001211354.1| protease subunit of ATP-dependent Clp proteases [Pelotomaculum
           thermopropionicum SI]
 gi|259585961|sp|A5D447|CLPP_PELTS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|146273236|dbj|BAF58985.1| protease subunit of ATP-dependent Clp proteases [Pelotomaculum
           thermopropionicum SI]
          Length = 194

 Score =  261 bits (666), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 159/189 (84%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGER+YDIYSRLLK+RI+F+ G I+D+ A LI AQ+LFLEAE+P+K+I
Sbjct: 1   MNLVPIVVEQTNRGERAYDIYSRLLKDRIIFLGGPIDDNTANLIIAQMLFLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
             YINSPGGVVTAGMAIYDTMQ+++ P++T C+GQAASM SLLL+AG KG R++LP ARI
Sbjct: 61  QFYINSPGGVVTAGMAIYDTMQYVRSPVATICIGQAASMASLLLAAGAKGKRYSLPYARI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           L+HQP GG  GQA+DIE HA++I+++++ LNEI  ++ G+  E++ +  +RD+ MSA EA
Sbjct: 121 LIHQPLGGVQGQATDIEIHAKEILRMRQFLNEILSRHTGQPIEKIARDTERDYFMSAQEA 180

Query: 196 CDWGVVDKV 204
            ++G++D+V
Sbjct: 181 KEYGIIDEV 189


>gi|169824905|ref|YP_001692516.1| ATP-dependent protease Clp proteolytic subunit [Finegoldia magna
           ATCC 29328]
 gi|297587291|ref|ZP_06945936.1| ATP-dependent Clp protease proteolytic subunit [Finegoldia magna
           ATCC 53516]
 gi|302379561|ref|ZP_07268046.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Finegoldia
           magna ACS-171-V-Col3]
 gi|303234189|ref|ZP_07320835.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Finegoldia
           magna BVS033A4]
 gi|167831710|dbj|BAG08626.1| ATP-dependent protease Clp proteolytic subunit [Finegoldia magna
           ATCC 29328]
 gi|297575272|gb|EFH93991.1| ATP-dependent Clp protease proteolytic subunit [Finegoldia magna
           ATCC 53516]
 gi|302312468|gb|EFK94464.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Finegoldia
           magna ACS-171-V-Col3]
 gi|302494730|gb|EFL54490.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Finegoldia
           magna BVS033A4]
          Length = 195

 Score =  261 bits (666), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 117/190 (61%), Positives = 158/190 (83%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQ+NRGERSYDI+SRLLKERI+FVTG++ D MA L+ AQLLFLE+E+P+K+I L
Sbjct: 4   LVPMVVEQSNRGERSYDIFSRLLKERIIFVTGEVNDQMADLVIAQLLFLESEDPKKDIQL 63

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG V+AG+AIYDTMQ++KP +ST C+G AASMG++LL++G KG R+ALPNA  L+
Sbjct: 64  YINSPGGSVSAGLAIYDTMQYVKPDVSTICVGMAASMGAILLTSGAKGKRYALPNADTLI 123

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG  GQASDIE HA++I+K +  LN+I  +  G+  E++E+  DRD I++A EA +
Sbjct: 124 HQPLGGAQGQASDIEIHAKNILKKRELLNKILSERTGQPLEKIERDTDRDFILTAEEAKE 183

Query: 198 WGVVDKVLMS 207
           +G++D+V+ +
Sbjct: 184 YGLIDEVIYT 193


>gi|319763664|ref|YP_004127601.1| ATP-dependent clp protease, proteolytic subunit clpp
           [Alicycliphilus denitrificans BC]
 gi|330824071|ref|YP_004387374.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Alicycliphilus denitrificans K601]
 gi|317118225|gb|ADV00714.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Alicycliphilus denitrificans BC]
 gi|329309443|gb|AEB83858.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Alicycliphilus denitrificans K601]
          Length = 202

 Score =  261 bits (666), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 117/193 (60%), Positives = 155/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG++PMV+EQ+ RGERSYDIYSRLLKER++F+ G++ D  A L+ AQLLFLE+ENP K+I
Sbjct: 9   LGMIPMVIEQSGRGERSYDIYSRLLKERVIFLVGEVNDQTANLVVAQLLFLESENPDKDI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S YINSPGG VTAGMAIYDTMQFIKP +ST C G AASMG+ LL+AG KG RF+LPN++I
Sbjct: 69  SFYINSPGGSVTAGMAIYDTMQFIKPDVSTLCCGFAASMGAFLLAAGAKGKRFSLPNSKI 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQ  GG  GQA+DIE HA+DI++ K ++N I  +  G++ E+V+   +RD+ M+A EA
Sbjct: 129 MIHQVLGGARGQATDIEIHARDILRTKDQMNRILAERTGQSIEKVKADTERDYFMTADEA 188

Query: 196 CDWGVVDKVLMSR 208
            D+G+VD+V+  R
Sbjct: 189 RDYGLVDQVISKR 201


>gi|302035647|ref|YP_003795969.1| ATP-dependent Clp protease proteolytic subunit clpP [Candidatus
           Nitrospira defluvii]
 gi|300603711|emb|CBK40042.1| ATP-dependent Clp protease, proteolytic subunit clpP [Candidatus
           Nitrospira defluvii]
          Length = 211

 Score =  261 bits (666), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 158/188 (84%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+V+EQTNRGER+YDIYSRLLK+RI+F+   I+D  A LI AQLLFLEAE+P+K+I+L
Sbjct: 2   LVPIVIEQTNRGERAYDIYSRLLKDRIIFLGAPIDDVFANLIIAQLLFLEAEDPEKDINL 61

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAG+ IYDTMQ++KP I+T C+GQAASMG+ LL+AG KG R+ALPNAR+++
Sbjct: 62  YINSPGGSVTAGLGIYDTMQYVKPAINTICLGQAASMGAFLLTAGTKGKRYALPNARVMI 121

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQA++I+ HA++I+KI+ RLNEI  K+ G+  +++ +  +RD+ MS+ EA  
Sbjct: 122 HQPMGGFQGQATEIDIHAREILKIRERLNEIMAKHTGQPLDKISQDTERDYFMSSEEAKR 181

Query: 198 WGVVDKVL 205
           +G++D+V+
Sbjct: 182 YGLIDEVI 189


>gi|257138854|ref|ZP_05587116.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           thailandensis E264]
          Length = 217

 Score =  260 bits (665), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 121/202 (59%), Positives = 155/202 (76%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
           A +D E   LGLVP+VVE + RGERSYDIYSRLLKERIVF+ G++ D  A L+ AQLLFL
Sbjct: 15  APRDFEAQALGLVPIVVETSGRGERSYDIYSRLLKERIVFMVGEVNDQTANLVVAQLLFL 74

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP K+ISLYINSPGG V+AGMAIYDTMQF+KP +ST CMG AASMG+ LL++G KG 
Sbjct: 75  ESENPDKDISLYINSPGGSVSAGMAIYDTMQFVKPDVSTLCMGLAASMGAFLLASGAKGK 134

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R+ALPNAR+++HQP GG  GQASDIE  A++I+ +K RLN +   + G+  E + +  DR
Sbjct: 135 RYALPNARVMIHQPLGGARGQASDIEIQAREILYLKDRLNHLLAHHTGQDVERIARDTDR 194

Query: 187 DHIMSASEACDWGVVDKVLMSR 208
           D+ MS+ +A  +G++D V   R
Sbjct: 195 DNFMSSEDAKAYGLIDHVSTKR 216


>gi|227824397|ref|ZP_03989229.1| ATP-dependent Clp protease [Acidaminococcus sp. D21]
 gi|226904896|gb|EEH90814.1| ATP-dependent Clp protease [Acidaminococcus sp. D21]
          Length = 199

 Score =  260 bits (665), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 115/191 (60%), Positives = 158/191 (82%)

Query: 19  VPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLY 78
           VP+VVEQT++GERSYDIYSRLLK+RI+FVTG+IEDHMA LI AQLLFLE+E+P K+I LY
Sbjct: 7   VPIVVEQTSKGERSYDIYSRLLKDRIIFVTGEIEDHMANLIVAQLLFLESEDPDKDIHLY 66

Query: 79  INSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLH 138
           INSPGG V+AG+AIYDTMQ+I+P +ST C+G AASM S+LL+AG KG RFALP++R+++H
Sbjct: 67  INSPGGSVSAGLAIYDTMQYIRPDVSTICVGMAASMASILLAAGAKGKRFALPHSRVMIH 126

Query: 139 QPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDW 198
           QP GG  GQA+DIE HA++I++++  +N+I   + GK  E ++   +RDH ++A EA  +
Sbjct: 127 QPLGGAQGQATDIEIHAREILRVREEMNQILAAHTGKDPETIKLDTERDHYLTADEALSY 186

Query: 199 GVVDKVLMSRI 209
           G++D+V+ S +
Sbjct: 187 GLIDQVVASPV 197


>gi|226311381|ref|YP_002771275.1| ATP-dependent Clp protease proteolytic subunit [Brevibacillus
           brevis NBRC 100599]
 gi|226094329|dbj|BAH42771.1| ATP-dependent Clp protease proteolytic subunit [Brevibacillus
           brevis NBRC 100599]
          Length = 193

 Score =  260 bits (665), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 120/188 (63%), Positives = 152/188 (80%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           L+PMV+EQT+RGERSYDIYSRLLK+RI+ +  +I+D +A LI AQLLFL+AE+P K+ISL
Sbjct: 2   LIPMVIEQTSRGERSYDIYSRLLKDRIILLGTEIDDEIANLIVAQLLFLQAEDPDKDISL 61

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGMAIYDTMQ+IKP +ST C+G AASMG+ LL+AG KG RFALPNA +++
Sbjct: 62  YINSPGGSVTAGMAIYDTMQYIKPDVSTICVGMAASMGAFLLAAGAKGKRFALPNAEVMI 121

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG  GQA DI  HA+ I+K KR+LNEI  +  G+ YE VE+  DRD+ MSA EA  
Sbjct: 122 HQPLGGVRGQAEDIRIHAEWIMKTKRQLNEILSERTGQPYERVEQDTDRDNFMSAEEAKA 181

Query: 198 WGVVDKVL 205
           +G++D ++
Sbjct: 182 YGLIDSII 189


>gi|157273309|gb|ABV27208.1| ATP-dependent Clp protease proteolytic subunit ClpP [Candidatus
           Chloracidobacterium thermophilum]
          Length = 199

 Score =  260 bits (665), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 117/193 (60%), Positives = 160/193 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            L+PMV+EQT RGER+YDIYSRLLK+ I+F++  I+D +A+L+ AQLLFLE+E+P+++IS
Sbjct: 7   ALIPMVIEQTGRGERAYDIYSRLLKDNIIFISTPIDDTVASLVVAQLLFLESEDPERDIS 66

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           +YINSPGG VTAGMAIYDTMQF+KP I TFC+GQ ASMG+LLL+AG KG R+ALP++RIL
Sbjct: 67  IYINSPGGSVTAGMAIYDTMQFVKPDIVTFCVGQCASMGALLLAAGTKGKRYALPHSRIL 126

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG  GQA+DI   A++I +I+   + I  K+ GK +E +E  ++RD IMSA++A 
Sbjct: 127 IHQPSGGAQGQATDILIQAEEIKRIRELTSTILAKHTGKPFEVIEADVERDRIMSATQAM 186

Query: 197 DWGVVDKVLMSRI 209
           ++G+VD+VL SR+
Sbjct: 187 EYGIVDQVLTSRV 199


>gi|83718816|ref|YP_442643.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           thailandensis E264]
 gi|167581577|ref|ZP_02374451.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           thailandensis TXDOH]
 gi|167619693|ref|ZP_02388324.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           thailandensis Bt4]
 gi|167836265|ref|ZP_02463148.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           thailandensis MSMB43]
 gi|110816456|sp|Q2SWQ6|CLPP_BURTA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|83652641|gb|ABC36704.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           thailandensis E264]
          Length = 207

 Score =  260 bits (665), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 121/202 (59%), Positives = 155/202 (76%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
           A +D E   LGLVP+VVE + RGERSYDIYSRLLKERIVF+ G++ D  A L+ AQLLFL
Sbjct: 5   APRDFEAQALGLVPIVVETSGRGERSYDIYSRLLKERIVFMVGEVNDQTANLVVAQLLFL 64

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP K+ISLYINSPGG V+AGMAIYDTMQF+KP +ST CMG AASMG+ LL++G KG 
Sbjct: 65  ESENPDKDISLYINSPGGSVSAGMAIYDTMQFVKPDVSTLCMGLAASMGAFLLASGAKGK 124

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R+ALPNAR+++HQP GG  GQASDIE  A++I+ +K RLN +   + G+  E + +  DR
Sbjct: 125 RYALPNARVMIHQPLGGARGQASDIEIQAREILYLKDRLNHLLAHHTGQDVERIARDTDR 184

Query: 187 DHIMSASEACDWGVVDKVLMSR 208
           D+ MS+ +A  +G++D V   R
Sbjct: 185 DNFMSSEDAKAYGLIDHVSTKR 206


>gi|317405213|gb|EFV85552.1| ATP-dependent Clp protease proteolytic subunit [Achromobacter
           xylosoxidans C54]
          Length = 217

 Score =  260 bits (665), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 152/193 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG +PMV+EQ+ RGER+YDIYSRLL+ER++F+ G + D  A L+ AQLLFLE+ENP K+I
Sbjct: 22  LGYIPMVIEQSGRGERAYDIYSRLLRERLIFLVGPVNDATANLVVAQLLFLESENPDKDI 81

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V AGMAIYDTMQF+KP +ST C G AASMG+ LL+AG+KG RF LPN+RI
Sbjct: 82  SLYINSPGGSVYAGMAIYDTMQFVKPDVSTLCTGLAASMGAFLLAAGKKGKRFTLPNSRI 141

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQASDI+  A++I+ ++ RLN I   N G++ + +    +RD+ MSA +A
Sbjct: 142 MIHQPSGGAQGQASDIQIQAREILDLRERLNRILADNTGQSIDRIALDTERDNFMSAEDA 201

Query: 196 CDWGVVDKVLMSR 208
             +G+VDKV+ SR
Sbjct: 202 VSYGLVDKVMTSR 214


>gi|257065888|ref|YP_003152144.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Anaerococcus
           prevotii DSM 20548]
 gi|256797768|gb|ACV28423.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Anaerococcus
           prevotii DSM 20548]
          Length = 197

 Score =  260 bits (664), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 115/191 (60%), Positives = 158/191 (82%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP VVEQTNRGER+YDIYSRLLK+RI+F++G++ D ++ +I AQLLFLE+E+P K+I  
Sbjct: 7   LVPTVVEQTNRGERAYDIYSRLLKDRIIFLSGEVRDEISDIIIAQLLFLESEDPDKDIQF 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G+AIYDTM +IKP +ST C+GQAASM ++LLS+G KG R++LP++ I++
Sbjct: 67  YINSPGGVVTSGLAIYDTMNYIKPDVSTICIGQAASMAAVLLSSGAKGKRYSLPSSNIMI 126

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGG  GQASDI   A+ I+KIK RLN+I   N G++ +++EK  DRD  M+A+EA +
Sbjct: 127 HQPSGGAQGQASDIVIQAEQIIKIKERLNKILSDNTGQSLKKIEKDTDRDFAMTAAEALE 186

Query: 198 WGVVDKVLMSR 208
           +G++DKV+ S+
Sbjct: 187 YGLIDKVIESK 197


>gi|95930403|ref|ZP_01313139.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Desulfuromonas acetoxidans DSM 684]
 gi|95133443|gb|EAT15106.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Desulfuromonas acetoxidans DSM 684]
          Length = 196

 Score =  260 bits (664), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 116/191 (60%), Positives = 155/191 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQT RGERSYDIYSRLLK+RI+F+ G I+D ++ L+ AQLLFLE+E+P+K+I
Sbjct: 1   MSLVPIVVEQTGRGERSYDIYSRLLKDRIIFLGGGIDDQISNLVIAQLLFLESEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGVVTAGMAIYDTMQ+IK P+ST C+GQAASMG++LL+AG +G RF LPN+RI
Sbjct: 61  HLYINSPGGVVTAGMAIYDTMQYIKAPVSTICVGQAASMGAVLLAAGAEGKRFTLPNSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI  HAQ+I++++  LN I   +C +  E + +  +RD  M A +A
Sbjct: 121 MIHQPLGGFQGQASDISIHAQEILRLREDLNRILAHHCSQDIETIARDTERDFFMGAEDA 180

Query: 196 CDWGVVDKVLM 206
             +G++DK++M
Sbjct: 181 QKYGLIDKIVM 191


>gi|28211967|ref|NP_782911.1| ATP-dependent Clp protease proteolytic subunit [Clostridium tetani
           E88]
 gi|28204410|gb|AAO36848.1| ATP-dependent clp protease proteolytic subunit [Clostridium tetani
           E88]
          Length = 202

