PSIBLAST alignment of GI: 254780272 and protein with PDB id: 3hln

>gi|301598440|pdb|3HLN|A Chain A, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer Disulfide Bonds Length = 193
>gi|301598441|pdb|3HLN|B Chain B, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer Disulfide Bonds Length = 193
 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 124/193 (64%), Positives = 163/193 (84%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI AQ+LFLEAENP+K+I 
Sbjct: 1   ALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIY 60

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+AG KG RF LPN+R++
Sbjct: 61  LYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVM 120

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG+ GQA+DIE H ++I+K+K R+NE+   + G++ E++E+  +RD  +SA EA 
Sbjct: 121 IHQPLGGYQGQATDIEIHCREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAV 180

Query: 197 DWGVVDKVLMSRI 209
           ++G+VD +L  R 
Sbjct: 181 EYGLVDSILTHRN 193