PSIBLAST alignment of GI: 254780272 and protein with PDB id: 2cby

>gi|88192658|pdb|2CBY|A Chain A, Crystal Structure Of The Atp-Dependent Clp Protease Proteolytic Subunit 1 (Clpp1) From Mycobacterium Tuberculosis Length = 208
>gi|88192659|pdb|2CBY|B Chain B, Crystal Structure Of The Atp-Dependent Clp Protease Proteolytic Subunit 1 (Clpp1) From Mycobacterium Tuberculosis Length = 208
 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 84/173 (48%), Positives = 117/173 (67%)

Query: 35  IYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYD 94
           +Y RLL ERI+F+  ++ D +A  +CAQ+L L AE+  K+ISLYINSPGG ++AGMAIYD
Sbjct: 20  VYERLLSERIIFLGSEVNDEIANRLCAQILLLAAEDASKDISLYINSPGGSISAGMAIYD 79

Query: 95  TMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERH 154
           TM      I+T+ MG AASMG  LL+AG KG R+ALP+ARIL+HQP GG +G A+DI   
Sbjct: 80  TMVLAPCDIATYAMGMAASMGEFLLAAGTKGKRYALPHARILMHQPLGGVTGSAADIAIQ 139

Query: 155 AQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGVVDKVLMS 207
           A+    IK+ +  +  +  G+  E +E   DRD   +A+EA ++G VD ++  
Sbjct: 140 AEQFAVIKKEMFRLNAEFTGQPIERIEADSDRDRWFTAAEALEYGFVDHIITR 192