 Score =  260 bits (664), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 118/197 (59%), Positives = 158/197 (80%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E+ F+ LVP+VVEQTNRGERSYDIYSRLLK+RI+ ++ Q+ D  A+LI AQLLFLEAE+P
Sbjct: 5   EEKFMSLVPVVVEQTNRGERSYDIYSRLLKDRIIMLSDQVNDVTASLIVAQLLFLEAEDP 64

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            K+I LYINSPGG +T+GMAIYDTMQ+IKP +ST C+G AASMG+ LL+AG KG RFALP
Sbjct: 65  DKDIFLYINSPGGSITSGMAIYDTMQYIKPDVSTICIGMAASMGAFLLAAGAKGKRFALP 124

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+ I++HQP GGF GQA+DI  HA  I+KIK+ LN I  +  G+  E +++  +RD+ M 
Sbjct: 125 NSEIMIHQPLGGFQGQATDIGIHADRILKIKQNLNSILSEKTGQPLEVIQRDTERDNFMD 184

Query: 192 ASEACDWGVVDKVLMSR 208
           A++A D+G++D+V++ +
Sbjct: 185 ANQAKDYGLIDEVMVKK 201


>gi|195384926|ref|XP_002051163.1| GJ13731 [Drosophila virilis]
 gi|194147620|gb|EDW63318.1| GJ13731 [Drosophila virilis]
          Length = 254

 Score =  260 bits (664), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 119/200 (59%), Positives = 157/200 (78%)

Query: 6   CAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLF 65
           C+ +      + L+PMVVEQT RGER+YDI+SRLLKERI+ + G I D +++ + AQLLF
Sbjct: 17  CSTQAPHVRGINLIPMVVEQTGRGERAYDIFSRLLKERIICLMGNITDDISSTVVAQLLF 76

Query: 66  LEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKG 125
           L++EN  K I LYINSPGGVVTAG+AIYDTMQ++KPPI+T+C+GQA SMGSLLL+AG  G
Sbjct: 77  LQSENVNKPIHLYINSPGGVVTAGLAIYDTMQYVKPPIATWCVGQACSMGSLLLAAGAPG 136

Query: 126 MRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD 185
           MR++LPNARI++HQPSGG  GQA+DI  HA++I+KIKR+L  IYVK+    Y+E+   ++
Sbjct: 137 MRYSLPNARIMIHQPSGGAQGQATDILIHAEEIIKIKRQLTNIYVKHAKNNYDEMCARME 196

Query: 186 RDHIMSASEACDWGVVDKVL 205
           RDH M+  EA   G++D VL
Sbjct: 197 RDHFMTPEEAKTLGIIDHVL 216


>gi|169831635|ref|YP_001717617.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Candidatus
           Desulforudis audaxviator MP104C]
 gi|169638479|gb|ACA59985.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Candidatus
           Desulforudis audaxviator MP104C]
          Length = 198

 Score =  260 bits (664), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 118/191 (61%), Positives = 156/191 (81%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+VVEQT RGER+YDIYSRLLK+RIVF+ G IEDH+A LI AQLLFLEAE+P K+I L
Sbjct: 4   LVPIVVEQTARGERAYDIYSRLLKDRIVFIGGPIEDHVANLIIAQLLFLEAEDPDKDIHL 63

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG+VT+GMAIYDTMQ+I+P +ST C+GQAAS G+ LL+AG  G RFALP ARI++
Sbjct: 64  YINSPGGLVTSGMAIYDTMQYIRPDVSTICLGQAASFGAFLLAAGTPGKRFALPYARIMM 123

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG  GQA++I+ HA++I++ KR LNE+  K+ G+  E++E+  +RD  MS  +A +
Sbjct: 124 HQPLGGVQGQATEIDIHAREILRTKRVLNELLAKHTGQPVEKIERDTERDFFMSPEQARE 183

Query: 198 WGVVDKVLMSR 208
           +G++D+V+  R
Sbjct: 184 YGIIDEVITVR 194


>gi|307252913|ref|ZP_07534801.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306859551|gb|EFM91576.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
          Length = 190

 Score =  260 bits (664), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 119/187 (63%), Positives = 152/187 (81%)

Query: 22  VVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYINS 81
           +VEQT++GERSYDIYSRLLKERI+F+TGQ+EDHMA LI AQ+LFLEAE+P+K+I LYINS
Sbjct: 1   MVEQTSKGERSYDIYSRLLKERIIFLTGQVEDHMANLIVAQMLFLEAEDPEKDIYLYINS 60

Query: 82  PGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPS 141
           PGGVVTAG+AIYDTM FIKP ++T C GQA SMG+ LLS G KG RFALPNAR+++HQP 
Sbjct: 61  PGGVVTAGLAIYDTMNFIKPDVATLCTGQACSMGAFLLSGGAKGKRFALPNARVMIHQPL 120

Query: 142 GGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGVV 201
           GG  GQA+DI+  AQ+I+K+K  L     ++ G+ +E+V    +RD+ MSA EA ++G++
Sbjct: 121 GGARGQATDIQIQAQEILKLKEMLTRKMAEHSGQPFEKVAADTERDNFMSAVEAMEYGLI 180

Query: 202 DKVLMSR 208
           DKVL  R
Sbjct: 181 DKVLTHR 187


>gi|225850859|ref|YP_002731093.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Persephonella
           marina EX-H1]
 gi|225644930|gb|ACO03116.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Persephonella
           marina EX-H1]
          Length = 202

 Score =  260 bits (664), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 117/200 (58%), Positives = 163/200 (81%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           KD + +   LVP+V+EQT RGER+YDIYSRLLK+RI+ +   I+DH+A LI AQLLFLE+
Sbjct: 3   KDLDSIVSQLVPIVIEQTPRGERAYDIYSRLLKDRIIMLGFPIDDHIANLIIAQLLFLES 62

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           E+P+K+I +YINSPGGVVT+G+AIYDTM++IKP + T CMGQAASMG+ LLSAG KG R+
Sbjct: 63  EDPEKDIYMYINSPGGVVTSGLAIYDTMRYIKPDVVTICMGQAASMGAFLLSAGAKGKRY 122

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           ALP++RI++HQP GGF GQA+DIE HA++I+++K+ LNE   ++ G+  E++E+  +RD 
Sbjct: 123 ALPSSRIMIHQPLGGFQGQATDIEIHAKEILRLKKYLNERLAEHTGQPLEKIERDTERDF 182

Query: 189 IMSASEACDWGVVDKVLMSR 208
            MSA +A ++G++DKV+  R
Sbjct: 183 FMSAHDAVEYGLIDKVIEKR 202


>gi|114567171|ref|YP_754325.1| ATP-dependent Clp protease proteolytic subunit [Syntrophomonas
           wolfei subsp. wolfei str. Goettingen]
 gi|122317850|sp|Q0AWF0|CLPP_SYNWW RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|114338106|gb|ABI68954.1| ATP-dependent Clp protease proteolytic subunit ClpP [Syntrophomonas
           wolfei subsp. wolfei str. Goettingen]
          Length = 200

 Score =  260 bits (664), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 155/188 (82%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQTNRGERSYDIYSRLLK+RI+F+   I+D +A L+ AQLLFLEAE+P K+ISL
Sbjct: 4   LVPMVVEQTNRGERSYDIYSRLLKDRIIFLGSGIDDTVANLVIAQLLFLEAEDPDKDISL 63

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG +TAGMAIYDT+Q+I+P +ST C+G AASMG+ LL+AG+KG R+ALPNA I++
Sbjct: 64  YINSPGGSITAGMAIYDTLQYIRPDVSTICVGLAASMGAFLLAAGKKGKRYALPNAEIMI 123

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP+GG  GQA+DIE HA+ I+ +K  LN+I  +  G+  E ++K  DRD+ M+A EA +
Sbjct: 124 HQPAGGTQGQATDIEIHARRIMNMKESLNKILAERTGQPLERIQKDTDRDYFMTAQEAKE 183

Query: 198 WGVVDKVL 205
           +G++D+V+
Sbjct: 184 YGIIDEVI 191


>gi|218885218|ref|YP_002434539.1| ATP-dependent Clp protease proteolytic subunit [Desulfovibrio
           vulgaris str. 'Miyazaki F']
 gi|226706450|sp|B8DNL4|CLPP_DESVM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|218756172|gb|ACL07071.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Desulfovibrio
           vulgaris str. 'Miyazaki F']
          Length = 201

 Score =  260 bits (664), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 155/192 (80%)

Query: 19  VPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLY 78
           VP+V+E + R ER+YDIYSRLLK+RI+ +   I+D +A+LICAQLLFLE+ENP+KEI LY
Sbjct: 3   VPIVIETSGRSERAYDIYSRLLKDRIILLGTPIDDQVASLICAQLLFLESENPEKEIYLY 62

Query: 79  INSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLH 138
           INSPGG VTAGMAIYDTMQ+I  P++T C+GQAASMG+LLL+AG  GMR ALPN+RI++H
Sbjct: 63  INSPGGSVTAGMAIYDTMQYITSPVATLCLGQAASMGALLLAAGAPGMRHALPNSRIMIH 122

Query: 139 QPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDW 198
           QPSGGF GQASDI+ HA++++++K  LNEI  ++ G+  E V    +RD+ M  +EA ++
Sbjct: 123 QPSGGFHGQASDIDIHAREVLRMKANLNEIMARHTGQPVERVADDTERDYFMGPAEAKEY 182

Query: 199 GVVDKVLMSRID 210
           G++D +L SR D
Sbjct: 183 GIIDSILTSRRD 194


>gi|311695076|gb|ADP97949.1| ATP-dependent Clp protease, proteolytic subunit ClpP [marine
           bacterium HP15]
          Length = 201

 Score =  259 bits (663), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 115/193 (59%), Positives = 152/193 (78%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVP+V+EQT RGERS+DIYSRLLKER++F+ G +EDHMA LI AQLLFLE+ENP K+I 
Sbjct: 6   GLVPIVIEQTARGERSFDIYSRLLKERVIFMVGPVEDHMANLIVAQLLFLESENPDKDIH 65

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP ++T C+GQAASMG+ LL+ G  G R  LPN+R++
Sbjct: 66  LYINSPGGSVTAGMSIYDTMQFIKPDVATLCVGQAASMGAFLLAGGAAGKRACLPNSRVM 125

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG+ GQA+DIE H ++I+KI+  LN I   + G+  E + K  DRD+ M  ++A 
Sbjct: 126 IHQPLGGYQGQATDIEIHTREILKIRHTLNSILAHHTGQDLETIAKDTDRDNFMDPAQAK 185

Query: 197 DWGVVDKVLMSRI 209
           ++G++D +L  R+
Sbjct: 186 EYGLIDSILDKRV 198


>gi|261405359|ref|YP_003241600.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Paenibacillus
           sp. Y412MC10]
 gi|329923469|ref|ZP_08278950.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Paenibacillus sp. HGF5]
 gi|261281822|gb|ACX63793.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Paenibacillus
           sp. Y412MC10]
 gi|328941269|gb|EGG37564.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Paenibacillus sp. HGF5]
          Length = 196

 Score =  259 bits (663), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 120/192 (62%), Positives = 154/192 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDIYSRLLK+RI+F++  I+D +A L+ AQLLFL AE+P+K+I
Sbjct: 1   MSLVPMVVEQTSRGERSYDIYSRLLKDRIIFLSSAIDDDVANLVIAQLLFLAAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG VTAGM IYDTMQ IKP +ST C+G AASMGSLLL+AG  G R+AL N+ +
Sbjct: 61  SLYINSPGGSVTAGMGIYDTMQLIKPDVSTICVGMAASMGSLLLTAGAPGKRYALENSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDI+ HA  I+K +++LN+IYV+  G+  E++E+  DRD  MSA EA
Sbjct: 121 MIHQPLGGIQGQASDIQIHADWIIKTRQKLNQIYVERTGQPLEKIERDTDRDFFMSAEEA 180

Query: 196 CDWGVVDKVLMS 207
             +G++D VL S
Sbjct: 181 KAYGIIDDVLSS 192


>gi|325266755|ref|ZP_08133428.1| ATP-dependent Clp protease, protease subunit [Kingella
           denitrificans ATCC 33394]
 gi|324981757|gb|EGC17396.1| ATP-dependent Clp protease, protease subunit [Kingella
           denitrificans ATCC 33394]
          Length = 209

 Score =  259 bits (663), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 125/196 (63%), Positives = 161/196 (82%), Gaps = 2/196 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQ+ RGER++DIYSRLLKERI+F+ G ++DH A L+ AQLLFLE+ENP K+I  
Sbjct: 13  LVPTVIEQSGRGERAFDIYSRLLKERIIFLVGPVDDHTANLVVAQLLFLESENPDKDIYF 72

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTM+FIKP + T C+GQAASMG+ LLSAG KG RFALPN+RI++
Sbjct: 73  YINSPGGSVTAGMSIYDTMKFIKPDVQTLCLGQAASMGAFLLSAGTKGKRFALPNSRIMI 132

Query: 138 HQP--SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP  SGG  GQASDIE HA++++K+K +LN+I   + GK+ EEVE+  DRD+ MSA EA
Sbjct: 133 HQPLISGGLGGQASDIEIHARELLKLKEKLNKILADHTGKSIEEVERDTDRDNFMSAQEA 192

Query: 196 CDWGVVDKVLMSRIDI 211
            ++G++DKV+ SR D+
Sbjct: 193 MEYGLIDKVITSRNDV 208


>gi|295698387|ref|YP_003603042.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Candidatus
           Riesia pediculicola USDA]
 gi|291157158|gb|ADD79603.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Candidatus
           Riesia pediculicola USDA]
          Length = 196

 Score =  259 bits (663), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 113/193 (58%), Positives = 158/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++P V+E+T  GERSYDIYSRLLKERI+F+TG IED+MA LI +QLLFLE+EN  KEI
Sbjct: 1   MSIIPTVIEKTVFGERSYDIYSRLLKERIIFLTGYIEDNMANLIISQLLFLESENQTKEI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG++T+G++IYDT+QFI P +ST C+GQA SMG+ LL++G KG R+ LPN+RI
Sbjct: 61  YLYINSPGGIITSGISIYDTIQFIMPKVSTICIGQACSMGAFLLASGAKGKRYCLPNSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP G F GQA+DIE H ++I+K+K ++NE+  K+ GK  E++EK  +RD+ +S+ EA
Sbjct: 121 MIHQPMGSFRGQATDIEIHTKEIIKLKSKMNELMAKHTGKQVEQIEKDTERDYFLSSEEA 180

Query: 196 CDWGVVDKVLMSR 208
            D+G+VD+V ++R
Sbjct: 181 VDYGLVDRVYLNR 193


>gi|253681101|ref|ZP_04861904.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum D str. 1873]
 gi|331270305|ref|YP_004396797.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum BKT015925]
 gi|253562950|gb|EES92396.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum D str. 1873]
 gi|329126855|gb|AEB76800.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum BKT015925]
          Length = 195

 Score =  259 bits (663), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 155/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGERSYDIYSRLLK+RI+F+  ++ D  A+L+ AQLLFLEAE+P K+I
Sbjct: 1   MSLVPVVVEQTNRGERSYDIYSRLLKDRIIFLGEEVNDVSASLVVAQLLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +TAGMAIYDTMQ+IKP +ST C+G AASMG+ LL+AG KG RFALPN+ I
Sbjct: 61  YLYINSPGGSITAGMAIYDTMQYIKPDVSTICIGMAASMGAFLLTAGAKGKRFALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI  HA  I+KIK +LN+I  +  GK  E ++K ++RD+ M A EA
Sbjct: 121 MIHQPLGGFQGQATDIGIHANRILKIKDKLNKILSERTGKPLEVIKKDVERDNFMEADEA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++D V+ SR
Sbjct: 181 KEYGLIDDVITSR 193


>gi|313499614|gb|ADR60980.1| ClpP [Pseudomonas putida BIRD-1]
          Length = 192

 Score =  259 bits (663), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 151/188 (80%)

Query: 21  MVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYIN 80
           MV+EQ+ RGER+YDIYSRLLKER++F+ G +ED+MA L+ AQLLFLEAENP K+I LYIN
Sbjct: 1   MVIEQSARGERAYDIYSRLLKERVIFLVGPVEDYMANLVVAQLLFLEAENPDKDIHLYIN 60

Query: 81  SPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQP 140
           SPGG VTAGM+IYDTMQFIKP +ST C+GQA SMG+ LL+AG KG R  LPN+R+++HQP
Sbjct: 61  SPGGSVTAGMSIYDTMQFIKPDVSTICIGQACSMGAFLLAAGAKGKRHCLPNSRVMIHQP 120

Query: 141 SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGV 200
            GGF GQA+DIE HAQ+I+ IK RLNE+   + G+  E +++  +RD+ MSAS A ++G+
Sbjct: 121 LGGFQGQATDIEIHAQEILNIKARLNELLAYHTGQDLETIKRDTERDNFMSASRAAEYGL 180

