PSIBLAST alignment of GI: 254780272 and protein with PDB id: 1tg6

gi|62738031|pdb|1TG6|A Chain A, Crystallography And Mutagenesis Point To An Essential Role For The N-Terminus Of Human Mitochondrial Clpp Length = 277
>gi|62738032|pdb|1TG6|B Chain B, Crystallography And Mutagenesis Point To An Essential Role For The N-Terminus Of Human Mitochondrial Clpp Length = 277
 Score =  232 bits (592), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 116/203 (57%), Positives = 157/203 (77%)

Query: 13  DVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQ 72
              L L+P+VVEQT RGER+YDIYSRLL+ERIV V G I+D +A+L+ AQLLFL++E+ +
Sbjct: 53  TRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNK 112

Query: 73  KEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPN 132
           K I +YINSPGGVVTAG+AIYDTMQ+I  PI T+C+GQAASMGSLLL+AG  GMR +LPN
Sbjct: 113 KPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPN 172

Query: 133 ARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSA 192
           +RI++HQPSGG  GQA+DI   A++I+K+K++L  IY K+  ++ + +E  ++RD  MS 
Sbjct: 173 SRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSP 232

Query: 193 SEACDWGVVDKVLMSRIDIEEKS 215
            EA ++G++DKVL+      E  
Sbjct: 233 MEAQEFGILDKVLVHPPQDGEDE 255