PSIBLAST alignment of GI: 254780272 and protein with PDB id: 2zl3

>gi|185177785|pdb|2ZL3|A Chain A, Crystal Structure Of H.Pylori Clpp S99a Length = 196
>gi|185177786|pdb|2ZL3|B Chain B, Crystal Structure Of H.Pylori Clpp S99a Length = 196
>gi|185177787|pdb|2ZL3|C Chain C, Crystal Structure Of H.Pylori Clpp S99a Length = 196
>gi|185177788|pdb|2ZL3|D Chain D, Crystal Structure Of H.Pylori Clpp S99a Length = 196
>gi|185177789|pdb|2ZL3|E Chain E, Crystal Structure Of H.Pylori Clpp S99a Length = 196
>gi|185177790|pdb|2ZL3|F Chain F, Crystal Structure Of H.Pylori Clpp S99a Length = 196
>gi|185177791|pdb|2ZL3|G Chain G, Crystal Structure Of H.Pylori Clpp S99a Length = 196
>gi|185177792|pdb|2ZL3|H Chain H, Crystal Structure Of H.Pylori Clpp S99a Length = 196
>gi|185177793|pdb|2ZL3|I Chain I, Crystal Structure Of H.Pylori Clpp S99a Length = 196
>gi|185177794|pdb|2ZL3|J Chain J, Crystal Structure Of H.Pylori Clpp S99a Length = 196
>gi|185177795|pdb|2ZL3|K Chain K, Crystal Structure Of H.Pylori Clpp S99a Length = 196
>gi|185177796|pdb|2ZL3|L Chain L, Crystal Structure Of H.Pylori Clpp S99a Length = 196
>gi|185177797|pdb|2ZL3|M Chain M, Crystal Structure Of H.Pylori Clpp S99a Length = 196
>gi|185177798|pdb|2ZL3|N Chain N, Crystal Structure Of H.Pylori Clpp S99a Length = 196
>gi|185177799|pdb|2ZL4|A Chain A, Crystal Structure Of H.Pylori Clpp S99a In Complex With The Peptide Aaaa Length = 196
 Score =  231 bits (588), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 112/196 (57%), Positives = 155/196 (79%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
            +G +P V+E T+RGERSYDIYSRLLK+RIV ++G+I D +A+ I AQLLFLEAE+P+K+
Sbjct: 1   MMGYIPYVIENTDRGERSYDIYSRLLKDRIVLLSGEINDSVASSIVAQLLFLEAEDPEKD 60

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           I LYINSPGGV+T+G++IYDTM FI+P +ST C+GQAA+MG+ LLS G KG RF+LP++R
Sbjct: 61  IGLYINSPGGVITSGLSIYDTMNFIRPDVSTICIGQAAAMGAFLLSCGAKGKRFSLPHSR 120

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           I++HQP GG  GQASDIE  + +I+++K  +N I  +N G++ E++ K  DRD  MSA E
Sbjct: 121 IMIHQPLGGAQGQASDIEIISNEILRLKGLMNSILAQNSGQSLEQIAKDTDRDFYMSAKE 180

Query: 195 ACDWGVVDKVLMSRID 210
           A ++G++DKVL   + 
Sbjct: 181 AKEYGLIDKVLQKNVK 196