Query: 201 VDKVLMSR 208
           +D V   R
Sbjct: 181 IDSVYDKR 188


>gi|293606140|ref|ZP_06688505.1| ATP-dependent Clp protease proteolytic subunit [Achromobacter
           piechaudii ATCC 43553]
 gi|292815595|gb|EFF74711.1| ATP-dependent Clp protease proteolytic subunit [Achromobacter
           piechaudii ATCC 43553]
          Length = 217

 Score =  259 bits (663), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 117/193 (60%), Positives = 152/193 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG +PMV+EQ+ RGER+YDIYSRLL+ER++F+ G + D  A L+ AQLLFLE+ENP K+I
Sbjct: 22  LGYIPMVIEQSGRGERAYDIYSRLLRERLIFLVGPVNDATANLVVAQLLFLESENPDKDI 81

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V AGMAI+DTMQFIKP +ST C G AASMG+ LL+AG+KG RF LPN+RI
Sbjct: 82  SLYINSPGGSVYAGMAIFDTMQFIKPDVSTLCTGLAASMGAFLLAAGKKGKRFTLPNSRI 141

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQASDI+  A++I+ ++ RLN I   N G++ E +    +RD+ MSA +A
Sbjct: 142 MIHQPSGGAQGQASDIQIQAREILDLRERLNRILADNTGQSMERIGLDTERDNFMSAEDA 201

Query: 196 CDWGVVDKVLMSR 208
             +G+VDKV+ SR
Sbjct: 202 VSYGLVDKVMSSR 214


>gi|121593621|ref|YP_985517.1| ATP-dependent Clp protease proteolytic subunit [Acidovorax sp.
           JS42]
 gi|166201795|sp|A1W5B6|CLPP_ACISJ RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|120605701|gb|ABM41441.1| ATP-dependent Clp protease proteolytic subunit ClpP [Acidovorax sp.
           JS42]
          Length = 202

 Score =  259 bits (663), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 154/193 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG++PMV+EQ+ RGERSYDIYSRLLKER++F+ G++ D  A L+ AQLLFLE+ENP K+I
Sbjct: 9   LGMIPMVIEQSGRGERSYDIYSRLLKERVIFLVGEVNDQTANLVVAQLLFLESENPDKDI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S YINSPGG VTAGMAIYDTMQFIKP +ST C G AASMG+ LL+AG KG R++LPN++I
Sbjct: 69  SFYINSPGGSVTAGMAIYDTMQFIKPDVSTLCCGFAASMGAFLLAAGAKGKRYSLPNSKI 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQ  GG  GQA+DIE HA+DI++ K ++N I  +  G+  E+V+   +RD+ M+A EA
Sbjct: 129 MIHQVLGGARGQATDIEIHARDILRTKEQMNRILAERTGQPIEKVKADTERDYFMTADEA 188

Query: 196 CDWGVVDKVLMSR 208
            D+G+VD+V+  R
Sbjct: 189 KDYGIVDQVIAKR 201


>gi|15895898|ref|NP_349247.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           acetobutylicum ATCC 824]
 gi|18202304|sp|P58276|CLPP_CLOAB RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|15025667|gb|AAK80587.1|AE007761_6 Protease subunits of ATP-dependent protease, ClpP [Clostridium
           acetobutylicum ATCC 824]
 gi|325510050|gb|ADZ21686.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           acetobutylicum EA 2018]
          Length = 193

 Score =  259 bits (663), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 154/190 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQT+RGERSYDIYSRLLK+R++F+  ++ D  A+L+ AQLLFLE+E+P K+I
Sbjct: 1   MSLVPYVIEQTSRGERSYDIYSRLLKDRVIFLGEEVNDTTASLVVAQLLFLESEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +T+GMAIYDTMQ++KP +ST C+G AASMGS LL+AG  G RFALPN+ I
Sbjct: 61  YLYINSPGGSITSGMAIYDTMQYVKPDVSTICIGMAASMGSFLLTAGAPGKRFALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI  HAQ I++IK++LN IY +  GK  E +EK  DRDH +SA EA
Sbjct: 121 MIHQPLGGFKGQATDIGIHAQRILEIKKKLNSIYSERTGKPIEVIEKDTDRDHFLSAEEA 180

Query: 196 CDWGVVDKVL 205
            ++G++D+V+
Sbjct: 181 KEYGLIDEVI 190


>gi|53719039|ref|YP_108025.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           pseudomallei K96243]
 gi|121601387|ref|YP_993274.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia mallei
           SAVP1]
 gi|124386617|ref|YP_001029282.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia mallei
           NCTC 10229]
 gi|126440189|ref|YP_001059356.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           pseudomallei 668]
 gi|126450257|ref|YP_001080784.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia mallei
           NCTC 10247]
 gi|126451473|ref|YP_001066627.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           pseudomallei 1106a]
 gi|134277993|ref|ZP_01764708.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei 305]
 gi|217421679|ref|ZP_03453183.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei 576]
 gi|226197408|ref|ZP_03792985.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei Pakistan 9]
 gi|237812684|ref|YP_002897135.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei MSHR346]
 gi|238562204|ref|ZP_00440781.2| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei GB8 horse 4]
 gi|242317499|ref|ZP_04816515.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei 1106b]
 gi|251766649|ref|ZP_02264557.2| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei PRL-20]
 gi|254178458|ref|ZP_04885113.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei ATCC 10399]
 gi|254189184|ref|ZP_04895695.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei Pasteur 52237]
 gi|254206398|ref|ZP_04912750.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei JHU]
 gi|254258354|ref|ZP_04949408.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei 1710a]
 gi|254297312|ref|ZP_04964765.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei 406e]
 gi|254358192|ref|ZP_04974465.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei 2002721280]
 gi|67460243|sp|Q63V41|CLPP_BURPS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166201803|sp|A3MKJ8|CLPP_BURM7 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166201804|sp|A2SBG3|CLPP_BURM9 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166201805|sp|A1V4X1|CLPP_BURMS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166201806|sp|A3NWA6|CLPP_BURP0 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166201807|sp|A3NAI5|CLPP_BURP6 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|52209453|emb|CAH35404.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           pseudomallei K96243]
 gi|121230197|gb|ABM52715.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei SAVP1]
 gi|124294637|gb|ABN03906.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei NCTC 10229]
 gi|126219682|gb|ABN83188.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei 668]
 gi|126225115|gb|ABN88655.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei 1106a]
 gi|126243127|gb|ABO06220.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei NCTC 10247]
 gi|134251643|gb|EBA51722.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei 305]
 gi|147753841|gb|EDK60906.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei JHU]
 gi|148027319|gb|EDK85340.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei 2002721280]
 gi|157807201|gb|EDO84371.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei 406e]
 gi|157936863|gb|EDO92533.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei Pasteur 52237]
 gi|160699497|gb|EDP89467.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei ATCC 10399]
 gi|217395421|gb|EEC35439.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei 576]
 gi|225930787|gb|EEH26797.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei Pakistan 9]
 gi|237504658|gb|ACQ96976.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei MSHR346]
 gi|238523066|gb|EEP86507.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei GB8 horse 4]
 gi|242140738|gb|EES27140.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei 1106b]
 gi|243065058|gb|EES47244.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei PRL-20]
 gi|254217043|gb|EET06427.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei 1710a]
          Length = 217

 Score =  259 bits (663), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 155/202 (76%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
           A +D E   LGLVP+VVE + RGERSYDIYSRLLKERIVF+ G++ D  A L+ AQLLFL
Sbjct: 15  APRDFEAQALGLVPIVVETSGRGERSYDIYSRLLKERIVFMVGEVNDQTANLVVAQLLFL 74

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP K+ISLYINSPGG V+AGMAIYDTMQF+KP +ST CMG AASMG+ LL++G KG 
Sbjct: 75  ESENPDKDISLYINSPGGSVSAGMAIYDTMQFVKPDVSTLCMGLAASMGAFLLASGAKGK 134

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R+ALPNAR+++HQP GG  GQASDIE  A++I+ ++ RLN +   + G+  E + +  DR
Sbjct: 135 RYALPNARVMIHQPLGGARGQASDIEIQAREILYLRDRLNHLLAHHTGQDVERIARDTDR 194

Query: 187 DHIMSASEACDWGVVDKVLMSR 208
           D+ MS+ +A  +G++D V   R
Sbjct: 195 DNFMSSEDAKAYGLIDHVSTKR 216


>gi|323449375|gb|EGB05263.1| hypothetical protein AURANDRAFT_31167 [Aureococcus anophagefferens]
          Length = 194

 Score =  259 bits (663), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 118/191 (61%), Positives = 156/191 (81%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           +VPMV+E+++RGER++DIYSRLLKERI+ + G + D +A+++ AQLLFLE+E+P   IS+
Sbjct: 1   MVPMVIERSSRGERAFDIYSRLLKERIIILNGPVHDELASVVTAQLLFLESEDPTSPISM 60

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVTAG+AIYDTMQ+I+P ++T CMGQAASMGSLLL+AG  GMR ALPNA+I+L
Sbjct: 61  YINSPGGVVTAGLAIYDTMQYIQPAVATLCMGQAASMGSLLLAAGADGMRRALPNAQIML 120

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGG  GQASDI   A++I+K + +LN+IYV +  K   +VEK +DRD   +A EA D
Sbjct: 121 HQPSGGAQGQASDIAIVAKEILKTRAKLNDIYVHHTKKPLADVEKVMDRDSYFTAQEAMD 180

Query: 198 WGVVDKVLMSR 208
           +GVVD+V+  R
Sbjct: 181 FGVVDEVVHPR 191


>gi|168186116|ref|ZP_02620751.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum C str. Eklund]
 gi|169296133|gb|EDS78266.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum C str. Eklund]
          Length = 195

 Score =  259 bits (663), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 155/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGERSYDIYSRLLK+RI+F+  ++ D  A+L+ AQLLFLEAE+P K+I
Sbjct: 1   MSLVPVVVEQTNRGERSYDIYSRLLKDRIIFLGEEVNDVSASLVVAQLLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +TAGMAIYDTMQ+IKP +ST C+G AASMG+ LL+AG KG RFALPN+ I
Sbjct: 61  YLYINSPGGSITAGMAIYDTMQYIKPDVSTICIGMAASMGAFLLTAGAKGKRFALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI  HA  I+KIK +LN+I  +  GK  E ++K ++RD+ M A EA
Sbjct: 121 MIHQPLGGFQGQATDIGIHANRILKIKDKLNKILSERTGKPLEVIKKDVERDNFMEAEEA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++D V+ SR
Sbjct: 181 KEYGLIDDVITSR 193


>gi|23099911|ref|NP_693377.1| ATP-dependent Clp protease proteolytic subunit [Oceanobacillus
           iheyensis HTE831]
 gi|60389793|sp|Q8ENM5|CLPP_OCEIH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|22778142|dbj|BAC14412.1| ATP-dependent Clp protease proteolytic subunit [Oceanobacillus
           iheyensis HTE831]
          Length = 193

 Score =  259 bits (663), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 154/190 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQTNRGER+YDIYSRLLK+RI+ +   I+D+++  I AQLLFLEAE+P K+I
Sbjct: 1   MNLVPTVIEQTNRGERAYDIYSRLLKDRIILLGSGIDDNVSNSIVAQLLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG +TAGMAIYDTM FIKP +ST C+G AASMG+ LL+AGEKG RFALPN+ I
Sbjct: 61  SLYINSPGGSITAGMAIYDTMNFIKPNVSTICIGMAASMGAFLLTAGEKGKRFALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DIE HA+ I+ IKRR+NEI  +  G+  E +E+  +RD+ M+A ++
Sbjct: 121 MIHQPLGGTQGQATDIEIHAKRIIDIKRRMNEIMAEKTGQPIEVIERDTERDNFMTADQS 180

Query: 196 CDWGVVDKVL 205
            ++G++DK+L
Sbjct: 181 VEYGLIDKIL 190


>gi|187477999|ref|YP_786023.1| ATP-dependent Clp protease proteolytic subunit [Bordetella avium
           197N]
 gi|115422585|emb|CAJ49110.1| ATP-dependent Clp protease proteolytic subunit [Bordetella avium
           197N]
          Length = 217

 Score =  259 bits (663), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 117/196 (59%), Positives = 153/196 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG +PMVVEQ+ RGER+YDIYSRLL+ER++F+ G + D  A L+ AQLLFLE+ENP K+I
Sbjct: 22  LGYIPMVVEQSGRGERAYDIYSRLLRERLIFLVGPVNDATANLVVAQLLFLESENPDKDI 81

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S YINSPGG V AGMAI+DTMQF+KP +ST C G AASMG+ LL+AG+KG RF+LPN+RI
Sbjct: 82  SFYINSPGGSVYAGMAIFDTMQFVKPDVSTLCTGLAASMGAFLLAAGKKGKRFSLPNSRI 141

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQASDI+  A++I+ ++ RLN I  +N G++ E +    +RD  MSA +A
Sbjct: 142 MIHQPSGGAQGQASDIQIQAKEILDLRERLNRILAENTGQSMERIAIDTERDTFMSAEDA 201

Query: 196 CDWGVVDKVLMSRIDI 211
             +G+VDKVL  R D+
Sbjct: 202 LSYGLVDKVLARREDV 217


>gi|254179427|ref|ZP_04886026.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei 1655]
 gi|254200063|ref|ZP_04906429.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei FMH]
 gi|147749659|gb|EDK56733.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei FMH]
 gi|184209967|gb|EDU07010.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei 1655]
          Length = 211

 Score =  259 bits (663), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 155/202 (76%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
           A +D E   LGLVP+VVE + RGERSYDIYSRLLKERIVF+ G++ D  A L+ AQLLFL
Sbjct: 9   APRDFEAQALGLVPIVVETSGRGERSYDIYSRLLKERIVFMVGEVNDQTANLVVAQLLFL 68

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP K+ISLYINSPGG V+AGMAIYDTMQF+KP +ST CMG AASMG+ LL++G KG 
Sbjct: 69  ESENPDKDISLYINSPGGSVSAGMAIYDTMQFVKPDVSTLCMGLAASMGAFLLASGAKGK 128

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R+ALPNAR+++HQP GG  GQASDIE  A++I+ ++ RLN +   + G+  E + +  DR
Sbjct: 129 RYALPNARVMIHQPLGGARGQASDIEIQAREILYLRDRLNHLLAHHTGQDVERIARDTDR 188

Query: 187 DHIMSASEACDWGVVDKVLMSR 208
           D+ MS+ +A  +G++D V   R
Sbjct: 189 DNFMSSEDAKAYGLIDHVSTKR 210


>gi|283852376|ref|ZP_06369646.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Desulfovibrio
           sp. FW1012B]
 gi|283572224|gb|EFC20214.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Desulfovibrio
           sp. FW1012B]
          Length = 204

 Score =  259 bits (663), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 115/196 (58%), Positives = 158/196 (80%)

Query: 19  VPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLY 78
           +P+V+E T R ER+YDIYSRLL++RI+ +   ++DH+A LICAQLLFLE+E+P+KEI +Y
Sbjct: 4   IPIVIETTGRSERAYDIYSRLLRDRIILLGSAVDDHVANLICAQLLFLESEDPEKEIFMY 63

Query: 79  INSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLH 138
           INSPGG VTAG+AIYDTMQ++ P +ST CMGQAASMG+LLL AG  GMR+ALP++RI++H
Sbjct: 64  INSPGGSVTAGLAIYDTMQYVLPKVSTLCMGQAASMGALLLCAGATGMRYALPHSRIMIH 123

Query: 139 QPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDW 198
           QP GGF GQA+DI+ HA++I++I+  LNEI  ++ G+  E+V    DRD+ M+A EA  +
Sbjct: 124 QPMGGFQGQATDIDIHAREILRIRESLNEIMARHTGQDIEKVRVDTDRDYFMNADEAVTY 183

Query: 199 GVVDKVLMSRIDIEEK 214
           G++DKVL SR  + +K
Sbjct: 184 GLIDKVLTSREPVAKK 199


>gi|120610146|ref|YP_969824.1| ATP-dependent Clp protease proteolytic subunit [Acidovorax citrulli
           AAC00-1]
 gi|326316315|ref|YP_004233987.1| ATP-dependent Clp protease proteolytic subunit [Acidovorax avenae
           subsp. avenae ATCC 19860]
 gi|166201794|sp|A1TM62|CLPP_ACIAC RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|120588610|gb|ABM32050.1| ATP-dependent Clp protease proteolytic subunit ClpP [Acidovorax
           citrulli AAC00-1]
 gi|323373151|gb|ADX45420.1| ATP-dependent Clp protease proteolytic subunit [Acidovorax avenae
           subsp. avenae ATCC 19860]
          Length = 202

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 117/193 (60%), Positives = 155/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG++PMV+EQ+ RGERSYDIYSRLLKERIVF+ G++ D  A L+ AQLLFLE+ENP K+I
Sbjct: 9   LGMIPMVIEQSGRGERSYDIYSRLLKERIVFLIGEVNDQTANLVVAQLLFLESENPDKDI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S YINSPGG VTAGMAIYDTMQFIKP +ST C+G AASMG+ LL+AG KG RF+LPN++I
Sbjct: 69  SFYINSPGGSVTAGMAIYDTMQFIKPDVSTMCLGFAASMGAFLLAAGAKGKRFSLPNSKI 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQ  GG  GQA+DIE HA+DI++ K ++N I  +  G+  E+V+   +RD+ ++A EA
Sbjct: 129 MIHQVLGGARGQATDIEIHARDILRTKDQMNRILAERTGQPLEKVKADTERDYFLTADEA 188

Query: 196 CDWGVVDKVLMSR 208
            ++G+VD+V+  R
Sbjct: 189 KEYGLVDQVVTQR 201


>gi|312128165|ref|YP_003993039.1| ATP-dependent clp protease, proteolytic subunit clpp
           [Caldicellulosiruptor hydrothermalis 108]
 gi|312134617|ref|YP_004001955.1| ATP-dependent clp protease, proteolytic subunit clpp
           [Caldicellulosiruptor owensensis OL]
 gi|312792981|ref|YP_004025904.1| ATP-dependent clp protease, proteolytic subunit clpp
           [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312876447|ref|ZP_07736431.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Caldicellulosiruptor lactoaceticus 6A]
 gi|311774668|gb|ADQ04155.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Caldicellulosiruptor owensensis OL]
 gi|311778184|gb|ADQ07670.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Caldicellulosiruptor hydrothermalis 108]
 gi|311796805|gb|EFR13150.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Caldicellulosiruptor lactoaceticus 6A]
 gi|312180121|gb|ADQ40291.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 195

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 120/192 (62%), Positives = 154/192 (80%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVP+V+EQTNRGER+YDIYSRLLK+RIV ++G+I D +A+LI AQLLFLEAE+P K+I 
Sbjct: 3   ALVPIVIEQTNRGERAYDIYSRLLKDRIVILSGEITDDIASLIVAQLLFLEAEDPDKDIY 62

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAG AIYDTMQ+IKP +ST C+G AASMG+ LL+AG KG RFALPN+ I+
Sbjct: 63  LYINSPGGSVTAGFAIYDTMQYIKPDVSTICVGMAASMGAFLLAAGAKGKRFALPNSEIM 122

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG  GQA+DI+ HA+ I+KIK R+N+I  +  G+  E +E+  DRD  M+A EA 
Sbjct: 123 IHQPLGGVRGQATDIKIHAEWILKIKNRINKILSERTGQPIEVIERDTDRDFFMTAEEAL 182

Query: 197 DWGVVDKVLMSR 208
            +G++DKV+  R
Sbjct: 183 KYGIIDKVIERR 194


>gi|153955960|ref|YP_001396725.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           kluyveri DSM 555]
 gi|219856302|ref|YP_002473424.1| hypothetical protein CKR_2959 [Clostridium kluyveri NBRC 12016]
 gi|189082452|sp|A5N2K8|CLPP_CLOK5 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|254763788|sp|B9E685|CLPP_CLOK1 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|146348818|gb|EDK35354.1| ClpP [Clostridium kluyveri DSM 555]
 gi|219570026|dbj|BAH08010.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 194

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 119/193 (61%), Positives = 155/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGERSYDIYSRLLK+RIV ++ ++ D  A+LI AQLLFLEAENP K+I
Sbjct: 1   MSLVPVVVEQTNRGERSYDIYSRLLKDRIVMLSEEVNDVTASLIVAQLLFLEAENPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
             YINSPGG +TAGMAIYDTMQ+IK  +ST C+G AASMG+ LL+AGEKG RFALPN+ I
Sbjct: 61  YFYINSPGGSITAGMAIYDTMQYIKSDVSTICIGMAASMGAFLLAAGEKGKRFALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI  HA  I++IK++LN I  +  G++ E+VEK  +RD+ M+A EA
Sbjct: 121 MIHQPLGGFQGQATDIGIHADRILRIKKKLNAIISERTGQSIEKVEKDTERDNFMTAEEA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++D+V   +
Sbjct: 181 KEYGLIDEVFTKK 193


>gi|315645729|ref|ZP_07898853.1| hypothetical protein PVOR_09635 [Paenibacillus vortex V453]
 gi|315279207|gb|EFU42517.1| hypothetical protein PVOR_09635 [Paenibacillus vortex V453]
          Length = 196

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 120/192 (62%), Positives = 153/192 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDIYSRLLK+RI+F++  I+D +A L+ AQLLFL AE+P+K+I
Sbjct: 1   MSLVPMVVEQTSRGERSYDIYSRLLKDRIIFLSSAIDDDVANLVIAQLLFLAAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG VTAGM IYDTMQ IKP +ST C+G AASMGSLLL+AG  G R+AL N+ +
Sbjct: 61  SLYINSPGGSVTAGMGIYDTMQLIKPDVSTICVGMAASMGSLLLTAGAPGKRYALENSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDI+ HA  I+K + +LN+IYV+  G+  E++E+  DRD  MSA EA
Sbjct: 121 MIHQPLGGIQGQASDIQIHADWIIKTRHKLNQIYVERTGQPLEKIERDTDRDFFMSAEEA 180

Query: 196 CDWGVVDKVLMS 207
             +G++D VL S
Sbjct: 181 KAYGIIDDVLSS 192


>gi|53723667|ref|YP_103112.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia mallei
           ATCC 23344]
 gi|76808778|ref|YP_333874.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           pseudomallei 1710b]
 gi|167719122|ref|ZP_02402358.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           pseudomallei DM98]
 gi|167738116|ref|ZP_02410890.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           pseudomallei 14]
 gi|167815308|ref|ZP_02446988.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           pseudomallei 91]
 gi|167823710|ref|ZP_02455181.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           pseudomallei 9]
 gi|167845261|ref|ZP_02470769.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           pseudomallei B7210]
 gi|167893805|ref|ZP_02481207.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           pseudomallei 7894]
 gi|167902257|ref|ZP_02489462.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           pseudomallei NCTC 13177]
 gi|167910496|ref|ZP_02497587.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           pseudomallei 112]
 gi|167918525|ref|ZP_02505616.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           pseudomallei BCC215]
 gi|67460238|sp|Q62JK7|CLPP_BURMA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|92087004|sp|Q3JRC9|CLPP_BURP1 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|52427090|gb|AAU47683.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei ATCC 23344]
 gi|76578231|gb|ABA47706.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei 1710b]
          Length = 207

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 155/202 (76%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
           A +D E   LGLVP+VVE + RGERSYDIYSRLLKERIVF+ G++ D  A L+ AQLLFL
Sbjct: 5   APRDFEAQALGLVPIVVETSGRGERSYDIYSRLLKERIVFMVGEVNDQTANLVVAQLLFL 64

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP K+ISLYINSPGG V+AGMAIYDTMQF+KP +ST CMG AASMG+ LL++G KG 
Sbjct: 65  ESENPDKDISLYINSPGGSVSAGMAIYDTMQFVKPDVSTLCMGLAASMGAFLLASGAKGK 124

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R+ALPNAR+++HQP GG  GQASDIE  A++I+ ++ RLN +   + G+  E + +  DR
Sbjct: 125 RYALPNARVMIHQPLGGARGQASDIEIQAREILYLRDRLNHLLAHHTGQDVERIARDTDR 184

Query: 187 DHIMSASEACDWGVVDKVLMSR 208
           D+ MS+ +A  +G++D V   R
Sbjct: 185 DNFMSSEDAKAYGLIDHVSTKR 206


>gi|149376712|ref|ZP_01894470.1| ATP-dependent Clp protease proteolytic subunit [Marinobacter
           algicola DG893]
 gi|149358951|gb|EDM47417.1| ATP-dependent Clp protease proteolytic subunit [Marinobacter
           algicola DG893]
          Length = 227

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 152/193 (78%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVP+V+EQT RGERS+DI+SRLLKER++F+ G +EDHMA LI AQLLFLE+ENP K+I 
Sbjct: 32  GLVPIVIEQTARGERSFDIFSRLLKERVIFLVGPVEDHMANLIVAQLLFLESENPDKDIH 91

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP ++T C+GQAASMG+ LL+ G +G R  LPN+R++
Sbjct: 92  LYINSPGGSVTAGMSIYDTMQFIKPDVATLCVGQAASMGAFLLAGGAEGKRACLPNSRVM 151

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG+ GQA+DIE H ++I+KI+  LN I   + G+  + + K  DRD+ M   +A 
Sbjct: 152 IHQPLGGYQGQATDIEIHTREILKIRHTLNSILAHHTGQKLDTIAKDTDRDNFMDPQQAK 211

Query: 197 DWGVVDKVLMSRI 209
           D+G++D +L  R+
Sbjct: 212 DYGLIDSILDKRV 224


>gi|189424987|ref|YP_001952164.1| ATP-dependent Clp protease proteolytic subunit ClpP [Geobacter
           lovleyi SZ]
 gi|226706453|sp|B3E1Z4|CLPP_GEOLS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|189421246|gb|ACD95644.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Geobacter
           lovleyi SZ]
          Length = 197

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 155/192 (80%)

Query: 19  VPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLY 78
           VPMVVEQ+ RGER+YDIYSRLLKERIVF+ G+I D +A L+ AQLLFLEAE+P K+I LY
Sbjct: 3   VPMVVEQSGRGERAYDIYSRLLKERIVFLGGEINDQVADLVIAQLLFLEAEDPDKDIHLY 62

Query: 79  INSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLH 138
           INSPGGVVTAGMAI+DTM +IK P+ST C+GQAASMG++LL+AGEKG RFALP+ARI++H
Sbjct: 63  INSPGGVVTAGMAIFDTMNYIKAPVSTICIGQAASMGAVLLTAGEKGKRFALPHARIMIH 122

Query: 139 QPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDW 198
           QPSGG  GQA+DI   A++I+++KR LN +     G+  E +E+  +RD  MSA EA ++
Sbjct: 123 QPSGGSRGQATDIMIQAEEILRMKRELNRLLADLSGQPVERLEQDTERDFFMSAEEARNY 182

Query: 199 GVVDKVLMSRID 210
           G++D V+  R D
Sbjct: 183 GLIDAVMTRRPD 194


>gi|222110341|ref|YP_002552605.1| ATP-dependent clp protease proteolytic subunit [Acidovorax ebreus
           TPSY]
 gi|254763789|sp|B9MG14|CLPP_DIAST RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|221729785|gb|ACM32605.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Acidovorax
           ebreus TPSY]
          Length = 202

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 154/193 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG++PMV+EQ+ RGERSYDIYSRLLKER++F+ G++ D  A L+ AQLLFLE+ENP K+I
Sbjct: 9   LGMIPMVIEQSGRGERSYDIYSRLLKERVIFLVGEVNDQTANLVVAQLLFLESENPDKDI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S YINSPGG VTAGMAIYDTMQFIKP +ST C G AASMG+ LL+AG KG R++LPN++I
Sbjct: 69  SFYINSPGGSVTAGMAIYDTMQFIKPDVSTLCCGFAASMGAFLLAAGAKGKRYSLPNSKI 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQ  GG  GQA+DIE HA+DI++ K ++N I  +  G+  E+V+   +RD+ M+A EA
Sbjct: 129 MIHQVLGGARGQATDIEIHARDILRTKDQMNRILAERTGQPIEKVKADTERDYFMTADEA 188

Query: 196 CDWGVVDKVLMSR 208
            D+G+VD+V+  R
Sbjct: 189 KDYGIVDQVIAKR 201


>gi|114152202|sp|Q2L256|CLPP_BORA1 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
          Length = 201

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 117/196 (59%), Positives = 153/196 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG +PMVVEQ+ RGER+YDIYSRLL+ER++F+ G + D  A L+ AQLLFLE+ENP K+I
Sbjct: 6   LGYIPMVVEQSGRGERAYDIYSRLLRERLIFLVGPVNDATANLVVAQLLFLESENPDKDI 65

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S YINSPGG V AGMAI+DTMQF+KP +ST C G AASMG+ LL+AG+KG RF+LPN+RI
Sbjct: 66  SFYINSPGGSVYAGMAIFDTMQFVKPDVSTLCTGLAASMGAFLLAAGKKGKRFSLPNSRI 125

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQASDI+  A++I+ ++ RLN I  +N G++ E +    +RD  MSA +A
Sbjct: 126 MIHQPSGGAQGQASDIQIQAKEILDLRERLNRILAENTGQSMERIAIDTERDTFMSAEDA 185

Query: 196 CDWGVVDKVLMSRIDI 211
             +G+VDKVL  R D+
Sbjct: 186 LSYGLVDKVLARREDV 201


>gi|225714260|gb|ACO12976.1| ATP-dependent Clp protease proteolytic subunit, mitochondrial
           precursor [Lepeophtheirus salmonis]
          Length = 222

 Score =  259 bits (661), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 120/188 (63%), Positives = 159/188 (84%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+VVEQT RGERSYDIYSRLLK+RI+ + GQ++D ++ L+ AQLLFL+AE+ +K I +
Sbjct: 25  LVPIVVEQTGRGERSYDIYSRLLKDRIICLMGQVDDVISGLMVAQLLFLQAESGKKPIHM 84

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAG+AIYDTMQ+I+PPI+T+C+GQA SMGSLLL+AG KGMR +LPN+RI++
Sbjct: 85  YINSPGGSVTAGLAIYDTMQYIQPPIATWCVGQACSMGSLLLTAGTKGMRHSLPNSRIMV 144

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSG   GQASDI+  AQ+I+ ++ RLN IYVK+ G+  + VEK++DRD+ MSA +A  
Sbjct: 145 HQPSGQSHGQASDIQIQAQEILNLRARLNNIYVKHTGQPLDIVEKSMDRDNFMSADDALK 204

Query: 198 WGVVDKVL 205
           +G++DKVL
Sbjct: 205 FGLIDKVL 212


>gi|222528715|ref|YP_002572597.1| ATP-dependent Clp protease proteolytic subunit
           [Caldicellulosiruptor bescii DSM 6725]
 gi|312622971|ref|YP_004024584.1| ATP-dependent clp protease, proteolytic subunit clpp
           [Caldicellulosiruptor kronotskyensis 2002]
 gi|222455562|gb|ACM59824.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Caldicellulosiruptor bescii DSM 6725]
 gi|312203438|gb|ADQ46765.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Caldicellulosiruptor kronotskyensis 2002]
          Length = 195

 Score =  259 bits (661), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 120/192 (62%), Positives = 154/192 (80%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVP+V+EQTNRGER+YDIYSRLLK+RIV ++G+I D +A+LI AQLLFLEAE+P K+I 
Sbjct: 3   ALVPIVIEQTNRGERAYDIYSRLLKDRIVILSGEITDDIASLIVAQLLFLEAEDPDKDIY 62

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAG AIYDTMQ+IKP +ST C+G AASMG+ LL+AG KG RFALPN+ I+
Sbjct: 63  LYINSPGGSVTAGFAIYDTMQYIKPDVSTICVGLAASMGAFLLAAGAKGKRFALPNSEIM 122

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG  GQA+DI+ HA+ I+KIK R+N+I  +  G+  E +E+  DRD  M+A EA 
Sbjct: 123 IHQPLGGVRGQATDIKIHAEWILKIKNRINKILSERTGQPIEVIERDTDRDFFMTAEEAL 182

Query: 197 DWGVVDKVLMSR 208
            +G++DKV+  R
Sbjct: 183 KYGIIDKVIERR 194


>gi|260222837|emb|CBA32804.1| ATP-dependent Clp protease proteolytic subunit [Curvibacter
           putative symbiont of Hydra magnipapillata]
          Length = 220

 Score =  259 bits (661), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 155/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG+VPMV+EQ+ RGERSYDIYSRLLKER++F+ G + D  A L+ AQLLFLE+ENP K+I
Sbjct: 27  LGMVPMVIEQSGRGERSYDIYSRLLKERVIFLVGPVNDQTANLVVAQLLFLESENPDKDI 86

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S YINSPGG V+AGMAIYDTM FIKP +ST C G AASMG+ LL+AG KG RF+LPN+++
Sbjct: 87  SFYINSPGGSVSAGMAIYDTMNFIKPDVSTLCTGMAASMGAFLLAAGAKGKRFSLPNSKV 146

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE HA++I+K + +LN+I  +  G+  E++E+  +RD+ +SA EA
Sbjct: 147 MIHQPLGGTQGQATEIEIHAREILKTREQLNKILAERTGQPLEKIERDTERDYYLSADEA 206

Query: 196 CDWGVVDKVLMSR 208
            ++G+VD+V+  R
Sbjct: 207 KEYGLVDQVIAKR 219


>gi|195051114|ref|XP_001993036.1| GH13604 [Drosophila grimshawi]
 gi|193900095|gb|EDV98961.1| GH13604 [Drosophila grimshawi]
          Length = 255

 Score =  259 bits (661), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 159/205 (77%), Gaps = 1/205 (0%)

Query: 2   SFEG-CAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           SF+  C+ +      + L+PMVVEQT RGER+YDI+SRLLKERI+ + G I D +++ + 
Sbjct: 12  SFQAKCSTQPLSVRGINLIPMVVEQTGRGERAYDIFSRLLKERIICLMGNITDDISSTVV 71

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFL++EN  K I LYINSPGGVVTAG+AIYDTMQ++KPPI+T+C+GQA SMGSLLL+
Sbjct: 72  AQLLFLQSENVNKPIHLYINSPGGVVTAGLAIYDTMQYVKPPIATWCVGQACSMGSLLLA 131

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG  GMR++LPNARI++HQPSGG  GQA+DI  HA++I+KIKR+L  IYVK+    Y E+
Sbjct: 132 AGAPGMRYSLPNARIMIHQPSGGAQGQATDILIHAEEIIKIKRQLTNIYVKHAQYDYAEM 191

Query: 181 EKTLDRDHIMSASEACDWGVVDKVL 205
              ++RDH M+  EA   G++D VL
Sbjct: 192 SSRMERDHFMTPEEAKVLGIIDHVL 216


>gi|254197976|ref|ZP_04904398.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei S13]
 gi|169654717|gb|EDS87410.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei S13]
          Length = 217

 Score =  258 bits (660), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 119/202 (58%), Positives = 155/202 (76%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
           A +D E   LGLVP+VVE + RGERSYDIYSRLLKERIVF+ G++ D  A L+ AQLLFL
Sbjct: 15  APRDFEAQALGLVPIVVETSGRGERSYDIYSRLLKERIVFMVGEVNDQTANLVVAQLLFL 74

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP K+ISLYINSPGG V+AGMAIYDTMQF+KP +ST CMG AASMG+ LL++G +G 
Sbjct: 75  ESENPDKDISLYINSPGGSVSAGMAIYDTMQFVKPDVSTLCMGLAASMGAFLLASGARGK 134

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R+ALPNAR+++HQP GG  GQASDIE  A++I+ ++ RLN +   + G+  E + +  DR
Sbjct: 135 RYALPNARVMIHQPLGGARGQASDIEIQAREILYLRDRLNHLLAHHTGQDVERIARDTDR 194

Query: 187 DHIMSASEACDWGVVDKVLMSR 208
           D+ MS+ +A  +G++D V   R
Sbjct: 195 DNFMSSEDAKAYGLIDHVSTKR 216


>gi|120554758|ref|YP_959109.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Marinobacter
           aquaeolei VT8]
 gi|120324607|gb|ABM18922.1| ATP-dependent Clp protease proteolytic subunit ClpP [Marinobacter
           aquaeolei VT8]
          Length = 211

 Score =  258 bits (660), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 155/193 (80%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVP+V+EQT RGERS+DIYSRLLKER++F+ G +EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 16  GLVPIVIEQTARGERSFDIYSRLLKERVIFLVGPVEDHMANLVVAQLLFLESENPDKDIH 75

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG V+AGM+IYDTMQF+KP ++T C+GQAASMG+ LLS G KG R  LP++R++
Sbjct: 76  LYINSPGGSVSAGMSIYDTMQFVKPDVATLCIGQAASMGAFLLSGGAKGKRACLPHSRVM 135

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG+ GQA+DIE H ++I+KI+  LNE+  ++ G+  E + +  DRD+ M  ++A 
Sbjct: 136 IHQPLGGYQGQATDIEIHTREILKIRNTLNELLAEHTGQDIETIARDTDRDNFMDPAQAK 195

Query: 197 DWGVVDKVLMSRI 209
           ++G++D +L  R+
Sbjct: 196 EYGLIDTILDKRV 208


>gi|124266485|ref|YP_001020489.1| ATP-dependent Clp protease proteolytic subunit ClpP [Methylibium
           petroleiphilum PM1]
 gi|189082491|sp|A2SFB5|CLPP_METPP RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|124259260|gb|ABM94254.1| ATP-dependent Clp protease proteolytic subunit ClpP [Methylibium
           petroleiphilum PM1]
          Length = 202

 Score =  258 bits (660), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 154/193 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG+VP+V+EQ+ RGER+YDIYSRLL+ER++F+ G + D  A L+ AQLLFLE+ENP K+I
Sbjct: 9   LGMVPVVIEQSGRGERAYDIYSRLLRERVIFLVGPVNDQTANLVVAQLLFLESENPDKDI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V+AG++I+DTMQFIKP +ST CMG AASMG+ LL+AG KG RFALPN+R+
Sbjct: 69  SLYINSPGGSVSAGLSIFDTMQFIKPDVSTLCMGIAASMGAFLLAAGAKGKRFALPNSRV 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA+DIE  A++I+K++  LN I  +  G+  E++    +RD+ MSA EA
Sbjct: 129 MIHQPSGGAQGQATDIEIQAREILKLRESLNGILAERTGQPLEKIRADSERDYFMSAEEA 188

Query: 196 CDWGVVDKVLMSR 208
             +G++DKV+  R
Sbjct: 189 TGYGLIDKVIAQR 201


>gi|241764198|ref|ZP_04762232.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Acidovorax
           delafieldii 2AN]
 gi|241366475|gb|EER60979.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Acidovorax
           delafieldii 2AN]
          Length = 202

 Score =  258 bits (660), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 155/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG+VPMV+EQ+ RGERSYDIYSRLLKER++F+ G++ D  A L+ AQLLFLE+ENP K+I
Sbjct: 9   LGMVPMVIEQSGRGERSYDIYSRLLKERVIFLVGEVNDQTANLVVAQLLFLESENPDKDI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S YINSPGG VTAGM+IYDTMQFIKP +ST C+G AASMG+ LL+AG KG RF+LPN+++
Sbjct: 69  SFYINSPGGSVTAGMSIYDTMQFIKPDVSTLCVGFAASMGAFLLAAGAKGKRFSLPNSKV 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQ  GG  GQA+DIE HA+DI++ K ++N I  +  G+  E+V+   +RD+ ++A EA
Sbjct: 129 MIHQVLGGARGQATDIEIHARDILRTKDQMNRILAERTGQPLEKVKADTERDYFLTADEA 188

Query: 196 CDWGVVDKVLMSR 208
            D+G++D+V+  R
Sbjct: 189 KDYGIIDQVIHKR 201


>gi|227486247|ref|ZP_03916563.1| endopeptidase Clp [Anaerococcus lactolyticus ATCC 51172]
 gi|227235658|gb|EEI85673.1| endopeptidase Clp [Anaerococcus lactolyticus ATCC 51172]
          Length = 205

 Score =  258 bits (660), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 152/191 (79%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQTNRGER+YDIYSRLLK+RI+F++G++ D ++ +I AQLLFLE+E+P K+I  
Sbjct: 14  LVPTVIEQTNRGERAYDIYSRLLKDRIIFLSGEVRDEVSDIIIAQLLFLESEDPNKDIHF 73

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G+AIYDTM +IKP +ST C+GQAASMG++LLS+G KG RF+LPN+ I++
Sbjct: 74  YINSPGGVVTSGLAIYDTMNYIKPDVSTICIGQAASMGAVLLSSGAKGKRFSLPNSNIMI 133

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGG  GQASDI   A+ I+KIK  LN I  +N GK    +EK  DRD  M+A EA  
Sbjct: 134 HQPSGGAQGQASDIVIQAEQILKIKANLNRILSENTGKDLATIEKDTDRDFAMTAEEALK 193

Query: 198 WGVVDKVLMSR 208
           +G++DKV+ S 
Sbjct: 194 YGLIDKVIESN 204


>gi|170692395|ref|ZP_02883558.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           graminis C4D1M]
 gi|307729638|ref|YP_003906862.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           sp. CCGE1003]
 gi|323526047|ref|YP_004228200.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           sp. CCGE1001]
 gi|170142825|gb|EDT10990.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           graminis C4D1M]
 gi|307584173|gb|ADN57571.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           sp. CCGE1003]
 gi|323383049|gb|ADX55140.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           sp. CCGE1001]
          Length = 217

 Score =  258 bits (660), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 153/202 (75%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
           + +D E   LGLVP+VVE + RGERSYDIYSRLLKERIVF+ G++ D  A L+ AQ+LFL
Sbjct: 15  SSRDLEAQALGLVPIVVETSGRGERSYDIYSRLLKERIVFLVGEVNDQTANLVVAQMLFL 74

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP K+I  YINSPGG V+AGMAIYDTMQFIKP +ST CMG AASMG+ LL+AG KG 
Sbjct: 75  ESENPDKDIYFYINSPGGSVSAGMAIYDTMQFIKPDVSTLCMGLAASMGAFLLAAGAKGK 134

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RFALPN+R+++HQP GG  GQASDIE  A++I+ +K RLN +   + G+  E + +  DR
Sbjct: 135 RFALPNSRVMIHQPLGGARGQASDIEIQAREILYLKERLNHLLAHHTGQPVERIARDTDR 194

Query: 187 DHIMSASEACDWGVVDKVLMSR 208
           D+ MS  +A  +G+VD+V   R
Sbjct: 195 DNFMSGDDAQAYGLVDQVAHKR 216


>gi|18310375|ref|NP_562309.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           perfringens str. 13]
 gi|110799833|ref|YP_696088.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           perfringens ATCC 13124]
 gi|110803073|ref|YP_698704.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           perfringens SM101]
 gi|168207806|ref|ZP_02633811.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           perfringens E str. JGS1987]
 gi|168212102|ref|ZP_02637727.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           perfringens B str. ATCC 3626]
 gi|168215325|ref|ZP_02640950.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           perfringens CPE str. F4969]
 gi|168217824|ref|ZP_02643449.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           perfringens NCTC 8239]
 gi|169342288|ref|ZP_02863366.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           perfringens C str. JGS1495]
 gi|182627116|ref|ZP_02954834.1| CAAX amino terminal protease family protein [Clostridium
           perfringens D str. JGS1721]
 gi|21759067|sp|Q8XKK1|CLPP_CLOPE RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|123146116|sp|Q0ST53|CLPP_CLOPS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|123148745|sp|Q0TQK2|CLPP_CLOP1 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|18145055|dbj|BAB81099.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           perfringens str. 13]
 gi|110674480|gb|ABG83467.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           perfringens ATCC 13124]
 gi|110683574|gb|ABG86944.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           perfringens SM101]
 gi|169299615|gb|EDS81674.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           perfringens C str. JGS1495]
 gi|170660863|gb|EDT13546.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           perfringens E str. JGS1987]
 gi|170709986|gb|EDT22168.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           perfringens B str. ATCC 3626]
 gi|170713287|gb|EDT25469.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           perfringens CPE str. F4969]
 gi|177907505|gb|EDT70163.1| CAAX amino terminal protease family protein [Clostridium
           perfringens D str. JGS1721]
 gi|182380151|gb|EDT77630.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           perfringens NCTC 8239]
          Length = 194

 Score =  258 bits (660), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 156/188 (82%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQT++GERSYDI+SRLLK+RI+ ++G++ D  A L+ AQLLFLE+E+P K+I L
Sbjct: 4   LVPMVVEQTSKGERSYDIFSRLLKDRIIMLSGEVNDVTANLVVAQLLFLESEDPDKDIHL 63

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG +T+GMAIYDTMQ+IKP +ST C+G AASMG+ LLS+G KG RFALPNA I++
Sbjct: 64  YINSPGGSITSGMAIYDTMQYIKPDVSTICIGMAASMGAFLLSSGAKGKRFALPNAEIMI 123

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQA+DI+ HA+ I+KIK +LN+I  +N  +  E+++  ++RD+ M ASEA +
Sbjct: 124 HQPLGGFQGQATDIDIHAKRILKIKDKLNQILSENTNQPLEKIKVDVERDYFMEASEAVE 183

Query: 198 WGVVDKVL 205
           +G++DKV+
Sbjct: 184 YGLIDKVI 191


>gi|319787636|ref|YP_004147111.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Pseudoxanthomonas suwonensis 11-1]
 gi|317466148|gb|ADV27880.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Pseudoxanthomonas suwonensis 11-1]
          Length = 209

 Score =  258 bits (660), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 165/195 (84%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           L LVPMVVEQT+RGER+YDIYSRLLKER++F+ G +EDH+A +I AQ+LFLEAENP+K+I
Sbjct: 9   LNLVPMVVEQTSRGERAYDIYSRLLKERVIFLVGPVEDHVANVIIAQMLFLEAENPEKDI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG+VTAGMAIYDTMQ+IKP +ST C+GQAASMG++LL+AG  G R+ALPN+R+
Sbjct: 69  SLYINSPGGLVTAGMAIYDTMQYIKPDVSTICVGQAASMGAVLLAAGAAGKRYALPNSRV 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI+ HA++I+ ++ RLNEI  ++ G++ E + +  +RD+  SA+EA
Sbjct: 129 MIHQPLGGFQGQATDIDIHAREILSMRARLNEILAQHTGQSIETIARDTERDNFKSAAEA 188

Query: 196 CDWGVVDKVLMSRID 210
             +G+VD+VL  R D
Sbjct: 189 KAYGLVDEVLERRPD 203


>gi|302871325|ref|YP_003839961.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Caldicellulosiruptor obsidiansis OB47]
 gi|302574184|gb|ADL41975.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Caldicellulosiruptor obsidiansis OB47]
          Length = 195

 Score =  258 bits (659), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 119/192 (61%), Positives = 154/192 (80%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVP+V+EQTNRGER+YDIYSRLLK+RIV ++G+I D +A+LI AQLLFLEAE+P K+I 
Sbjct: 3   ALVPIVIEQTNRGERAYDIYSRLLKDRIVILSGEITDDIASLIVAQLLFLEAEDPDKDIY 62

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAG AIYDTMQ+IKP +ST C+G AASMG+ LL+AG KG RFALPN+ I+
Sbjct: 63  LYINSPGGSVTAGFAIYDTMQYIKPDVSTICVGMAASMGAFLLAAGAKGKRFALPNSEIM 122

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG  GQA+DI+ HA+ I+KIK R+N+I  +  G+  E +E+  DRD  M+A EA 
Sbjct: 123 IHQPLGGVRGQATDIKIHAEWILKIKNRINKILSERTGQPIEVIERDTDRDFFMTAEEAL 182

Query: 197 DWGVVDKVLMSR 208
            +G++D+V+  R
Sbjct: 183 KYGIIDRVIERR 194


>gi|188590743|ref|YP_001921998.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum E3 str. Alaska E43]
 gi|251778109|ref|ZP_04821029.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum E1 str. 'BoNT E Beluga']
 gi|226706443|sp|B2UX13|CLPP_CLOBA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|188501024|gb|ACD54160.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum E3 str. Alaska E43]
 gi|243082424|gb|EES48314.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum E1 str. 'BoNT E Beluga']
          Length = 199

 Score =  258 bits (659), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 117/190 (61%), Positives = 154/190 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDI+SRLLKERI+ ++G++ D  + LI +QLLFLE+E+P K+I
Sbjct: 1   MSLVPMVVEQTSRGERSYDIFSRLLKERIIMLSGEVNDDSSNLIVSQLLFLESEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S+YINSPGG +TAGMAIYDTMQ+IKP +ST C+G AASMG+ LLS+G KG R+ALPNA I
Sbjct: 61  SIYINSPGGSITAGMAIYDTMQYIKPDVSTICVGMAASMGAFLLSSGAKGKRYALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI+ HA  I+KIK  LN+I  +N  +  E +E  ++RD+ M+A EA
Sbjct: 121 MIHQPLGGFQGQATDIQIHANRILKIKESLNKILSENTNQPLEVIEADVERDNFMTADEA 180

Query: 196 CDWGVVDKVL 205
             +G+VDKV+
Sbjct: 181 KAYGLVDKVI 190


>gi|268680774|ref|YP_003305205.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Sulfurospirillum deleyianum DSM 6946]
 gi|268618805|gb|ACZ13170.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Sulfurospirillum deleyianum DSM 6946]
          Length = 196

 Score =  258 bits (659), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 155/187 (82%)

Query: 19  VPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLY 78
           VP+VVE+T RGERSYDIYSRLLK+RI+ ++G+I D +A+ I AQLLFLEAE+P+K+I LY
Sbjct: 5   VPVVVEKTGRGERSYDIYSRLLKDRIIMLSGEINDVVASSIVAQLLFLEAEDPEKDIYLY 64

Query: 79  INSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLH 138
           INSPGGV+T+G +IYDTM +IKP IST C+GQAASMG+ LLSAG KG R+ALPNARI++H
Sbjct: 65  INSPGGVITSGFSIYDTMNYIKPDISTICIGQAASMGAFLLSAGTKGKRYALPNARIMIH 124

Query: 139 QPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDW 198
           QP GG  GQA+DIE  A++I+++K+ LNEI  KNC +   ++ K  +RD  MSA E+C++
Sbjct: 125 QPLGGAQGQATDIEIQAKEILRMKQVLNEILAKNCNQKLPKIIKDTERDFFMSAEESCEY 184

Query: 199 GVVDKVL 205
           G++DKVL
Sbjct: 185 GLIDKVL 191


>gi|209521458|ref|ZP_03270166.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           sp. H160]
 gi|209498114|gb|EDZ98261.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           sp. H160]
          Length = 217

 Score =  258 bits (659), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 153/202 (75%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
           + +D E   LGLVP+VVE + RGERSYDIYSRLLKERIVF+ G++ D  A L+ AQ+LFL
Sbjct: 15  SSRDLETQALGLVPIVVETSGRGERSYDIYSRLLKERIVFLVGEVNDQTANLVVAQMLFL 74

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP K+I  YINSPGG V+AGMAIYDTMQFIKP +ST CMG AASMG+ LL+AG KG 
Sbjct: 75  ESENPDKDIYFYINSPGGSVSAGMAIYDTMQFIKPDVSTLCMGLAASMGAFLLAAGAKGK 134

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RFALPN+R+++HQP GG  GQASDIE  A++I+ +K RLN +   + G+  E + +  DR
Sbjct: 135 RFALPNSRVMIHQPLGGARGQASDIEIQAREILYLKDRLNHLLAHHTGQPVERIARDTDR 194

Query: 187 DHIMSASEACDWGVVDKVLMSR 208
           D+ MS  +A  +G+VD+V   R
Sbjct: 195 DNFMSGDDAQAYGLVDQVAHKR 216


>gi|319760381|ref|YP_004124319.1| ATP-dependent Clp protease, proteolytic subunit [Candidatus
           Blochmannia vafer str. BVAF]
 gi|318039095|gb|ADV33645.1| ATP-dependent Clp protease, proteolytic subunit [Candidatus
           Blochmannia vafer str. BVAF]
          Length = 215

 Score =  258 bits (659), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 157/194 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +G++P+V+EQT RGER+YDI+S LLKERI+F+T  IE+H A  I AQ++FLE+ENP K+I
Sbjct: 21  MGIIPIVIEQTARGERAYDIFSLLLKERIIFITDTIENHTANSIVAQMMFLESENPTKDI 80

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG++TAGM+IYDT+QFIKP +ST+CMGQAASMG+ LL+AG KG RF LPNAR+
Sbjct: 81  HLYINSPGGLITAGMSIYDTIQFIKPDVSTYCMGQAASMGAFLLAAGAKGKRFCLPNARV 140

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP G F GQA+DI  H ++I+++K  +N++  K+ GK+ + V K ++RD  +SA EA
Sbjct: 141 MIHQPLGSFQGQATDIAIHTKEILQVKNNINKLIAKHTGKSIDIVIKDMERDCFLSADEA 200

Query: 196 CDWGVVDKVLMSRI 209
            D+G+VD VL  RI
Sbjct: 201 MDYGLVDCVLSKRI 214


>gi|119503321|ref|ZP_01625405.1| ATP-dependent Clp protease proteolytic subunit [marine gamma
           proteobacterium HTCC2080]
 gi|119460967|gb|EAW42058.1| ATP-dependent Clp protease proteolytic subunit [marine gamma
           proteobacterium HTCC2080]
          Length = 212

 Score =  258 bits (659), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 117/200 (58%), Positives = 156/200 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGL+PMV+EQT+RGERS+DIYSRLLKER++F  G +ED+MA LI AQLLFLE+ENP K+I
Sbjct: 13  LGLIPMVIEQTSRGERSFDIYSRLLKERVIFAVGPVEDNMANLIVAQLLFLESENPDKDI 72

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAG++IYDTMQF+KP +ST C+GQAASMG+ LLS G  G R+ LPNAR 
Sbjct: 73  HLYINSPGGSVTAGLSIYDTMQFVKPDVSTMCLGQAASMGAFLLSGGASGKRYILPNART 132

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA+DI+  A++I+ I+ RLN +  ++ G+  E +E+  +RD  M A ++
Sbjct: 133 MIHQPSGGAQGQATDIDIQAKEILIIRERLNRLMAEHTGQPLEVIERDTERDRFMDAEQS 192

Query: 196 CDWGVVDKVLMSRIDIEEKS 215
             +G+VD V+ +R  + E S
Sbjct: 193 QSYGLVDHVVNNREVVAEDS 212


>gi|52842086|ref|YP_095885.1| ATP-dependent Clp protease proteolytic subunit [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|54297778|ref|YP_124147.1| ATP-dependent Clp protease proteolytic subunit [Legionella
           pneumophila str. Paris]
 gi|296107452|ref|YP_003619152.1| Protease subunit of ATP-dependent Clp protease [Legionella
           pneumophila 2300/99 Alcoy]
 gi|67460220|sp|Q5X451|CLPP_LEGPA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|67460230|sp|Q5ZUD9|CLPP_LEGPH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|52629197|gb|AAU27938.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|53751563|emb|CAH12981.1| ATP-dependent Clp protease proteolytic subunit [Legionella
           pneumophila str. Paris]
 gi|295649353|gb|ADG25200.1| Protease subunit of ATP-dependent Clp protease [Legionella
           pneumophila 2300/99 Alcoy]
          Length = 214

 Score =  258 bits (659), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 122/192 (63%), Positives = 162/192 (84%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GL+PMV+EQT+RGERSYDIYSRLLKERI+F+ G++EDHMA L+ AQLLFLE+ENP+K+IS
Sbjct: 14  GLIPMVIEQTSRGERSYDIYSRLLKERIIFLLGEVEDHMANLVVAQLLFLESENPEKDIS 73

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGVVTAG+AIYDTMQFIKP +ST C+GQAAS  +LLL AG +G RF LPN+R++
Sbjct: 74  LYINSPGGVVTAGLAIYDTMQFIKPDVSTLCIGQAASAAALLLCAGAEGKRFCLPNSRVM 133

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG+ GQA+DIE HA++ + ++ RLN I  K+  KT +++ +  +RD+ MSA++A 
Sbjct: 134 IHQPLGGYRGQATDIEIHARETLAVRERLNNIMAKHTKKTPDQIMRDTERDNFMSATQAM 193

Query: 197 DWGVVDKVLMSR 208
           ++G++DKVL  R
Sbjct: 194 EYGLIDKVLYDR 205


>gi|332041211|gb|EGI77575.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Hylemonella
           gracilis ATCC 19624]
          Length = 194

 Score =  258 bits (659), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 113/193 (58%), Positives = 157/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +G+VP+V+EQ+ RGERSYDIYSRLL+ER++F+ G + D  A L+ AQLLFLE+ENP KEI
Sbjct: 1   MGMVPIVIEQSGRGERSYDIYSRLLRERVIFLVGPVNDQTANLVVAQLLFLESENPDKEI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V+AGM+I+DTM FIKP +ST C+G AASMG+ LL+AG KG RF+LPN++I
Sbjct: 61  SLYINSPGGSVSAGMSIFDTMNFIKPDVSTLCIGMAASMGAFLLAAGAKGKRFSLPNSKI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE HA++I+K + +LN+I  +  G+  E++E+  +RD+ +SA EA
Sbjct: 121 MIHQPLGGAQGQATEIEIHAREILKTREQLNKILAERTGQPLEKIERDTERDYYLSADEA 180

Query: 196 CDWGVVDKVLMSR 208
            D+G+VD+V+  R
Sbjct: 181 KDYGLVDQVIAKR 193


>gi|27904898|ref|NP_778024.1| ATP-dependent Clp protease proteolytic subunit [Buchnera aphidicola
           str. Bp (Baizongia pistaciae)]
 gi|31076632|sp|Q89AA1|CLPP_BUCBP RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|27904296|gb|AAO27129.1| ATP-dependent Clp protease proteolytic subunit [Buchnera aphidicola
           str. Bp (Baizongia pistaciae)]
          Length = 205

 Score =  258 bits (659), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 112/191 (58%), Positives = 159/191 (83%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           L+PMV+E+T+ GERSYDIYSRLLKERI+F+TG I+D+ A LI AQ+LFLEAEN +++I +
Sbjct: 14  LIPMVIEKTSYGERSYDIYSRLLKERIIFLTGTIDDNTANLIVAQMLFLEAENAKQDIYI 73

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGV+TAGM+IYDTM+FIKP ++T C+GQA SM +L+L+AG+KG R+ LPN+RI++
Sbjct: 74  YINSPGGVITAGMSIYDTMKFIKPNVNTICIGQACSMAALILTAGKKGYRYCLPNSRIMI 133

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG++GQASDIE HA++I+K+KR+LNE+   +  ++   +EK  +RD  +SA++A  
Sbjct: 134 HQPIGGYNGQASDIEIHAKEIIKVKRKLNELMAFHTSQSINTIEKDTERDCFLSANQAIK 193

Query: 198 WGVVDKVLMSR 208
           +G++D +L  R
Sbjct: 194 YGLIDTILSYR 204


>gi|118444381|ref|YP_878863.1| ATP-dependent Clp protease proteolytic subunit [Clostridium novyi
           NT]
 gi|166201817|sp|A0Q2L1|CLPP_CLONN RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|118134837|gb|ABK61881.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           novyi NT]
          Length = 195

 Score =  258 bits (658), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 119/193 (61%), Positives = 154/193 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGERSYDIYSRLLK+RI+F+  ++ D  A+L+ AQLLFLEAE+P K+I
Sbjct: 1   MSLVPVVVEQTNRGERSYDIYSRLLKDRIIFLGEEVNDVTASLVVAQLLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +TAGMAIYDTMQ+IKP +ST C+G AASMG+ LL+AG KG RFALPN+ I
Sbjct: 61  YLYINSPGGSITAGMAIYDTMQYIKPDVSTICIGMAASMGAFLLTAGAKGKRFALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI  HA  I+KIK +LN I  +  G+  E ++K ++RD+ M A EA
Sbjct: 121 MIHQPLGGFQGQATDIGIHANRILKIKDKLNSILSERTGQPLEVIKKDVERDNFMEAEEA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++D V+ SR
Sbjct: 181 KEYGLIDDVITSR 193


>gi|295676517|ref|YP_003605041.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           sp. CCGE1002]
 gi|295436360|gb|ADG15530.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           sp. CCGE1002]
          Length = 217

 Score =  258 bits (658), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 153/202 (75%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
           + +D E   LGLVP+VVE + RGERSYDIYSRLLKERIVF+ G++ D  A L+ AQ+LFL
Sbjct: 15  SSRDLEAQALGLVPIVVETSGRGERSYDIYSRLLKERIVFLVGEVNDQTANLVVAQMLFL 74

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP K+I  YINSPGG V+AGMAIYDTMQFIKP +ST CMG AASMG+ LL+AG KG 
Sbjct: 75  ESENPDKDIYFYINSPGGSVSAGMAIYDTMQFIKPDVSTLCMGLAASMGAFLLAAGAKGK 134

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RFALPN+R+++HQP GG  GQASDIE  A++I+ +K RLN +   + G+  E + +  DR
Sbjct: 135 RFALPNSRVMIHQPLGGARGQASDIEIQAREILYLKDRLNHLLAHHTGQPVERIARDTDR 194

Query: 187 DHIMSASEACDWGVVDKVLMSR 208
           D+ MS  +A  +G+VD+V   R
Sbjct: 195 DNFMSGDDAQAYGLVDQVAHKR 216


>gi|187928950|ref|YP_001899437.1| ATP-dependent Clp protease proteolytic subunit [Ralstonia pickettii
           12J]
 gi|241663134|ref|YP_002981494.1| ATP-dependent Clp protease proteolytic subunit [Ralstonia pickettii
           12D]
 gi|309781948|ref|ZP_07676679.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Ralstonia sp.
           5_7_47FAA]
 gi|187725840|gb|ACD27005.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Ralstonia
           pickettii 12J]
 gi|240865161|gb|ACS62822.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Ralstonia
           pickettii 12D]
 gi|308919292|gb|EFP64958.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Ralstonia sp.
           5_7_47FAA]
          Length = 215

 Score =  258 bits (658), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 155/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVPMVVEQ+ RGER+YDIYSRLLKER++F+ G++ D  A L+ AQLLFLE+ENP K+I
Sbjct: 23  LGLVPMVVEQSGRGERAYDIYSRLLKERVIFMVGEVNDQTANLVVAQLLFLESENPDKDI 82

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V++G+A+YDTMQFIKP +ST CMG AASMG+ LL+AG KG R ALPN+RI
Sbjct: 83  SLYINSPGGSVSSGLAMYDTMQFIKPDVSTLCMGMAASMGAFLLAAGAKGKRLALPNSRI 142

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDIE  A++I+ ++ RLN +  +  G+  +++ +  DRD+ MS+ +A
Sbjct: 143 MIHQPLGGARGQASDIEIQAREILYLRERLNTVLSEVTGQPVDKIARDTDRDNFMSSEQA 202

Query: 196 CDWGVVDKVLMSR 208
            ++G++D+V+  R
Sbjct: 203 KEYGLIDQVIAKR 215


>gi|298707749|emb|CBJ26066.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Ectocarpus
           siliculosus]
          Length = 243

 Score =  258 bits (658), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 157/202 (77%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
           A   +  V +  +PMV+E T RGER+YDIYSRLL+ERI+ + G + + M +L+ AQLLFL
Sbjct: 31  AYSSTRRVEMNYLPMVLESTPRGERAYDIYSRLLRERIICMHGPVTEQMTSLVTAQLLFL 90

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP K I++YINSPGGVVTAG+AIYDTMQ+++P I T CMGQAASMGSLLL+AG   M
Sbjct: 91  ESENPDKPINMYINSPGGVVTAGLAIYDTMQYVRPEICTICMGQAASMGSLLLTAGSPEM 150

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RF LPNA+++LHQPSGG +G A+DI   A++I+K + RLN+IY ++ G+   E+EK +DR
Sbjct: 151 RFILPNAKVMLHQPSGGANGMAADIAIMAEEIIKTRARLNDIYAEHTGREVGEIEKVMDR 210

Query: 187 DHIMSASEACDWGVVDKVLMSR 208
           D  M+A EA ++GVVDK+L  R
Sbjct: 211 DFYMTAQEAIEFGVVDKILKKR 232


>gi|197117660|ref|YP_002138087.1| ATP-dependent Clp protease proteolytic subunit [Geobacter
           bemidjiensis Bem]
 gi|226706452|sp|B5EI27|CLPP_GEOBB RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|197087020|gb|ACH38291.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Geobacter
           bemidjiensis Bem]
          Length = 199

 Score =  258 bits (658), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 115/192 (59%), Positives = 157/192 (81%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+VVEQT RGERSYDIYSRLLK+RI+F+ G I+D++A L+ AQLLFLEAE+P K+I L
Sbjct: 2   LVPIVVEQTGRGERSYDIYSRLLKDRIIFLGGGIDDNVANLVIAQLLFLEAEDPDKDIHL 61

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVTAGMAIYDTM++IK P+ST C+GQAASMG+ LLS GEKG R++L N+RI++
Sbjct: 62  YINSPGGVVTAGMAIYDTMRYIKAPVSTICVGQAASMGAFLLSGGEKGKRYSLVNSRIMI 121

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQA+DI  HA++I+++K +LN +  ++ G++ E+V    +RD+ MS  EA +
Sbjct: 122 HQPLGGFQGQATDIHIHAKEILRMKDQLNALLAEHTGQSVEKVAADTERDYFMSGEEAKN 181

Query: 198 WGVVDKVLMSRI 209
           +G++D ++   +
Sbjct: 182 YGIIDAIVTRNV 193


>gi|148359406|ref|YP_001250613.1| ATP-dependent Clp protease proteolytic subunit ClpP [Legionella
           pneumophila str. Corby]
 gi|166201828|sp|A5ID17|CLPP_LEGPC RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|148281179|gb|ABQ55267.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Legionella
           pneumophila str. Corby]
          Length = 214

 Score =  258 bits (658), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 122/192 (63%), Positives = 162/192 (84%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GL+PMV+EQT+RGERSYDIYSRLLKERI+F+ G++EDHMA L+ AQLLFLE+ENP+K+IS
Sbjct: 14  GLIPMVIEQTSRGERSYDIYSRLLKERIIFLLGEVEDHMANLVVAQLLFLESENPEKDIS 73

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGVVTAG+AIYDTMQFIKP +ST C+GQAAS  +LLL AG +G RF LPN+R++
Sbjct: 74  LYINSPGGVVTAGLAIYDTMQFIKPDVSTLCIGQAASAAALLLCAGAEGKRFCLPNSRVM 133

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG+ GQA+DIE HA++ + ++ RLN I  K+  KT +++ +  +RD+ MSA++A 
Sbjct: 134 IHQPLGGYRGQATDIEIHARETLAVRERLNNIMAKHTKKTPDQIMRDTERDNFMSATQAM 193

Query: 197 DWGVVDKVLMSR 208
           ++G++DKVL  R
Sbjct: 194 EYGLIDKVLYDR 205


>gi|225175200|ref|ZP_03729196.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Dethiobacter
           alkaliphilus AHT 1]
 gi|225169376|gb|EEG78174.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Dethiobacter
           alkaliphilus AHT 1]
          Length = 193

 Score =  258 bits (658), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 158/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQTNRGER+YDIYSRLLK+RI+F+   I+D++A L+ AQLLFLE+E+P+K+I
Sbjct: 1   MNLVPMVVEQTNRGERAYDIYSRLLKDRIIFIGSPIDDNVANLVIAQLLFLESEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           ++Y+NSPGG V AG+AIYDTMQ+IKP +ST C+G AASMG++LL+AG  G RF+LPN+RI
Sbjct: 61  NIYVNSPGGSVYAGLAIYDTMQYIKPDVSTICVGLAASMGAVLLAAGADGKRFSLPNSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA DIE HA++I++I+ RLNEI   + GK  E++ +  DRD+ MSA +A
Sbjct: 121 MVHQPLGGAQGQAVDIEIHAKEILRIRERLNEILSGHTGKPVEQIARDTDRDYFMSAEQA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++D VL  R
Sbjct: 181 KEYGLIDGVLEKR 193


>gi|254456794|ref|ZP_05070222.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Campylobacterales bacterium GD 1]
 gi|207085586|gb|EDZ62870.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Campylobacterales bacterium GD 1]
          Length = 196

 Score =  258 bits (658), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 116/191 (60%), Positives = 159/191 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +  +P VVE+T RGERSYDIYSRLLK+RI+ ++G++ D +A+ I AQ+LFLEAE+P+K+I
Sbjct: 1   MSYIPYVVEKTGRGERSYDIYSRLLKDRIIMLSGEVNDAVASSIVAQMLFLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
             YINSPGGVVTAGMAI+DTM +I+P I+T C+GQAASMG+ LLS+GEKG R+ALP+ARI
Sbjct: 61  YFYINSPGGVVTAGMAIFDTMNYIRPHITTICIGQAASMGAFLLSSGEKGKRYALPHARI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI   A++I+++K  LNEI  KN G++ ++VEK  DRD+ MSASEA
Sbjct: 121 MIHQPLGGAQGQATDIAIQAKEILRMKAELNEILAKNTGQSVKKVEKDTDRDNFMSASEA 180

Query: 196 CDWGVVDKVLM 206
            ++G++D+VL+
Sbjct: 181 QEYGMIDEVLV 191


>gi|270156951|ref|ZP_06185608.1| ATP-dependent Clp protease proteolytic subunit ClpP [Legionella
           longbeachae D-4968]
 gi|289164625|ref|YP_003454763.1| ATP-dependent Clp protease proteolytic subunit [Legionella
           longbeachae NSW150]
 gi|269988976|gb|EEZ95230.1| ATP-dependent Clp protease proteolytic subunit ClpP [Legionella
           longbeachae D-4968]
 gi|288857798|emb|CBJ11642.1| ATP-dependent Clp protease proteolytic subunit [Legionella
           longbeachae NSW150]
          Length = 212

 Score =  258 bits (658), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 122/192 (63%), Positives = 161/192 (83%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMV+EQT+RGERSYDIYSRLLKERI+F+ G++EDHMA L+ AQLLFLE+ENP+K+IS
Sbjct: 14  GLVPMVIEQTSRGERSYDIYSRLLKERIIFLLGEVEDHMANLVVAQLLFLESENPEKDIS 73

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGVVTAG+AIYDT+QFIKP +ST C+GQAAS  +LLL AG  G RF LPN+R++
Sbjct: 74  LYINSPGGVVTAGLAIYDTIQFIKPDVSTLCIGQAASAAALLLCAGADGKRFCLPNSRVM 133

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG+ GQA+DIE HA++ + ++ RLN I  K+  KT +++ +  +RD+ MSA++A 
Sbjct: 134 IHQPLGGYRGQATDIEIHARETLTVRERLNNIMAKHTKKTPDQIMRDTERDNFMSATQAV 193

Query: 197 DWGVVDKVLMSR 208
           ++G++DKVL  R
Sbjct: 194 EYGLIDKVLYDR 205


>gi|171059225|ref|YP_001791574.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Leptothrix
           cholodnii SP-6]
 gi|226706459|sp|B1Y6H3|CLPP_LEPCP RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|170776670|gb|ACB34809.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Leptothrix
           cholodnii SP-6]
          Length = 202

 Score =  258 bits (658), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 155/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG+VP+V+EQ+ RGER+YDIYSRLL+ER++F+ G + D  A L+ AQLLFLE+ENP K+I
Sbjct: 9   LGMVPIVIEQSGRGERAYDIYSRLLRERVIFLVGPVNDQSANLVVAQLLFLESENPDKDI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S YINSPGG V+AGM+IYDTMQFIKP +ST CMG AASMG+ LL+AG KG RF+LPN++I
Sbjct: 69  SFYINSPGGSVSAGMSIYDTMQFIKPQVSTLCMGLAASMGAFLLAAGAKGKRFSLPNSKI 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DIE HA++I+K + +LN I  +  G++ E+++   +RD+ MS+ EA
Sbjct: 129 MIHQPLGGAQGQATDIEIHAREILKTREQLNRILAERTGQSLEKIQNDTERDYFMSSEEA 188

Query: 196 CDWGVVDKVLMSR 208
             +G++D+V+  R
Sbjct: 189 QTYGLIDQVISKR 201


>gi|289523086|ref|ZP_06439940.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
 gi|289503629|gb|EFD24793.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
          Length = 194

 Score =  257 bits (657), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 153/191 (80%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+V+EQT RGER+YDIYSRLLK+RI+F+   IE+H+A L+ AQ+LFLE+E+P K+I+L
Sbjct: 4   LVPIVIEQTGRGERAYDIYSRLLKDRIIFLGDVIEEHLANLVVAQMLFLESEDPDKDINL 63

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAG+ IYDTMQ+IK P+ST C+GQAASM ++LL+AG KG R ALPN+R++L
Sbjct: 64  YINSPGGSVTAGLGIYDTMQYIKCPVSTICVGQAASMAAVLLAAGAKGKRIALPNSRVML 123

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG  GQA+DIE HA++I KI+ RLNEI   +  +  E+V K  DRD  MSA EA  
Sbjct: 124 HQPLGGVQGQATDIEIHAKEIKKIRDRLNEIIAYHTNQDIEKVAKDTDRDFFMSAEEALA 183

Query: 198 WGVVDKVLMSR 208
           +G+VDKV+  R
Sbjct: 184 YGIVDKVIEKR 194


>gi|227500202|ref|ZP_03930271.1| endopeptidase Clp [Anaerococcus tetradius ATCC 35098]
 gi|227217724|gb|EEI83028.1| endopeptidase Clp [Anaerococcus tetradius ATCC 35098]
          Length = 197

 Score =  257 bits (657), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 114/191 (59%), Positives = 156/191 (81%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP VVEQTNRGER+YDIYSRLLK+RI+F++G++ D ++ +I AQLLFLE+E+P K+I  
Sbjct: 7   LVPTVVEQTNRGERAYDIYSRLLKDRIIFLSGEVRDEISDIIIAQLLFLESEDPDKDIQF 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G+AIYDTM +IKP +ST C+GQAASM ++LLS+G KG R++LP++ I++
Sbjct: 67  YINSPGGVVTSGLAIYDTMNYIKPDVSTICIGQAASMAAVLLSSGAKGKRYSLPSSNIMI 126

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGG  GQASDI   A+ I+KIK +LN+I   N G++ +++EK  DRD  M+A EA  
Sbjct: 127 HQPSGGAQGQASDIVIQAEQIIKIKEKLNKILSDNTGQSLKKIEKDTDRDFAMTAEEALK 186

Query: 198 WGVVDKVLMSR 208
           +G++DKV+ S+
Sbjct: 187 YGLIDKVIESK 197


>gi|319943618|ref|ZP_08017899.1| ATP-dependent Clp protease proteolytic subunit [Lautropia mirabilis
           ATCC 51599]
 gi|319742851|gb|EFV95257.1| ATP-dependent Clp protease proteolytic subunit [Lautropia mirabilis
           ATCC 51599]
          Length = 262

 Score =  257 bits (657), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 113/200 (56%), Positives = 157/200 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG+VP+V+EQ+ RGER+YDIYSRLL+ER+VF+ G + D  A L  AQ+L+LE+ENP K+I
Sbjct: 58  LGMVPIVIEQSGRGERAYDIYSRLLRERVVFLVGPVMDQSANLAVAQMLYLESENPDKDI 117

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
             YINSPGG V+AG+ I+DTMQF+KP +ST C+G AASMG+ LL+AG KG R +LPN+RI
Sbjct: 118 HFYINSPGGSVSAGLGIFDTMQFVKPDVSTLCIGFAASMGAFLLAAGAKGKRHSLPNSRI 177

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQASDIE HA++I+ +++RLN+I     G+  E +E+  +RD+ MSA EA
Sbjct: 178 MIHQPSGGAQGQASDIEIHAKEIIYLRKRLNQILADRTGQPLERIERDTERDNFMSADEA 237

Query: 196 CDWGVVDKVLMSRIDIEEKS 215
            ++G++DKV+ SR +   K+
Sbjct: 238 LEYGLIDKVMTSRTEATAKA 257


>gi|224367556|ref|YP_002601719.1| ClpP1 [Desulfobacterium autotrophicum HRM2]
 gi|259585947|sp|C0QGT0|CLPP_DESAH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|223690272|gb|ACN13555.1| ClpP1 [Desulfobacterium autotrophicum HRM2]
          Length = 205

 Score =  257 bits (657), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 115/196 (58%), Positives = 161/196 (82%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           L+PMVVEQ+NRGER+YDIYSRLLK+RI+F+   ++D +A LI AQLLFLE+E+P+K+I+ 
Sbjct: 3   LIPMVVEQSNRGERAYDIYSRLLKDRIIFLGSAMDDEVANLIVAQLLFLESEDPEKDINF 62

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVTAGMA+YDTMQ+IKP ++T C+GQAASMG+LLL+AG KG RF+LPN+RI++
Sbjct: 63  YINSPGGVVTAGMAVYDTMQYIKPDVATVCIGQAASMGALLLAAGAKGKRFSLPNSRIMI 122

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG  GQASDI+  A +I+++K  L+ I  K+ G+ ++++ +  DRD  MS  +A +
Sbjct: 123 HQPLGGAQGQASDIKIQANEILRMKEVLSGILSKHTGQNFDKISEDTDRDFFMSGDQAKE 182

Query: 198 WGVVDKVLMSRIDIEE 213
           +G+VD V+ SR ++E+
Sbjct: 183 YGLVDHVVASRDELEK 198


>gi|54294748|ref|YP_127163.1| ATP-dependent Clp protease proteolytic subunit [Legionella
           pneumophila str. Lens]
 gi|67460216|sp|Q5WVJ0|CLPP_LEGPL RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|53754580|emb|CAH16064.1| ATP-dependent Clp protease proteolytic subunit [Legionella
           pneumophila str. Lens]
 gi|307610564|emb|CBX00152.1| ATP-dependent Clp protease proteolytic subunit [Legionella
           pneumophila 130b]
          Length = 214

 Score =  257 bits (657), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 122/192 (63%), Positives = 161/192 (83%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GL+PMV+EQT+RGERSYDIYSRLLKERI+F+ G++EDHMA L+ AQLLFLE+ENP+K+IS
Sbjct: 14  GLIPMVIEQTSRGERSYDIYSRLLKERIIFLLGEVEDHMANLVVAQLLFLESENPEKDIS 73

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGVVTAG+AIYDTMQFIKP +ST C+GQAAS  +LLL AG  G RF LPN+R++
Sbjct: 74  LYINSPGGVVTAGLAIYDTMQFIKPDVSTLCIGQAASAAALLLCAGADGKRFCLPNSRVM 133

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG+ GQA+DIE HA++ + ++ RLN I  K+  KT +++ +  +RD+ MSA++A 
Sbjct: 134 IHQPLGGYRGQATDIEIHARETLAVRERLNNIMAKHTKKTPDQIMRDTERDNFMSATQAM 193

Query: 197 DWGVVDKVLMSR 208
           ++G++DKVL  R
Sbjct: 194 EYGLIDKVLYDR 205


>gi|118579613|ref|YP_900863.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Pelobacter
           propionicus DSM 2379]
 gi|166201831|sp|A1AN85|CLPP_PELPD RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|118502323|gb|ABK98805.1| ATP-dependent Clp protease proteolytic subunit ClpP [Pelobacter
           propionicus DSM 2379]
          Length = 199

 Score =  257 bits (656), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 117/192 (60%), Positives = 155/192 (80%)

Query: 19  VPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLY 78
           +PMVVEQ+ RGER+YDIYSRLLKERI+F+ G I+D +A LI AQLLFLEAE+P K+I LY
Sbjct: 3   IPMVVEQSGRGERAYDIYSRLLKERIIFLGGGIDDQVANLIIAQLLFLEAEDPDKDIHLY 62

Query: 79  INSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLH 138
           INSPGGVVT+GMAIYDTM++IK P+ST C+GQAASMG++LL+AGEKG RF+L ++RI++H
Sbjct: 63  INSPGGVVTSGMAIYDTMRYIKAPVSTICVGQAASMGAVLLAAGEKGKRFSLNHSRIMIH 122

Query: 139 QPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDW 198
           QP GGF GQA+DI  HA++I+++K  LN I     G++ E +E   DRD+ MSA+EA ++
Sbjct: 123 QPLGGFQGQATDISIHAKEILRMKEELNSILADLTGQSKERIEADTDRDYFMSATEAEEY 182

Query: 199 GVVDKVLMSRID 210
           G++D     + D
Sbjct: 183 GLIDATFTRKPD 194


>gi|321265634|ref|XP_003197533.1| ATP-dependent Clp protease proteolytic subunit [Cryptococcus gattii
           WM276]
 gi|317464013|gb|ADV25746.1| ATP-dependent Clp protease proteolytic subunit, putative
           [Cryptococcus gattii WM276]
          Length = 260

 Score =  257 bits (656), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 120/198 (60%), Positives = 157/198 (79%), Gaps = 8/198 (4%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+VVEQT RGERSYDIYSRLL+ER+VF+ G +    +TL+ AQLLFLEAE+P++ I L
Sbjct: 55  LVPIVVEQTARGERSYDIYSRLLRERVVFL-GPVNSQDSTLLTAQLLFLEAEDPKRPIKL 113

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+G+AIYDTMQ+I PP+ TFCMGQAASMGSLLL+ GEKG R+AL N+ +++
Sbjct: 114 YINSPGGVVTSGLAIYDTMQYISPPVHTFCMGQAASMGSLLLAGGEKGHRYALKNSSVMI 173

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEE-------VEKTLDRDHIM 190
           HQPSGG  GQASDI  HA++I++I+  L +IY ++C +  EE        EK L+RD+ M
Sbjct: 174 HQPSGGAQGQASDIALHAKEILRIRAALTDIYAEHCTRPGEERTVALDRFEKALERDYFM 233

Query: 191 SASEACDWGVVDKVLMSR 208
           ++ EA D+G+VDK++  R
Sbjct: 234 TSEEAIDFGIVDKIVTQR 251


>gi|187935559|ref|YP_001887076.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum B str. Eklund 17B]
 gi|226706444|sp|B2TPB9|CLPP_CLOBB RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|187723712|gb|ACD24933.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum B str. Eklund 17B]
          Length = 199

 Score =  257 bits (656), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 153/190 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDI+SRLLKERI+ ++G++ D  + LI +QLLFLE+E+P K+I
Sbjct: 1   MSLVPMVVEQTSRGERSYDIFSRLLKERIIMLSGEVNDDSSNLIVSQLLFLESEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S+YINSPGG +TAGMAIYDTMQ+IKP +ST C+G AASMG+ LLS+G  G R+ALPNA I
Sbjct: 61  SIYINSPGGSITAGMAIYDTMQYIKPDVSTICVGMAASMGAFLLSSGANGKRYALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI+ HA  I+KIK  LN+I  +N  +  E +E  ++RD+ M+A EA
Sbjct: 121 MIHQPLGGFQGQATDIQIHANRILKIKESLNKILSENTNQPLEVIEADVERDNFMTADEA 180

Query: 196 CDWGVVDKVL 205
             +G+VDKV+
Sbjct: 181 KTYGLVDKVI 190


>gi|125975222|ref|YP_001039132.1| ATP-dependent Clp protease proteolytic subunit ClpP [Clostridium
           thermocellum ATCC 27405]
 gi|256003116|ref|ZP_05428108.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           thermocellum DSM 2360]
 gi|281419196|ref|ZP_06250212.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           thermocellum JW20]
 gi|166201818|sp|A3DJ10|CLPP_CLOTH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|125715447|gb|ABN53939.1| ATP-dependent Clp protease proteolytic subunit ClpP [Clostridium
           thermocellum ATCC 27405]
 gi|255992807|gb|EEU02897.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           thermocellum DSM 2360]
 gi|281407062|gb|EFB37324.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           thermocellum JW20]
 gi|316939386|gb|ADU73420.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           thermocellum DSM 1313]
          Length = 194

 Score =  256 bits (655), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 117/193 (60%), Positives = 154/193 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGERSYDIYSRLLK+RI+ ++ +I D  A+L+ AQ+LFLEAE+P K+I
Sbjct: 1   MSLVPIVVEQTNRGERSYDIYSRLLKDRIIVLSDEINDVTASLVVAQMLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAG AIYDTMQ++KP +ST C+G AASMG+ LL+AG KG RFALPN+ I
Sbjct: 61  QLYINSPGGSVTAGFAIYDTMQYVKPDVSTICIGMAASMGAFLLAAGAKGKRFALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI+ HA+ I+KIK +LN I  +  G+ +E++E+  +RD  MSA EA
Sbjct: 121 MIHQPLGGARGQATDIKIHAEQIIKIKNKLNRILSERTGQPFEKIERDTERDFFMSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G+VD+V+  R
Sbjct: 181 KAYGIVDEVMERR 193


>gi|253701609|ref|YP_003022798.1| ATP-dependent Clp protease proteolytic subunit [Geobacter sp. M21]
 gi|259585955|sp|C6E2T0|CLPP_GEOSM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|251776459|gb|ACT19040.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Geobacter sp.
           M21]
          Length = 199

 Score =  256 bits (655), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 115/192 (59%), Positives = 156/192 (81%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+VVEQT RGERSYDIYSRLLK+RI+F+ G I+D++A L+ AQLLFLEAE+P K+I L
Sbjct: 2   LVPIVVEQTGRGERSYDIYSRLLKDRIIFLGGGIDDNVANLVIAQLLFLEAEDPDKDIHL 61

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVTAGMAIYDTM++IK P+ST C+GQAASMG+ LLS GEKG R++L N+RI++
Sbjct: 62  YINSPGGVVTAGMAIYDTMRYIKAPVSTICVGQAASMGAFLLSGGEKGKRYSLVNSRIMI 121

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQA+DI  HA++I+++K  LN +  ++ G++ E+V    +RD+ MS  EA +
Sbjct: 122 HQPLGGFQGQATDIHIHAKEILRMKDELNALLAEHTGQSVEKVAADTERDYFMSGEEAKN 181

Query: 198 WGVVDKVLMSRI 209
           +G++D ++   +
Sbjct: 182 YGIIDAIVTRNV 193


>gi|146295915|ref|YP_001179686.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Caldicellulosiruptor saccharolyticus DSM 8903]
 gi|166201809|sp|A4XHW0|CLPP_CALS8 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|145409491|gb|ABP66495.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 195

 Score =  256 bits (655), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 154/192 (80%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVP+V+EQTNRGER+YDIYSRLLK+RIV ++G+I D +A+LI AQLLFLEAE+P K+I 
Sbjct: 3   ALVPIVIEQTNRGERAYDIYSRLLKDRIVILSGEITDDIASLIVAQLLFLEAEDPDKDIY 62

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAG AIYDT+Q+IKP +ST C+G AASMG+ LL+AG KG RFALPN+ I+
Sbjct: 63  LYINSPGGSVTAGFAIYDTIQYIKPDVSTICVGMAASMGAFLLAAGAKGKRFALPNSEIM 122

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG  GQA+DI+ HA+ I+KIK+R+N I  +  G+  E +E+  +RD  M+A EA 
Sbjct: 123 IHQPIGGVRGQATDIKIHAEWILKIKQRINRILAERTGQPIEVIERDTERDFFMTAEEAL 182

Query: 197 DWGVVDKVLMSR 208
            +G++DKV+  R
Sbjct: 183 KYGIIDKVIERR 194


>gi|148381180|ref|YP_001255721.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum A str. ATCC 3502]
 gi|153933152|ref|YP_001385555.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum A str. ATCC 19397]
 gi|153934525|ref|YP_001388961.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum A str. Hall]
 gi|153939192|ref|YP_001392582.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum F str. Langeland]
 gi|168179119|ref|ZP_02613783.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum NCTC 2916]
 gi|168183548|ref|ZP_02618212.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum Bf]
 gi|170754567|ref|YP_001782870.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum B1 str. Okra]
 gi|226950659|ref|YP_002805750.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum A2 str. Kyoto]
 gi|237796687|ref|YP_002864239.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum Ba4 str. 657]
 gi|166201814|sp|A7FYI2|CLPP_CLOB1 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166201815|sp|A5I6W1|CLPP_CLOBH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166201816|sp|A7GIH2|CLPP_CLOBL RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|226706445|sp|B1IND7|CLPP_CLOBK RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|254763786|sp|C1FLA6|CLPP_CLOBJ RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|148290664|emb|CAL84793.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           botulinum A str. ATCC 3502]
 gi|152929196|gb|ABS34696.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum A str. ATCC 19397]
 gi|152930439|gb|ABS35938.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum A str. Hall]
 gi|152935088|gb|ABS40586.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum F str. Langeland]
 gi|169119779|gb|ACA43615.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum B1 str. Okra]
 gi|182670165|gb|EDT82141.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum NCTC 2916]
 gi|182673367|gb|EDT85328.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum Bf]
 gi|226842960|gb|ACO85626.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum A2 str. Kyoto]
 gi|229261301|gb|ACQ52334.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum Ba4 str. 657]
 gi|295320566|gb|ADG00944.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum F str. 230613]
 gi|322807545|emb|CBZ05120.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           botulinum H04402 065]
          Length = 194

 Score =  256 bits (655), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 154/190 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGERSYDIYSRLLK+RI+ ++ ++ D  A+LI AQLLFLEAE+P K+I
Sbjct: 1   MSLVPVVVEQTNRGERSYDIYSRLLKDRIIMLSEEVNDTTASLIVAQLLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +T+GMAIYDTMQ+IKP +ST C+G AASMG+ LL+AG KG R+ALPN+ +
Sbjct: 61  HLYINSPGGSITSGMAIYDTMQYIKPDVSTICVGMAASMGAFLLAAGAKGKRYALPNSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI  HA+ I+K+K++LN I     GK  E+VE   +RDH +SA EA
Sbjct: 121 MIHQPLGGFRGQATDIGIHAERILKMKKKLNTILSDRTGKPLEQVELDTERDHFLSAEEA 180

Query: 196 CDWGVVDKVL 205
            ++G++D+V+
Sbjct: 181 KEYGLIDEVI 190


>gi|187776850|ref|ZP_02993323.1| hypothetical protein CLOSPO_00389 [Clostridium sporogenes ATCC
           15579]
 gi|187775509|gb|EDU39311.1| hypothetical protein CLOSPO_00389 [Clostridium sporogenes ATCC
           15579]
          Length = 194

 Score =  256 bits (655), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 154/190 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGERSYDIYSRLLK+RI+ ++ ++ D  A+LI AQLLFLEAE+P K+I
Sbjct: 1   MSLVPVVVEQTNRGERSYDIYSRLLKDRIIMLSEEVNDTTASLIVAQLLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +T+GMAIYDTMQ+IKP +ST C+G AASMG+ LL+AG KG R+ALPN+ +
Sbjct: 61  YLYINSPGGSITSGMAIYDTMQYIKPDVSTICVGMAASMGAFLLAAGAKGKRYALPNSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI  HA+ I+K+K++LN I     GK  E+VE   +RDH +SA EA
Sbjct: 121 MIHQPLGGFRGQATDIGIHAERILKMKKKLNTILSDRTGKPLEQVELDTERDHFLSAEEA 180

Query: 196 CDWGVVDKVL 205
            ++G++D+V+
Sbjct: 181 KEYGLIDEVI 190


>gi|126668931|ref|ZP_01739872.1| ATP-dependent Clp protease proteolytic subunit [Marinobacter sp.
           ELB17]
 gi|126626594|gb|EAZ97250.1| ATP-dependent Clp protease proteolytic subunit [Marinobacter sp.
           ELB17]
          Length = 211

 Score =  256 bits (655), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 113/193 (58%), Positives = 150/193 (77%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMV+EQT RGERS+DIYSRLLKER++F+ G +EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 16  ALVPMVIEQTARGERSFDIYSRLLKERVIFMVGPVEDHMANLVVAQLLFLESENPDKDIH 75

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG V+AGM+IYDTMQFIKP ++T C+GQAASMG+ LL+ G  G R  LPN+R++
Sbjct: 76  LYINSPGGSVSAGMSIYDTMQFIKPDVATLCVGQAASMGAFLLAGGAAGKRACLPNSRVM 135

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG+ GQA+DIE H ++I+KI+  LN I   + G+  E + +  DRD+ M  ++A 
Sbjct: 136 IHQPLGGYQGQATDIEIHTREILKIRHTLNSILAHHTGQDLETISRDTDRDNFMDPTQAK 195

Query: 197 DWGVVDKVLMSRI 209
            +G++D VL  R+
Sbjct: 196 AYGLIDSVLDKRV 208


>gi|158321199|ref|YP_001513706.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Alkaliphilus
           oremlandii OhILAs]
 gi|167008645|sp|A8MIS8|CLPP_ALKOO RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|158141398|gb|ABW19710.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Alkaliphilus
           oremlandii OhILAs]
          Length = 195

 Score =  256 bits (655), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 151/192 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQTNRGERSYDIYSRLLKERI+F++ ++ D  A+L+ AQLLFLE+E+P K+I
Sbjct: 1   MALVPMVVEQTNRGERSYDIYSRLLKERIIFLSDEVNDATASLVVAQLLFLESEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +TAGMAIYDTM +IKP +ST C+G AASMG+ LL+AG+KG RFALPNA I
Sbjct: 61  QLYINSPGGSITAGMAIYDTMNYIKPDVSTICIGMAASMGAFLLTAGQKGKRFALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA DI  H + I+K++  LN+I  +  G+  E+V+K  DRD  M A EA
Sbjct: 121 MIHQPLGGTRGQAEDIRIHTERILKMRETLNKIIAERTGQPLEKVQKDTDRDFFMEAEEA 180

Query: 196 CDWGVVDKVLMS 207
             +G++D+V+ +
Sbjct: 181 RAYGIIDEVITT 192


>gi|301091655|ref|XP_002896007.1| ATP-dependent Clp protease proteolytic subunit, putative
           [Phytophthora infestans T30-4]
 gi|262095668|gb|EEY53720.1| ATP-dependent Clp protease proteolytic subunit, putative
           [Phytophthora infestans T30-4]
          Length = 221

 Score =  256 bits (655), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 115/202 (56%), Positives = 157/202 (77%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
           A++    +   LVPMV+EQ+ RGER +DIYSRLLKERIVFV G + D MA+L+ AQLLFL
Sbjct: 11  ARRGFHSIMNSLVPMVLEQSPRGERVFDIYSRLLKERIVFVHGPVNDDMASLVTAQLLFL 70

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP+K++ +YINSPGG+V++G+AIYDTMQ+I+P ++T CMGQAASMGSLLL+ G  G 
Sbjct: 71  ESENPEKDVHMYINSPGGIVSSGLAIYDTMQYIQPKVNTLCMGQAASMGSLLLAGGASGC 130

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R ALPNARI++HQPSGG  G ASDI   A++I+K++ RLN +Y  + GK  + +E+ +DR
Sbjct: 131 RSALPNARIMIHQPSGGAQGMASDIAIQAEEIIKLRTRLNGLYASHTGKPLKVIEQAMDR 190

Query: 187 DHIMSASEACDWGVVDKVLMSR 208
           D  M   EA ++G+VD ++ +R
Sbjct: 191 DLFMDPREAQEFGIVDSIIANR 212


>gi|298369365|ref|ZP_06980683.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Neisseria sp.
           oral taxon 014 str. F0314]
 gi|298283368|gb|EFI24855.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Neisseria sp.
           oral taxon 014 str. F0314]
          Length = 206

 Score =  256 bits (654), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 161/197 (81%), Gaps = 2/197 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQ+ RGER++DIYSRLLKERIVF+ G ++D  A L+ AQLLFLE+ENP K+I  
Sbjct: 9   LVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVDDQSANLVVAQLLFLESENPDKDIFF 68

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG V+AGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG RFALPN+RI++
Sbjct: 69  YINSPGGSVSAGMSIYDTMNFIKPNVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMI 128

Query: 138 HQP--SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP  SGG SGQASDIE HA++++K+K +LN +  K+CG+   ++E+  DRD+ MSA EA
Sbjct: 129 HQPLISGGLSGQASDIEIHAKELLKLKEKLNRLLAKHCGRDLADLERDTDRDNYMSAEEA 188

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G+VD+VL +R  ++
Sbjct: 189 KEYGLVDQVLENRASMQ 205


>gi|242015536|ref|XP_002428409.1| ATP-dependent Clp protease proteolytic subunit, putative [Pediculus
           humanus corporis]
 gi|212513021|gb|EEB15671.1| ATP-dependent Clp protease proteolytic subunit, putative [Pediculus
           humanus corporis]
          Length = 252

 Score =  256 bits (654), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 164/199 (82%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           L+P+V+EQT RGER+YDIYSRLLKERI+ V GQI D +++++ AQLLFL++EN +K + +
Sbjct: 41  LIPVVIEQTGRGERAYDIYSRLLKERIICVMGQIHDELSSVVIAQLLFLQSENSKKPVHM 100

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAG+ IYDTMQ+I PP++T+C+GQA SM SLLL+AG  GMR ALPNARI++
Sbjct: 101 YINSPGGSVTAGLGIYDTMQYILPPVATWCVGQACSMASLLLAAGASGMRHALPNARIMI 160

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQPSGG  GQA+DI+  A++I+K+K+++N +YVK+ G + E++E++++RD  M+ S+A +
Sbjct: 161 HQPSGGVQGQATDIQIQAEEILKLKKQINHLYVKHTGLSIEKIEQSMERDKFMNPSDAKE 220

Query: 198 WGVVDKVLMSRIDIEEKSK 216
           +G++DK+L     + EK++
Sbjct: 221 FGIIDKILNHPPKLGEKAE 239


>gi|256828014|ref|YP_003156742.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Desulfomicrobium baculatum DSM 4028]
 gi|256577190|gb|ACU88326.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Desulfomicrobium baculatum DSM 4028]
          Length = 198

 Score =  256 bits (654), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 114/191 (59%), Positives = 154/191 (80%)

Query: 22  VVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYINS 81
           V+E T RGER YDIYSRLLK+RIV +   I+DH+A  ICAQLLFLE+ENP+K+I +YINS
Sbjct: 8   VIENTGRGERMYDIYSRLLKDRIVLLGTPIDDHVANSICAQLLFLESENPEKQIYMYINS 67

Query: 82  PGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPS 141
           PGG VTAGMAIYDTMQ+I  P++T C+GQAASM ++LL+AGEKGMR+ LP++RI++HQP 
Sbjct: 68  PGGAVTAGMAIYDTMQYISAPVATLCIGQAASMAAVLLAAGEKGMRYTLPHSRIMIHQPM 127

Query: 142 GGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGVV 201
           GGF GQA+DI   A++I++++  LN I   + G+T E+VE+  +RD+ MS  EAC +G++
Sbjct: 128 GGFQGQATDIAIQAKEIIRLRGELNGILANHTGQTLEKVEQDTERDYFMSGEEACAYGLI 187

Query: 202 DKVLMSRIDIE 212
           D+VL SR ++E
Sbjct: 188 DQVLASRKELE 198


>gi|254520131|ref|ZP_05132187.1| endopeptidase Clp [Clostridium sp. 7_2_43FAA]
 gi|226913880|gb|EEH99081.1| endopeptidase Clp [Clostridium sp. 7_2_43FAA]
          Length = 198

 Score =  256 bits (654), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 153/190 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDI+SRLLK+RI+ ++G+I D  + L+ +QLLFLE+E+P K+I
Sbjct: 1   MSLVPMVVEQTSRGERSYDIFSRLLKDRIIMLSGEINDTTSNLVVSQLLFLESEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +TAGMAIYDTMQ+IKP +ST C+G AASMGS LLS+G KG RF LPN+ I
Sbjct: 61  HLYINSPGGSITAGMAIYDTMQYIKPDVSTICIGMAASMGSFLLSSGAKGKRFVLPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDI